2XNDH

Crystal structure of bovine f1-c8 sub-complex of atp synthase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bioenergetic Cost of Making an Adenosine Triphosphate Molecule in Animal Mitochondria.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
total genus 21
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2xndH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2xndH01
3OE7H 2RQ6A 3FKSH 1JEKA 1FS0E 1BSHA 2QE7H 3EFFK 4WVZA 2CK3H 2XNDH 3OAAH 4TLFA 5FL7H 2RQ7A 2W6JH 3PJSK 2E5YA 4QMAA 5DN6I 4YXWH 1E79H 2HLDH 3OEHH 1BSNA 2WSSH 1AQTA 2V7QH 2E5TA 1H8EH 3OFNH 3USSA 4ASUH 2JDIH 1IFPA 2XOKH 4DJGA
chains in the Genus database with same CATH superfamily
2FFDA 3CCVP 3H1JE 1L0NK 3L36A 5CCHA 2KOGA 2K9JA 3L73G 3GG2A 1QVFO 1K05A 2YXRB 2OYIA 4U3FD 2A45H 5CMZA 2OTJP 4HB1A 3RGUA 1SQXE 1YBKA 2W27A 3E7KA 2Q3EA 1SFCD 1ZN5A 3G9RA 2QM7A 2OYIB 4DCKA 3L73D 1VL2A 2J58A 1JY3O 2WSCH 2WWWA 1KB9H 5AW7B 4BRYB 1JNMA 1E79H 1SQXK 1HWTC 3L70G 3VOPA 3CCSP 3FXDA 1HF9A 1KFNA 2QJPB 1SQQG 2Y9ZA 4K3AA 3RL0g 2YMYA 4D6TE 4EYYQ 4RJTA 5KJ7C 2V7QH 1GK4A 4GODA 4EOTA 3L72D 2OTLP 3I56P 4O9BA 1IFPA 1KILA 3RK2B 2H8PD 2QJKC 4IFMA 1KTMA 2L5GB 2ZYGA 1VQOP 1N73B 4PD4H 3FKSH 2XU6A 2J5UA 1KILD 2BCCJ 3HRNA 1URQD 3N4XA 2BASA 1BGYJ 2N1TD 3BCCJ 4B86A 2Q9IA 3CCEP 1JUNA 3H1HD 4DOJA 2JJLA 2N9YB 2QE7H 5KLVE 4HKZH 1X8YA 3FWNA 1NJIQ 1N7SD 1M56D 1IK7A 2RN0A 3JCUH 3OA7A 3L71E 3B5NC 3O6QB 1BCCJ 1SS1A 1BE3D 1EC5A 1T3UA 2G8YA 1L0LJ 2I1KA 2FYUG 4QMAA 1Q86Q 1VQ4P 1JY3P 2KZJA 2DW3A 3BASA 1H0TB 1LTJC 1L4AC 3CCRP 2NPSB 3CD6P 3UIAA 2JP3A 3VYIA 1DIPA 1K73Q 2Y0DA 2LXCB 1G2CA 1NTZE 1VPCA 4I2LC 3TGUE 1AJYA 2ZYAA 4KT0J 5CBOA 2LKMA 4JYCA 1QLED 1VQLP 2KNCB 1DD3A 1KILE 1DEEG 1Z56A 2LR2A 2OTKE 4OWFA 3TK1A 1N73C 2GM4A 3MIWA 2WT7B 3G71P 1J1EB 2KSEA 1PP9E 2Q6QA 1K9MQ 3IF4A 1K8AQ 3V6IA 1BGYG 3H1IG 3P8MC 4WB4A 4PJ0H 3H1LE 2FYZA 2FXPA 4PV1C 1IFIA 3BCCE 3EFFK 3QWOC 1URQA 3FGAD 5GTIE 3H1HG 4GOFA 1VF5D 2H88C 1N7LA 2M0BA 2I1JA 4OGQD 2ZJSE 2ZAEB 3C8VA 2M5AB 3OJAB 3P32A 2KZIA 2V4HA 4PD4D 1KB9D 3Q5SA 3I5CA 1GZLA 5AW8B 1JTHA 5KAIE 2N1TB 1LTAC 1U7JA 1X79B 1JCDA 2W8ZA 4WY4B 3V2PA 4EIJA 4C7NA 1W2BO 2AEFA 3OFNH 2PP6A 2B9BA 3Q5RA 4IL6E 1SQQD 2RKLA 3BCCG 1NTZJ 1RH5B 3H1LG 5L8RJ 3WUTA 1YJNP 3CX5I 1ZXGA 5AVZB 1KC8Q 1SFCA 3KPEA 4H0LC 1W5CE 2NPSD 1MUUA 3TNUA 3PH0A 3CMAP 1OW6A 2CK3H 2XNDH 1IJDB 3VP9A 3TNUB 3HE4A 5KKZC 3H1JD 3IFMA 4GT1A 1P84H 5TISE 2Q7CA 3M9HA 2XDJA 1NAFA 1GTWA 4YXWH 2A06E 3TF5A 3Q5PA 1H89A 3AE6C 1GW3A 3CWBD 2YKOA 5APVA 3OW2O 1SQXD 1NTMD 3MD0A 3CCUP 4WY4C 1KMIZ 4H13B 1FJPA 1SQBJ 1M1KQ 1HUCA 2NRGA 1J2JB 2O1JA 3AEFC 3MHVA 1VQ5P 3MTUE 2P7JA 3RK2C 2WITA 2ZT9D 2E76C 5KLIC 4BXLA 5B5EE 2E76B 4WBAA 1GDTA 1UIXA 5AW3B 4C7NB 4JYBA 5B66E 4ZMDA 2FKWB 2QJYC 3L4FA 1U57A 1RY3A 1VQ8P 1L4AA 1RF1A 2B88A 1A02J 3BRVB 1KYOH 1FBMA 1ZRTE 1SQPJ 1NO4A 2Z5IA 4TLFA 