2XNDH

Crystal structure of bovine f1-c8 sub-complex of atp synthase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title Bioenergetic Cost of Making an Adenosine Triphosphate Molecule in Animal Mitochondria.
pubmed doi rcsb
total genus 21
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2xndH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2xndH01
3OEHH 2QE7H 1FS0E 3EFFK 2XNDH 4DJGA 5FL7H 2E5YA 4YXWH 2HLDH 2RQ7A 2CK3H 3OE7H 3PJSK 4ASUH 3OFNH 4TLFA 1AQTA 4WVZA 1BSHA 1JEKA 2V7QH 2XOKH 1E79H 1BSNA 3FKSH 3OAAH 2JDIH 2RQ6A 2E5TA 1IFPA 1H8EH 2WSSH 2W6JH 4QMAA 3USSA 5DN6I
chains in the Genus database with same CATH superfamily
1OVVA 4GIFA 1U57A 1BGYD 1N86A 2HG5D 1KILB 1NTMK 3CD6P 5EFWB 1OWAA 1JCCA 1T8ZA 2Q7CA 3AEGC 1NTKG 1URQA 2N9YB 2FBWC 4IOIH 3U1AA 1KV4A 3H1KJ 3PP5A 1EDLA 1BE3D 1AA0A 2D2CD 2IFMA 1W2EA 3P32A 1JY3O 3BASA 3EWKA 1ZLLA 3CLQA 1JY2N 1SQBG 2WSEH 1KN7A 1ZR4A 1PP9J 3A0BE 1J1DC 3A2AA 3OW2O 1PGPA 4ASUH 2I8DA 1M7LA 3TSIA 3G71P 3L74D 2KK7A 2OTJP 1HF9A 2Z5HA 1SQXD 2IYOA 4W7YA 3L71D 5TISE 3L37A 3JSVC 1FZBA 5AW1B 2XKMA 1VF5C 2NZ2A 2KZJA 3RK3E 1RE3C 1IFMA 1KYOD 2WT7A 2HPCB 1G1IA 2WPVB 4N78D 3NMDA 1FC2C 4OH8B 3F89A 3AEBC 1CZQA 3G3ZA 1LT1A 1SQVJ 5M1BA 2RN0A 4JPZB 2RQ7A 5AW9B 1L4AD 5CCGD 1BCCE 3HUSB 3CPWO 5B66E 1H8AA 1SQQG 2E75B 2KSJA 3GF3A 1URQC 3K5BA 1SFCC 3H1HE 2WITA 3U59A 3TK1A 1NO4A 1VQKP 3I56P 3A0HH 2YKPA 2A45H 4M3LA 1UIIA 5AW5B 2FYUK 3O6QA 2BEZF 3JCUH 2IBZD 1BGYG 2NPSA 3B5NA 1OIPA 2QG4A 2LKMA 3MIWA 1FE6A 3L72D 1JCDA 1P84H 4JQ0D 3F5HA 1J1DB 1NTMJ 3M0DA 3VN0A 4MN4C 1VQ9P 2VRSA 3MUDA 2FYNB 2RQ6A 4Y99B 1BE3G 5KJ7A 3TGUD 3BCCD 1S9KE 3CI9A 1GD2E 3A7OA 5BVZA 2ITAA 1FZCA 1FDOA 1HVVA 4XE5B 4HH2A 2R5DA 4GODA 1FOSF 2BCCE 3U1CA 3S4RA 1OZHA 1WMKA 4OVNF 1NTZE 3V4WA 1VF5D 3AEAC 1NKNA 1X79B 1EZVD 1LT9A 3L71G 2IZ1A 2M5AA 2QJKB 