2OARA 1NKNA 3CX5D 3KZIH 2OYHA 1RF1B 3JC22 2HFED 1S5LH 4D6TG 3CWBE 2YKPA 1CSBA 3Q1MA 2MJZA 3B5NB 1KZUB 1L0LG 1KFMA 2D2CD 2IZ0A 2QIWA 3EWKA 3L72E 5AVXB 2XKMA 3CC4P 3EQ2A 3TGUJ 1Y47A 1LTIC 3LIEA 2CPBA 2R44A 3L70J 2B87B 3L75J 3L74D 1JO5A 3SFEC 1AFOA 2HG5D 2KNCA 2QG4A 2Q1KA 3KQGA 4AUWA 2E74D 3MZWB 2BCCG 5KAFE 1YIJP 2IZ1A 2FBWC 4L76A 4U3FE 2P1JA 5CJ4A 1PPJG 4KJMA 2Y0EA 1M90Q 2NPSA 2E42A 1JCCA 5CBNA 3QH9A 3D70A 1L4AD 1MFTA 5DN6I 2YO2A 3P8CD 1SQPK 5M1BA 3L75G 4NPFX 5KLVJ 1SQVG 1PIXA 1SQQJ 2G3AA 4ASWA 1EDKA 3HD7C 2HYNA 2O01H 1SQPE 3L71J 1RQVA 2HLDH 1SQBG 3AECC 3FXEA 3M0DC 2N1TC 1LTTC 2KS1B 1AQTA 2C9LY 1KN7A 1RF0C 1HGVA 1NTKD 3IN6A 1H8EH 1JM0A 1X22A 1H88A 1JMMA 1ZOYC 2I8DA 2K88A 1FDIA 5AW5B 1Q7YQ 1PV3A 1NTKK 1OVRA 1PGJA 3S4RA 2IFNA 1KB9E 4PD4I 2ITAA 1HGZA 4XA4A 3VMYA 1IFMA 2YMKA 1SP4A 1EZVI 3H1IE 4Y99C 3FX0A 2A45G 4HJGH 4YTPC 2QVAA 2R32A 5APSA 1ZW0A 1NWQA 2J59M 1JB0J 1KV4A 3V4WA 1R5LA 1DEBA 3N7NA 5AVRB 4H0LB 1RHZB 2PAJA 3VN0A 2FYNB 3IAOA 5AW2B 3MUDA 1WRGA 5FL7H 1NTZG 2KK7A 2WPQA 3MP7B 1NOHA 5E79H 1VQ9P 5AVTB 1FDMA 1YTZT 2K9JB 3A0HH 3CX5H 3VMAA 1NTKG 3A3YB 1VQ6P 2YKQA 1GU5A 2ZXEB 5KTBA 3OEHH 1EZVD 1S4XA 1M8OB 5TJHA 1LTBC 2C0WA 2YIUC 4I1LA 5AVWB 1T8ZA 3NTNA 1QVGO 2K3RA 1GL2C 3H6PA 4UB8E 1DD4A 1NTKJ 3CCMP 4D6TJ 3G6EP 3I55P 1YQ4C 1OVUA 3RK3C 1HJ0A 4W7YA 5GTHE 4DT0A 3C1LA 5CHXA 3VMZA 1N7SA 1H0TA 1PZQA 4XE5B 3GLMA 4H13D 3AE4C 1IK9A 1FS0E 2HR3A 2JR8A 1LJ2A 1NU1G 1OWAA 2GUVA 1EQ7A 2IBZG 2M3BA 2Z5HA 3NMDA 4I7ZC 2OYOA 4N3YB 1ZLLA 1J1DC 1USEA 5CCGA 1LT9A 2E75B 3A0BH 3BRTB 5AW6B 2D2CB 3CMEP 3FWLA 1OMIA 1Q82Q 2ZYDA 3CXHH 3H32A 3L70E 4IFFA 2E75D 3MGNA 3BCCD 3B4SA 3H1HJ 1RE3A 2E5TA 1LGHB 1N7SB 2RMZA 2YIUB 3KYQA 4YXDC 3H1KE 1L0LK 1N73A 3CI9A 2Y0CA 1IZNB 2Q5UA 1D7MA 4WWIA 4Z1MH 2XOKH 2HODA 2KP8A 2XZRA 3L75E 4C7RA 3AE2C 1FZGA 1KB9I 3AEBC 4PD4E 1YI2P 1JY2N 3BATA 2GA1A 3RL0C 2VRSA 1FC2C 3V2NA 3D6YA 1PPJE 3CXHI 3CCJP 3Q2YA 3KDPB 5KAIH 2WMMA 1EDLA 4U3FG 3H1JG 1YJWP 2WPVB 3VP8A 5AW1B 2FXOA 1PGPA 3PTZA 2BCCE 1BSHA 4I7ZB 3L74J 1J1EC 1ZV8A 2KUBA 1ZR4A 1S72P 1RE4A 3PP5A 2O3JA 2OYHB 1MZ9A 2N9BA 1PP9D 2JWAA 1FU1A 2D2CC 2IBZI 1LNQA 1BCCE 4UB6H 5APQA 2W6AA 1P84D 3F5HA 3WU2H 3L73E 1X9VA 2HPCA 3CWBG 1VQKP 2KI7B 3CPWO 3V2QA 1SQQK 5C39A 5AVUB 2FFDC 1JY3N 2K1AA 2WSEH 2JO1A 2CPSA 3S9OA 5TISH 1PFIA 1AA0A 3U1CA 1NU1J 3HE5B 1R8EA 2KIKA 3JSVC 1S2EA 2B89A 3D6ZA 3LW5H 3LIDA 1NU1E 1GL2A 1YHQP 2KS1A 3Q3DA 1AV1A 2IBZD 1Y8AA 4RESB 4AYCA 1KQGB 1L2PA 2NZ2A 3G3ZA 4PJ0E 1BE3G 2KSJA 3M0DA 3AEDC 3GHGC 4U3FJ 5CCGD 3B5ND 3ITKA 5GTIH 4W80A 1HH0A 5APYA 5CCHD 3HTKA 3GHGA 4GDOA 1SQPD 3T97A 1EDJA 1OXZA 1G1IA 1NVOA 4Y28J 1YJ9P 2OYHC 3GF7A 3HD7B 5H2FH 1URQC 3PLNA 5AVYB 1S1CX 1FDOA 2FYNC 3SFDC 3A5TA 2GUSA 1FOSE 1SQVK 3PRJA 1NTKE 2HLOA 4ZNCA 1KILC 1EZVG 1VQMP 1L0NJ 2POHA 4R4LA 3RK3D 5CCHC 2P2UA 2R3CA 4IL6H 2B87A 2ZXXA 1L0NE 3HUSA 4JQ0D 1GD2E 1VQNP 1LWUC 4RKUJ 2W83C 1IFNA 1S5LE 3AEAC 1IFDA 3H1JJ 1P84I 1FZBA 1YYCA 3HUSC 3TYYA 5APTA 2WVRA 2LXBA 3AE5C 3AE8C 1Q81Q 4WY4A 2YXQB 3H1LD 4OH8B 1BGYD 2E74B 1H8AA 4N78E 1SQXJ 3B5NA 1OVVA 4RO0A 1X0TA 3L35A 2UWJE 2AXTH 2V7QJ 1NAYA 2L91A 3OAAH 4L73A 1M7LA 1EXIA 5DJUB 1CI6A 1L4AB 2QJPC 3PJSK 2E5YA 1LP1B 1G1JA 3WMM0 1IC2A 1FJKA 1KQLA 1J1DB 1LTGC 1JMBA 2WSCJ 3H25A 3CC2P 1RF1C 2FYUJ 4KHXA 4OGQC 3CWBJ 3PHLA 3RBZA 3H1KJ 2H89C 1M57D 4YPCA 4TT3H 1BDCA 2PGDA 4LC1A 1RF0A 4PV1D 2JDIH 3H1ID 1U7MA 3W67A 4ASUH 1Y9BA 2R5DA 3ZDMA 1JY2P 1PP9J 1JY2O 1G2CB 1EDIA 1OW8A 3RL0B 1N86A 2WZ7A 2RQ6A 4N78D 2E43A 1S9KD 1PP9G 1NHLA 1S3JA 3H1LJ 3W68A 5KLIB 3L74E 4ASVA 1NGMB 1CW5A 3SWFA 4JBZA 1LTJA 1KYOE 3R4YA 2JEEA 3M06A 1LTJB 3TGUG 4U7JA 3O6QA 2NPSC 2O1KA 2E75C 1OFCX 1MV8A 1NTZD 3HE4B 3M91A 3MUDC 3L73J 3O8ZA 1QGKB 1EZVE 2P10A 3AEGC 3KHUA 3L72G 1HVVA 2M3EA 4H0LD 4HH2A 4ZKPA 1KQFB 1L0LE 4HYTB 1YQ3C 2BEZF 2QM8A 4BWNA 3CC7P 3VMXA 2A45I 2ZT9B 1SFCB 3V4QA 2WTYA 1SFCC 3F89A 1FZAA 1N7SC 3GMAA 3L72J 3P7KA 3R2PA 3LW5J 3L71G 2W90A 4H44C 4I6MC 4D6TD 3SSUA 1N8RQ 1QL2A 2QRXA 2N1TA 3JCUE 1JTHB 1PGOA 2KLVA 2OQQA 3CLQA 3OAKA 2YO3A 5KLVG 2H43A 1BE3E 1TU3F 5AVVB 4LGDE 4GOEA 4JF7A 4W7ZA 2YNYA 1JEKA 1LP1A 2BCCD 3RBXA 5AW4B 3D71A 1KYOD 3M9QA 3II6A 1ZRTD 4UB8H 2SPZA 2BEQD 5CCGC 2M5AA 3GF3A 1SQBD 1IFJA 4K35A 3A2AA 1R5SA 3E1RA 1HTLC 1NU1D 3AE3C 3B8EB 2W6JH 5GTHH 2OYIC 2KXPB 1LT9C 5BU5A 1GU4A 1P84E 1URQB 1SQVD 1SQQE 4H44D 2FXMA 3RL0D 1WT6A 4JPZB 1FZEA 2A06G 3ABVC 1IO4A 1BCCG 1T6AA 2PFXA 1UIIA 3E1IA 2ZT9C 4AQRD 1MKMA 3AE1C 1KORA 1FOSF 1XTGB 1YTZI 2WQYC 4M3LA 1T3JA 4H44B 1M1JA 2IYPA 2JWDA 2PRRA 2Q3IA 3A0BE 3HD7D 3SWKA 2HODB 2H7HA 1CZQA 1NH4A 2O01J 2QJYB 2QJKB 3WUUA 5BVZA 3HUSB 4IFDK 1M1JC 2FY8A 3GW6A 3L74G 3CXHE 3WUVA 3P8CE 1USDA 3RK3B 4GIFA 1JOCA 5AW9B 1NTMJ 5B66H 4NPDA 1VDFA 5BU8B 1VQ7P 1HJBA 1RE4C 1VF5B 2W6BA 3GHGB 1OW7A 2WSEJ 3V5BA 2XNXA 1KQSO 1QX8A 3L75D 3VTPC 3AEEC 1LTSC 2E74C 5E79E 5CJ0A 4C46A 3H1KG 2WPSA 2QEXP 3T97B 2RQ7A 1GMJA 1SQBK 2ZVNB 2M8RA 3AE7C 2R5BA 4CPGA 1MFZA 5KAFH 2Z4EA 3M0AA 3IR9A 2AEMA 4IL6X 1KILB 2IPPA 1Q2NA 2IDBA 1T2KC 4XFJA 4A7PA 4OGQB 1FE6A 3H1HE 5AVSB 2KB7P 5KJ7D 5KLVD 4DZOA 4OVNF 2JKVA 1AQ5A 3U1AA 1SLQA 1BDDA 2IBZE 1N2DC 4DJGA 1GL2D 2K9YA 3WU2E 1BGYE 1Q90D 2AEJA 2R3SA 1NTMK 3KXDA 4N6JA 4EDFA 1RE3C 1FAVA 5KJ7A 4BRYA 3EFGA 5AVQB 3H1KD 2HPCB 2AXCA 4IOIH 1E5WA 2RH0A 4PV1B 2IFMA 3V2RA 1CI6B 1SVFA 1VF5C 1NTME 3U59A 3AE9C 1OX3A 4WVZA 1YITP 5AW0B 1L0NG 1T2KD 3G4SP 2OGUA 1NYHA 2P67A 1PPJD 2C0XA 1A02F 1XTCC 5B5EH 2FYUK 3C9IA 1GW4A 3SWYA 1AVOA 3A7OA 3TDKA 2WT7A 1VQPP 3M9BA 3RK3E 1AVYA 2IX7C 3K5BA 2QSIA 2K37A 2WSSH 1FZCA 2FFDB 1GK6A 1L0ND 5K5GB 4MN4C 2FYUE 4NPEA 3S1KA 5DJTB 1FZFA 1KYOI 4Y99B 1ZR2A 1EXJA 1OIPA 2XV5A 3TGUD 1BCCD 1BE3J 1NTMG 3CCLP 1L0LD 1LWUA 3KZIE 5APUA 3H32B 3L71D 5H2FE 5KLVK 1DX7A 3OE7H 1HBWA 