3TDKA 1M1JA 2YNYA 1NTZK 2KB7P 1LP1A 1MKMA 2QJPB 3CC7P 1JMBA 1URQD 1R5LA 1SFCD 1TU3F 4N3YB 3CL3D 2NPSC 3B5NC 1KD1Q 3M9QA 3AE3C 4D6TD 4WB4A 3AE7C 3KHUA 3B8EB 3NFQA 4O9BA 1PP9G 3RL0B 2QEXP 3E7KA 1QL2A 2B87B 3M0DC 4U7JA 1BSHA 4RJTA 1FDIA 3T97A 1YHQP 1GW3A 1VQLP 1GK4A 2WTYA 1EXIA 5APXA 2O1KA 5KJ7C 2XDJA 4EOTA 1FZCC 4W80A 3C1LA 1LWUB 2H88C 2J59M 4I7ZC 4DZOA 2PAJA 1KYOH 2FYUJ 3AEEC 1T3JA 1VQ6P 4WY4A 1T3UA 1X0TA 4BRYA 3CWBJ 1NHLA 1QEXA 3L73D 4DJGA 3PRJA 3RL0g 1AJYA 3FWNA 1L0NG 4C46A 1LT9C 4C7NB 3BCCG 1SQVG 3H1JG 2CPBA 4Z1MH 1JEKA 1LTBC 2KXPB 3CMEP 2HODB 4U3FG 2Q5UA 1NAYA 1JUNA 4HYTB 4CPGA 1QLED 1KB9I 4DCKA 1YYCA 3L36A 1PZQA 3H32B 1RF1B 2RH0A 3ZDMA 3WU2H 3HD7C 1LJ2A 3SSUA 5TJHA 1ZR2A 1SQPK 4YTPC 1PV3A 1EZVG 1BCCD 1GU5A 1EDKA 1GMJA 1M8OB 3W68A 1FZGA 4I6MC 3ABVC 1NTMG 2BCCJ 1LTSC 1PIXA 2NPSD 4L76A 5CHXA 3RBZA 1YITP 1JTHB 1T2KC 4XFJA 3H1KE 3GW6A 2QJYB 2BEQD 2C0XA 1NU1J 5CBOA 3S1KA 1AQ5A 1W5CE 3PHLA 2G3AA 2V4HA 5KJ7D 1H8EH 2AXCA 4JBZA 3KQGA 4HKZH 4EDFA 3TYYA 1PP9E 2WWWA 2M3EA 1NTKD 2XNDH 5AW2B 1S1CX 1VQMP 3M91A 2IYPA 3VP9A 2IX7C 3OFNH 2OYHC 2Q3EA 1MFZA 2FY8A 1S9KD 2E76B 3M9BA 1KORA 4C7RA 5FL7H 5BU5A 5CCHA 3AEFC 1PGQA 5APSA 5H2FE 2L91A 4WVZA 1IFIA 5KKZB 1KFMA 4ASWA 1E5WA 5AW6B 2Q3IA 2PFXA 4GDOA 1LTIC 1NWQA 1FAVA 1L0LJ 1HJBA 1GL2A 2XNXA 3L70J 2A06E 5APUA 2WSCJ 3HD7D 2JDIH 3E1IA 3MGNA 1YQ4C 1KB9E 4OGQB 1FBMA 3G9RA 2P67A 2OYOA 2YIUC 3RK2B 1OX3A 1OXZA 3RGUA 3CCJP 3AE1C 1VDFA 5KLVK 1PPJE 2AXTE 2C9LY 2V7QH 1IFJA 3HE5A 3CX5I 2W6AA 3A0BH 4PV1B 2FYUG 2WVRA 1T2KD 1Q2NA 3BRTB 2O3JA 4PD4E 1SQPJ 1KTMA 3H1HG 1VQ4P 2W90A 3CWBG 2FFDB 3CCRP 1QGKB 4IL6X 2L5GB 1NTME 1NGMB 5AVVB 5TISH 1DEBA 1SP4A 2N1TC 1JY2P 2Y9ZA 1YBKA 3V6IA 2XU6A 2YO2A 3GMAA 2D2CB 2R44A 2AEMA 2P58A 1RQUA 3AE8C 2W6BA 4IFFA 1KC8Q 2FKWB 3HRNA 1XTCC 2HYNA 1GL2C 2LXBA 2GM4A 2E74C 1OMIA 2O01J 