3NXSA 4LLHA 1K04A 1KD1Q 1LT1A 1OZHA 3HD7A 1ZP0C 2C9NY 1WMKA 3HTKB 1NU1K 1NKZB 4GKGA 2IYOA 2Y9YA 1PL5A 2E76D 4L75A 4WY4D 3RK2D 5EFWB 1LT9B 1ZMEC 4ZKUA 5APXA 3CXHD 1W2EA 3L37A 4UB6E 2ZFCA 4R4MA 5KKZB 1GL2B 2WSFJ 2ZVOB 1NTZK 3A0HE 2MKVA 3CX5E 3TSIA 2FYUD 2KLUA 1BSNA 2WPRA 3BVHA 1LWUB 1PGQA 1SQBE 2A06D 3HE5A 2AXTE 2QA4P 1SQPG 1QEXA 2P58A 2WSFH 4H13C 3NFQA 3CL3D 3B71A 4L74A 4EI2A 3L70D 3CCQP 1FZCC 1RQUA 1DH3A 3USSA 5APWA 1S5LX 1SQVE 2O01N 3H1IJ 1SQXG 2KYVA 1S9KE 1M1JB 1SQVJ 1FZCB 1QL1A
chains in the Genus database with same CATH topology
3OE7H 2RQ6A 3FKSH 1JEKA 1FS0E 1BSHA 2QE7H 3EFFK 4WVZA 2CK3H 2XNDH 3OAAH 4TLFA 5FL7H 2RQ7A 2W6JH 3PJSK 2E5YA 4QMAA 5DN6I 4YXWH 1E79H 2HLDH 3OEHH 1BSNA 2WSSH 1AQTA 2V7QH 2E5TA 1H8EH 3OFNH 3USSA 4ASUH 2JDIH 1IFPA 2XOKH 4DJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OE7 H;  2RQ6 A;  3FKS H;  1JEK A;  1FS0 E;  1BSH A;  2QE7 H;  3EFF K;  4WVZ A;  2CK3 H;  2XND H;  3OAA H;  4TLF A;  5FL7 H;  2RQ7 A;  2W6J H;  3PJS K;  2E5Y A;  4QMA A;  5DN6 I;  4YXW H;  1E79 H;  2HLD H;  3OEH H;  1BSN A;  2WSS H;  1AQT A;  2V7Q H;  2E5T A;  1H8E H;  3OFN H;  3USS A;  4ASU H;  2JDI H;  1IFP A;  2XOK H;  4DJG A; 
#chains in the Genus database with same CATH topology
 2FFD A;  3CCV P;  3H1J E;  1L0N K;  3L36 A;  5CCH A;  2KOG A;  2K9J A;  3L73 G;  3GG2 A;  1QVF O;  1K05 A;  2YXR B;  2OYI A;  4U3F D;  2A45 H;  5CMZ A;  2OTJ P;  4HB1 A;  3RGU A;  1SQX E;  1YBK A;  2W27 A;  3E7K A;  2Q3E A;  1SFC D;  1ZN5 A;  3G9R A;  2QM7 A;  2OYI B;  4DCK A;  3L73 D;  1VL2 A;  2J58 A;  1JY3 O;  2WSC H;  2WWW A;  1KB9 H;  5AW7 B;  4BRY B;  1JNM A;  1E79 H;  1SQX K;  1HWT C;  3L70 G;  3VOP A;  3CCS P;  3FXD A;  1HF9 A;  1KFN A;  2QJP B;  1SQQ G;  2Y9Z A;  4K3A A;  3RL0 g;  2YMY A;  4D6T E;  4EYY Q;  4RJT A;  5KJ7 C;  2V7Q H;  1GK4 A;  4GOD A;  4EOT A;  3L72 D;  2OTL P;  3I56 P;  4O9B A;  1IFP A;  1KIL A;  3RK2 B;  2H8P D;  2QJK C;  4IFM A;  1KTM A;  2L5G B;  2ZYG A;  1VQO P;  1N73 B;  4PD4 H;  3FKS H;  2XU6 A;  2J5U A;  1KIL D;  2BCC J;  3HRN A;  1URQ D;  3N4X A;  2BAS A;  1BGY J;  2N1T D;  3BCC J;  4B86 A;  2Q9I A;  3CCE P;  1JUN A;  3H1H D;  4DOJ A;  2JJL A;  2N9Y B;  2QE7 H;  5KLV E;  4HKZ H;  1X8Y A;  3FWN A;  1NJI Q;  1N7S D;  1M56 D;  1IK7 A;  2RN0 A;  3JCU H;  3OA7 A;  3L71 E;  3B5N C;  3O6Q B;  1BCC J;  1SS1 A;  1BE3 D;  1EC5 A;  1T3U A;  2G8Y A;  1L0L J;  2I1K A;  2FYU G;  4QMA A;  1Q86 Q;  1VQ4 P;  1JY3 P;  2KZJ A;  2DW3 A;  3BAS A;  1H0T B;  1LTJ C;  1L4A C;  3CCR P;  2NPS B;  3CD6 P;  3UIA A;  2JP3 A;  3VYI A;  1DIP A;  1K73 Q;  2Y0D A;  2LXC B;  1G2C A;  1NTZ E;  1VPC A;  4I2L C;  3TGU E;  1AJY A;  2ZYA A;  4KT0 J;  5CBO A;  2LKM A;  4JYC A;  1QLE D;  1VQL P;  2KNC B;  1DD3 A;  1KIL E;  1DEE G;  1Z56 A;  2LR2 A;  2OTK E;  4OWF A;  3TK1 A;  1N73 C;  2GM4 A;  3MIW A;  2WT7 B;  3G71 P;  1J1E B;  2KSE A;  1PP9 E;  2Q6Q A;  1K9M Q;  3IF4 A;  1K8A Q;  3V6I A;  1BGY G;  3H1I G;  3P8M C;  4WB4 A;  4PJ0 H;  3H1L E;  2FYZ A;  2FXP A;  4PV1 C;  1IFI A;  3BCC E;  3EFF K;  3QWO C;  1URQ A;  3FGA D;  5GTI E;  3H1H G;  4GOF A;  1VF5 D;  2H88 C;  1N7L A;  2M0B A;  2I1J A;  4OGQ D;  2ZJS E;  2ZAE B;  3C8V A;  2M5A B;  3OJA B;  3P32 A;  2KZI A;  2V4H A;  4PD4 D;  1KB9 D;  3Q5S A;  3I5C A;  1GZL A;  5AW8 B;  1JTH A;  5KAI E;  2N1T B;  1LTA C;  1U7J A;  1X79 B;  1JCD A;  2W8Z A;  4WY4 B;  3V2P A;  4EIJ A;  4C7N A;  1W2B O;  2AEF A;  3OFN H;  2PP6 A;  2B9B A;  3Q5R A;  4IL6 E;  1SQQ D;  2RKL A;  3BCC G;  1NTZ J;  1RH5 B;  3H1L G;  5L8R J;  3WUT A;  1YJN P;  3CX5 I;  1ZXG A;  5AVZ B;  1KC8 Q;  1SFC A;  3KPE A;  4H0L C;  1W5C E;  2NPS D;  1MUU A;  3TNU A;  3PH0 A;  3CMA P;  1OW6 A;  2CK3 H;  2XND H;  1IJD B;  3VP9 A;  3TNU B;  3HE4 A;  5KKZ C;  3H1J D;  3IFM A;  4GT1 A;  1P84 H;  5TIS E;  2Q7C A;  3M9H A;  2XDJ A;  1NAF A;  1GTW A;  4YXW H;  2A06 E;  3TF5 A;  3Q5P A;  1H89 A;  3AE6 C;  1GW3 A;  3CWB D;  2YKO A;  5APV A;  3OW2 O;  1SQX D;  1NTM D;  3MD0 A;  3CCU P;  4WY4 C;  1KMI Z;  4H13 B;  1FJP A;  1SQB J;  1M1K Q;  1HUC A;  2NRG A;  1J2J B;  2O1J A;  3AEF C;  3MHV A;  1VQ5 P;  3MTU E;  2P7J A;  3RK2 C;  2WIT A;  2ZT9 D;  2E76 C;  5KLI C;  4BXL A;  5B5E E;  2E76 B;  4WBA A;  1GDT A;  1UIX A;  5AW3 B;  4C7N B;  4JYB A;  5B66 E;  4ZMD A;  2FKW B;  2QJY C;  3L4F A;  1U57 A;  1RY3 A;  1VQ8 P;  1L4A A;  1RF1 A;  2B88 A;  1A02 J;  3BRV B;  1KYO H;  1FBM A;  1ZRT E;  1SQP J;  1NO4 A;  2Z5I A;  4TLF A;  2OAR A;  1NKN A;  3CX5 D;  3KZI H;  2OYH A;  1RF1 B;  3JC2 2;  2HFE D;  1S5L H;  4D6T G;  3CWB E;  2YKP A;  1CSB A;  3Q1M A;  2MJZ A;  3B5N B;  1KZU B;  1L0L G;  1KFM A;  2D2C D;  2IZ0 A;  2QIW A;  3EWK A;  3L72 E;  5AVX B;  2XKM A;  3CC4 P;  3EQ2 A;  3TGU J;  1Y47 A;  1LTI C;  3LIE A;  2CPB A;  2R44 A;  3L70 J;  2B87 B;  3L75 J;  3L74 D;  1JO5 A;  3SFE C;  1AFO A;  2HG5 D;  2KNC A;  2QG4 A;  2Q1K A;  3KQG A;  4AUW A;  2E74 D;  3MZW B;  2BCC G;  5KAF E;  1YIJ P;  2IZ1 A;  2FBW C;  4L76 A;  4U3F E;  2P1J A;  5CJ4 A;  1PPJ G;  4KJM A;  2Y0E A;  1M90 Q;  2NPS A;  2E42 A;  1JCC A;  5CBN A;  3QH9 A;  3D70 A;  1L4A D;  1MFT A;  5DN6 I;  2YO2 A;  3P8C D;  1SQP K;  5M1B A;  3L75 G;  4NPF X;  5KLV J;  1SQV G;  1PIX A;  1SQQ J;  2G3A A;  4ASW A;  1EDK A;  3HD7 C;  2HYN A;  2O01 H;  1SQP E;  3L71 J;  1RQV A;  2HLD H;  1SQB G;  3AEC C;  3FXE A;  3M0D C;  2N1T C;  1LTT C;  2KS1 B;  1AQT A;  2C9L Y;  1KN7 A;  1RF0 C;  1HGV A;  1NTK D;  3IN6 A;  1H8E H;  1JM0 A;  1X22 A;  1H88 A;  1JMM A;  1ZOY C;  2I8D A;  2K88 A;  1FDI A;  5AW5 B;  1Q7Y Q;  1PV3 A;  1NTK K;  1OVR A;  1PGJ A;  3S4R A;  2IFN A;  1KB9 E;  4PD4 I;  2ITA A;  1HGZ A;  4XA4 A;  3VMY A;  1IFM A;  2YMK A;  