3VMZA 3N4XA 1LTJA 2C0WA 2W83C 1GTWA 3GHGC 3V2NA 1YJNP 1N73B 2BCCG 3Q5SA 5L8RJ 5E79E 1J1EB 1AVOA 1G2CB 3P7KA 1JMMA 4BXLA 2IFNA 1NTZG 2AEJA 2OYIA 2J58A 5K5GB 5KLIB 3HTKB 2B87A 5GTIE 2WPSA 1NOHA 1K04A 1KQLA 1OW7A 1N7SA 2KS1A 3FXEA 3QWOC 4IFDK 1JY2O 5APQA 2YXRB 1HGVA 1Y9BA 2R32A 5APWA 4YXDC 3H1KD 1T6AA 1L4AB 1MUUA 4R4MA 3W67A 2A45I 1W2BO 2QA4P 2QM7A 1RE4A 1YTZT 4B86A 3CX5E 4YPCA 5KLVJ 2RKLA 1ZW0A 2FYUE 1PP9D 3CWBE 2N1TD 2KNCB 3I5CA 1KFNA 3CCUP 4H0LC 1NVOA 3H1LJ 4AYCA 3MZWB 1FZFA 1HWTC 1LTJC 3KYQA 4EIJA 2IZ0A 3NXSA 1OW8A 2M8RA 1A02J 3H32A 3EFFK 3P8MC 1RF1A 3PLNA 3OAKA 2QVAA 2E74D 2G8YA 2K9JB 1VL2A 4WBAA 3WUUA 2OYIC 1A02F 1L0ND 4BWNA 4L74A 1BDCA 1SQVD 3H1JD 1KQFB 1RHZB 3KDPB 4RESB 4ZMDA 1N7SC 4U3FD 1SQPG 1JTHA 1KB9D 1VF5B 2HLOA 2K1AA 4LLHA 3VTPC 4H44C 4HB1A 1RE4C 3RK3C 2MJZA 1PPJD 1KMIZ 5KAFE 4NPFX 4D6TJ 1JOCA 1NU1E 4AQRD 1YQ3C 2Y0EA 3V2QA 2UWJE 3G4SP 1X8YA 1NJIQ 3AE5C 1NTMD 1URQB 2O1JA 1SFCB 4KHXA 2W27A 3H1KG 4XA4A 3HE4B 3CXHI 3MD0A 2Q6QA 3TNUB 1NU1K 4ZNCA 1NH4A 2W8ZA 2KP8A 3JCUE 2KI7B 1KQGB 3FX0A 3L73J 1QVFO 1LTGC 1Y47A 1DX7A 1Q81Q 1E79H 3MUDC 4ASVA 2J5UA 1IO4A 5KAIH 3QH9A 1L0LE 2E5YA 2KLUA 3L70E 4NPDA 4A7PA 1YI2P 3CCEP 3LIEA 3IF4A 1L2PA 1MZ9A 2WT7B 1DIPA 1N7SD 3S9OA 1L0LK 2DW3A 3A5TA 4GKGA 1H88A 4IFMA 5B5EE 5KLVG 3KPEA 2FFDA 2B88A 2A06G 2C9NY 4HJGH 4I1LA 1AV1A 4H44D 1M1JC 1ZRTE 1SQPE 3RK3D 1VQOP 2WSEJ 5AVZB 3CC2P 1KILE 1JB0J 3D71A 2KUBA 3H1LG 1PL5A 4UB6E 1PPJG 3USSA 5AVQB 3L75J 2OGUA 3O6QB 3R4YA 3CX5D 1KILA 2ZAEB 1QX8A 2Y0CA 2NPSB 2P7JA 2FYUD 3B5NB 2HFED 4PD4I 1AQTA 5GTHE 1OFCX 3H1HD 3CWBD 3LIDA 3V2RA 1YJ9P 1FZEA 1SS1A 1EXJA 3B5ND 3RBXA 2ZYGA 3CXHE 1VQ5P 3PTZA 2I1JA 4PJ0H 1ZOYC 1Q7YQ 1SQBJ 1EQ7A 1FZCB 2ZXXA 1KB9H 3VMYA 2Q9IA 1EDJA 4WY4C 4I7ZB 5AW4B 4RKUJ 3FWLA 1SQXK 2PP6A 2YMKA 3V5BA 1NAFA 2AXTH 1HTLC 3HTKA 2ZT9C 2FXOA 1Q82Q 