1SP4 A;  1EZV I;  3H1I E;  4Y99 C;  3FX0 A;  2A45 G;  4HJG H;  4YTP C;  2QVA A;  2R32 A;  5APS A;  1ZW0 A;  1NWQ A;  2J59 M;  1JB0 J;  1KV4 A;  3V4W A;  1R5L A;  1DEB A;  3N7N A;  5AVR B;  4H0L B;  1RHZ B;  2PAJ A;  3VN0 A;  2FYN B;  3IAO A;  5AW2 B;  3MUD A;  1WRG A;  5FL7 H;  1NTZ G;  2KK7 A;  2WPQ A;  3MP7 B;  1NOH A;  5E79 H;  1VQ9 P;  5AVT B;  1FDM A;  1YTZ T;  2K9J B;  3A0H H;  3CX5 H;  3VMA A;  1NTK G;  3A3Y B;  1VQ6 P;  2YKQ A;  1GU5 A;  2ZXE B;  5KTB A;  3OEH H;  1EZV D;  1S4X A;  1M8O B;  5TJH A;  1LTB C;  2C0W A;  2YIU C;  4I1L A;  5AVW B;  1T8Z A;  3NTN A;  1QVG O;  2K3R A;  1GL2 C;  3H6P A;  4UB8 E;  1DD4 A;  1NTK J;  3CCM P;  4D6T J;  3G6E P;  3I55 P;  1YQ4 C;  1OVU A;  3RK3 C;  1HJ0 A;  4W7Y A;  5GTH E;  4DT0 A;  3C1L A;  5CHX A;  3VMZ A;  1N7S A;  1H0T A;  1PZQ A;  4XE5 B;  3GLM A;  4H13 D;  3AE4 C;  1IK9 A;  1FS0 E;  2HR3 A;  2JR8 A;  1LJ2 A;  1NU1 G;  1OWA A;  2GUV A;  1EQ7 A;  2IBZ G;  2M3B A;  2Z5H A;  3NMD A;  4I7Z C;  2OYO A;  4N3Y B;  1ZLL A;  1J1D C;  1USE A;  5CCG A;  1LT9 A;  2E75 B;  3A0B H;  3BRT B;  5AW6 B;  2D2C B;  3CME P;  3FWL A;  1OMI A;  1Q82 Q;  2ZYD A;  3CXH H;  3H32 A;  3L70 E;  4IFF A;  2E75 D;  3MGN A;  3BCC D;  3B4S A;  3H1H J;  1RE3 A;  2E5T A;  1LGH B;  1N7S B;  2RMZ A;  2YIU B;  3KYQ A;  4YXD C;  3H1K E;  1L0L K;  1N73 A;  3CI9 A;  2Y0C A;  1IZN B;  2Q5U A;  1D7M A;  4WWI A;  4Z1M H;  2XOK H;  2HOD A;  2KP8 A;  2XZR A;  3L75 E;  4C7R A;  3AE2 C;  1FZG A;  1KB9 I;  3AEB C;  4PD4 E;  1YI2 P;  1JY2 N;  3BAT A;  2GA1 A;  3RL0 C;  2VRS A;  1FC2 C;  3V2N A;  3D6Y A;  1PPJ E;  3CXH I;  3CCJ P;  3Q2Y A;  3KDP B;  5KAI H;  2WMM A;  1EDL A;  4U3F G;  3H1J G;  1YJW P;  2WPV B;  3VP8 A;  5AW1 B;  2FXO A;  1PGP A;  3PTZ A;  2BCC E;  1BSH A;  4I7Z B;  3L74 J;  1J1E C;  1ZV8 A;  2KUB A;  1ZR4 A;  1S72 P;  1RE4 A;  3PP5 A;  2O3J A;  2OYH B;  1MZ9 A;  2N9B A;  1PP9 D;  2JWA A;  1FU1 A;  2D2C C;  2IBZ I;  1LNQ A;  1BCC E;  4UB6 H;  5APQ A;  2W6A A;  1P84 D;  3F5H A;  3WU2 H;  3L73 E;  1X9V A;  2HPC A;  3CWB G;  1VQK P;  2KI7 B;  3CPW O;  3V2Q A;  1SQQ K;  5C39 A;  5AVU B;  2FFD C;  1JY3 N;  2K1A A;  2WSE H;  2JO1 A;  2CPS A;  3S9O A;  5TIS H;  1PFI A;  1AA0 A;  3U1C A;  1NU1 J;  3HE5 B;  1R8E A;  2KIK A;  3JSV C;  1S2E A;  2B89 A;  3D6Z A;  3LW5 H;  3LID A;  1NU1 E;  1GL2 A;  1YHQ P;  2KS1 A;  3Q3D A;  1AV1 A;  2IBZ D;  1Y8A A;  4RES B;  4AYC A;  1KQG B;  1L2P A;  2NZ2 A;  3G3Z A;  4PJ0 E;  1BE3 G;  2KSJ A;  3M0D A;  3AED C;  3GHG C;  4U3F J;  5CCG D;  3B5N D;  3ITK A;  5GTI H;  4W80 A;  1HH0 A;  5APY A;  5CCH D;  3HTK A;  3GHG A;  4GDO A;  1SQP D;  3T97 A;  1EDJ A;  1OXZ A;  1G1I A;  1NVO A;  4Y28 J;  1YJ9 P;  2OYH C;  3GF7 A;  3HD7 B;  5H2F H;  1URQ C;  3PLN A;  5AVY B;  1S1C X;  1FDO A;  2FYN C;  3SFD C;  3A5T A;  2GUS A;  1FOS E;  1SQV K;  3PRJ A;  1NTK E;  2HLO A;  4ZNC A;  1KIL C;  1EZV G;  1VQM P;  1L0N J;  2POH A;  4R4L A;  3RK3 D;  5CCH C;  2P2U A;  2R3C A;  4IL6 H;  2B87 A;  2ZXX A;  1L0N E;  3HUS A;  4JQ0 D;  1GD2 E;  1VQN P;  1LWU C;  4RKU J;  2W83 C;  1IFN A;  1S5L E;  3AEA C;  1IFD A;  3H1J J;  1P84 I;  1FZB A;  1YYC A;  3HUS C;  3TYY A;  5APT A;  2WVR A;  2LXB A;  3AE5 C;  3AE8 C;  1Q81 Q;  4WY4 A;  2YXQ B;  3H1L D;  4OH8 B;  1BGY D;  2E74 B;  1H8A A;  4N78 E;  1SQX J;  3B5N A;  1OVV A;  4RO0 A;  1X0T A;  3L35 A;  2UWJ E;  2AXT H;  2V7Q J;  1NAY A;  2L91 A;  3OAA H;  4L73 A;  1M7L A;  1EXI A;  5DJU B;  1CI6 A;  1L4A B;  2QJP C;  3PJS K;  2E5Y A;  1LP1 B;  1G1J A;  3WMM 0;  1IC2 A;  1FJK A;  1KQL A;  1J1D B;  1LTG C;  1JMB A;  2WSC J;  3H25 A;  3CC2 P;  1RF1 C;  2FYU J;  4KHX A;  4OGQ C;  3CWB J;  3PHL A;  3RBZ A;  3H1K J;  2H89 C;  1M57 D;  4YPC A;  4TT3 H;  1BDC A;  2PGD A;  4LC1 A;  1RF0 A;  4PV1 D;  2JDI H;  3H1I D;  1U7M A;  3W67 A;  4ASU H;  1Y9B A;  2R5D A;  3ZDM A;  1JY2 P;  1PP9 J;  1JY2 O;  1G2C B;  1EDI A;  1OW8 A;  3RL0 B;  1N86 A;  2WZ7 A;  2RQ6 A;  4N78 D;  2E43 A;  1S9K D;  1PP9 G;  1NHL A;  1S3J A;  3H1L J;  3W68 A;  5KLI B;  3L74 E;  4ASV A;  1NGM B;  1CW5 A;  3SWF A;  4JBZ A;  1LTJ A;  1KYO E;  3R4Y A;  2JEE A;  3M06 A;  1LTJ B;  3TGU G;  4U7J A;  3O6Q A;  2NPS C;  2O1K A;  2E75 C;  1OFC X;  1MV8 A;  1NTZ D;  3HE4 B;  3M91 A;  3MUD C;  3L73 J;  3O8Z A;  1QGK B;  1EZV E;  2P10 A;  3AEG C;  3KHU A;  3L72 G;  1HVV A;  2M3E A;  4H0L D;  4HH2 A;  4ZKP A;  1KQF B;  1L0L E;  4HYT B;  1YQ3 C;  2BEZ F;  2QM8 A;  4BWN A;  3CC7 P;  3VMX A;  2A45 I;  2ZT9 B;  1SFC B;  3V4Q A;  2WTY A;  1SFC C;  3F89 A;  1FZA A;  1N7S C;  3GMA A;  3L72 J;  3P7K A;  3R2P A;  3LW5 J;  3L71 G;  2W90 A;  4H44 C;  4I6M C;  4D6T D;  3SSU A;  1N8R Q;  1QL2 A;  2QRX A;  2N1T A;  3JCU E;  1JTH B;  1PGO A;  2KLV A;  2OQQ A;  3CLQ A;  3OAK A;  2YO3 A;  5KLV G;  2H43 A;  1BE3 E;  1TU3 F;  5AVV B;  4LGD E;  4GOE A;  4JF7 A;  4W7Z A;  2YNY A;  1JEK A;  1LP1 A;  2BCC D;  3RBX A;  5AW4 B;  3D71 A;  1KYO D;  3M9Q A;  3II6 A;  1ZRT D;  4UB8 H;  2SPZ A;  2BEQ D;  5CCG C;  2M5A A;  3GF3 A;  1SQB D;  1IFJ A;  4K35 A;  3A2A A;  1R5S A;  3E1R A;  1HTL C;  1NU1 D;  3AE3 C;  3B8E B;  2W6J H;  5GTH H;  2OYI C;  2KXP B;  1LT9 C;  5BU5 A;  1GU4 A;  1P84 E;  1URQ B;  1SQV D;  1SQQ E;  4H44 D;  2FXM A;  3RL0 D;  1WT6 A;  4JPZ B;  1FZE A;  2A06 G;  3ABV C;  1IO4 A;  1BCC G;  1T6A A;  2PFX A;  1UII A;  3E1I A;  2ZT9 C;  4AQR D;  1MKM A;  3AE1 C;  1KOR A;  1FOS F;  1XTG B;  1YTZ I;  2WQY C;  4M3L A;  1T3J A;  4H44 B;  1M1J A;  2IYP A;  2JWD A;  2PRR A;  2Q3I A;  3A0B E;  3HD7 D;  3SWK A;  2HOD B;  2H7H A;  1CZQ A;  1NH4 A;  2O01 J;  2QJY B;  2QJK B;  3WUU A;  5BVZ A;  3HUS B;  4IFD K;  1M1J C;  2FY8 A;  3GW6 A;  3L74 G;  3CXH E;  3WUV A;  3P8C E;  1USD A;  3RK3 B;  4GIF A;  1JOC A;  5AW9 B;  1NTM J;  5B66 H;  4NPD A;  1VDF A;  5BU8 B;  1VQ7 P;  1HJB A;  1RE4 C;  1VF5 B;  2W6B A;  3GHG B;  1OW7 A;  2WSE J;  3V5B A;  2XNX A;  1KQS O;  1QX8 A;  3L75 D;  3VTP C;  3AEE C;  1LTS C;  2E74 C;  5E79 E;  5CJ0 A;  4C46 A;  3H1K G;  2WPS A;  2QEX P;  3T97 B;  2RQ7 A;  1GMJ A;  1SQB K;  2ZVN B;  2M8R A;  3AE7 C;  2R5B A;  4CPG A;  1MFZ A;  5KAF H;  2Z4E A;  3M0A A;  3IR9 A;  2AEM A;  4IL6 X;  1KIL B;  2IPP A;  1Q2N A;  2IDB A;  1T2K C;  4XFJ A;  4A7P A;  4OGQ B;  1FE6 A;  3H1H E;  5AVS B;  2KB7 P;  5KJ7 D;  5KLV D;  4DZO A;  4OVN F;  2JKV A;  1AQ5 A;  3U1A A;  1SLQ A;  1BDD A;  2IBZ E;  1N2D C;  4DJG A;  1GL2 D;  2K9Y A;  3WU2 E;  1BGY E;  1Q90 D;  2AEJ A;  2R3S A;  1NTM K;  3KXD A;  4N6J A;  4EDF A;  1RE3 C;  1FAV A;  5KJ7 A;  4BRY A;  3EFG A;  5AVQ B;  3H1K D;  2HPC B;  2AXC A;  4IOI H;  1E5W A;  2RH0 A;  4PV1 B;  2IFM A;  3V2R A;  1CI6 B;  1SVF A;  1VF5 C;  1NTM E;  3U59 A;  3AE9 C;  1OX3 A;  4WVZ A;  1YIT P;  5AW0 B;  1L0N G;  1T2K D;  3G4S P;  2OGU A;  1NYH A;  2P67 A;  1PPJ D;  2C0X A;  1A02 F;  1XTC C;  5B5E H;  2FYU K;  3C9I A;  1GW4 A;  3SWY A;  1AVO A;  3A7O A;  3TDK A;  2WT7 A;  1VQP P;  3M9B A;  3RK3 E;  1AVY A;  2IX7 C;  3K5B A;  2QSI A;  2K37 A;  2WSS H;  1FZC A;  2FFD B;  1GK6 A;  1L0N D;  5K5G B;  4MN4 C;  2FYU E;  4NPE A;  3S1K A;  5DJT B;  1FZF A;  1KYO I;  4Y99 B;  1ZR2 A;  1EXJ A;  1OIP A;  2XV5 A;  3TGU D;  1BCC D;  1BE3 J;  1NTM G;  3CCL P;  1L0L D;  1LWU A;  3KZI E;  5APU A;  3H32 B;  3L71 D;  5H2F E;  5KLV K;  1DX7 A;  3OE7 H;  1HBW A;  3NXS A;  4LLH A;  1K04 A;  1KD1 Q;  1LT1 A;  1OZH A;  3HD7 A;  1ZP0 C;  2C9N Y;  1WMK A;  3HTK B;  1NU1 K;  1NKZ B;  4GKG A;  2IYO A;  2Y9Y A;  1PL5 A;  2E76 D;  4L75 A;  4WY4 D;  3RK2 D;  5EFW B;  1LT9 B;  1ZME C;  4ZKU A;  5APX A;  3CXH D;  1W2E A;  3L37 A;  4UB6 E;  2ZFC A;  4R4M A;  5KKZ B;  1GL2 B;  2WSF J;  2ZVO B;  1NTZ K;  3A0H E;  2MKV A;  3CX5 E;  3TSI A;  2FYU D;  2KLU A;  1BSN A;  2WPR A;  3BVH A;  1LWU B;  1PGQ A;  1SQB E;  2A06 D;  3HE5 A;  2AXT E;  2QA4 P;  1SQP G;  1QEX A;  2P58 A;  2WSF H;  4H13 C;  3NFQ A;  3CL3 D;  3B71 A;  4L74 A;  4EI2 A;  3L70 D;  3CCQ P;  1FZC C;  1RQU A;  1DH3 A;  3USS A;  5APW A;  1S5L X;  1SQV E;  2O01 N;  3H1I J;  1SQX G;  2KYV A;  1S9K E;  1M1J B;  1SQV J;  1FZC B;  1QL1 A; 
#chains in the Genus database with same CATH homology
 3OE7 H;  2RQ6 A;  3FKS H;  1JEK A;  1FS0 E;  1BSH A;  2QE7 H;  3EFF K;  4WVZ A;  2CK3 H;  2XND H;  3OAA H;  4TLF A;  5FL7 H;  2RQ7 A;  2W6J H;  3PJS K;  2E5Y A;  4QMA A;  5DN6 I;  4YXW H;  1E79 H;  2HLD H;  3OEH H;  1BSN A;  2WSS H;  1AQT A;  2V7Q H;  2E5T A;  1H8E H;  3OFN H;  3USS A;  4ASU H;  2JDI H;  1IFP A;  2XOK H;  4DJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...