1LT9B 2W6JH 2I1KA 4H13C 3VYIA 2M5AB 3A3YB 2HPCA 4YXWH 3AE4C 2Q1KA 2BCCD 3Q3DA 1LP1B 3BRVB 1VQNP 3MTUE 3D6ZA 1FJKA 1NTZD 2JJLA 2IBZE 3HD7B 1KILC 3HUSA 3H1IJ 1NU1D 1YTZI 3L35A 3JC22 1SQQJ 3O8ZA 2ZJSE 5KLVE 1VQPP 3L72E 3CMAP 2H89C 1IK9A 1HH0A 1J2JB 5AW7B 3KZIE 3AECC 2GUVA 2Y9YA 3H1LE 1X9VA 5APTA 1ZMEC 1BGYJ 5AVSB 2KIKA 2O01N 2E5TA 3CCSP 1GU4A 2FXMA 2K9JA 2GUSA 5AW0B 2IPPA 4KJMA 3M0AA 1OVUA 5CMZA 4UB8E 2JR8A 1K8AQ 1BE3J 1WRGA 1Q90D 3FGAD 4WY4D 3VOPA 2OYHB 5GTIH 1L0LD 2ZVOB 5DN6I 5CBNA 3L70D 5DJUB 3IN6A 5CCHC 1USDA 3SWYA 3WUTA 1S5LE 1M1KQ 2ZT9D 3C9IA 5AVTB 2AEFA 3WMM0 1JY3N 1RY3A 3BATA 1OVRA 2WQYC 3AE6C 1SVFA 3L74J 4H13D 2B9BA 1FS0E 1SQXJ 3CX5H 1K9MQ 3HUSC 3BVHA 3L71J 3L75G 1HBWA 1FZAA 5B66H 4D6TE 2E75C 1ZV8A 2WPRA 1CSBA 3CCLP 5AVRB 3G6EP 1SFCA 1SQPD 1ZRTD 4R4LA 3CCQP 2CPSA 1KILD 3HE4A 2HR3A 1NKZB 3TNUA 1UIXA 2XZRA 2KYVA 3SFDC 5AVYB 2YIUB 2KOGA 3MP7B 2M3BA 1N2DC 1ZP0C 2KSEA 4IL6E 1RH5B 3I55P 1NU1G 3EQ2A 2KLVA 1S3JA 1Z56A 4K35A 2FYNC 3L73E 1VPCA 3LW5H 4Y99C 2Z5IA 2P1JA 2OARA 3IFMA 3CXHD 3V4QA 2A45G 1LWUA 2MKVA 1HGZA 5CJ0A 2N1TB 5AVWB 2E43A 2QSIA 3L72J 1P84I 4JYCA 2ZVNB 5KAFH 1L0NJ 2JP3A 5CCHD 4C7NA 3TGUJ 3BCCJ 3H1JJ 1CI6B 2ZYDA 1EDIA 1DH3A 2BASA 2WSFH 3H1IG 1IC2A 2HODA 2QJKC 4U3FJ 1RF0A 4I2LC 1L0LG 3P8CE 3FKSH 1GL2B 2QIWA 1H0TB 3L70G 2E74B 1K73Q 4GT1A 2QJPC 4ZKPA 2H8PD 5AW8B 3PH0A 3GF7A 3GHGB 1GL2D 2E75D 2OTKE 3VMXA 2RMZA 1PGOA 1IFNA 2KZIA 1IFDA 3SFEC 3L75E 3RL0C 2R3CA 2QE7H 3HE5B 5KLVD 4NPEA 2A06D 1N7LA 3TF5A 1NTKE 2POHA 2CK3H 1GK6A 1MFTA 2JKVA 3UIAA 2YKOA 4AUWA 1M90Q 2Z4EA 4QMAA 1LWUC 3SWKA 1XTGB 3H1LD 2M0BA 4L73A 2JO1A 1JNMA 2OTLP 2HLDH 1U7JA 2WSCH 1GDTA 3OE7H 1NTKK 3Q5PA 1SQBE 3VMAA 3CCVP 3MHVA 3OA7A 3CC4P 4PD4D 5DJTB 3AE9C 1AVYA 2K37A 3L74G 3CCMP 1H89A 1DD3A 1SQXG 5B5EH 4TLFA 3L4FA 1PFIA 1RF0C 3OJAB 1SQBK 2YMYA 3A0HE 4H0LB 1S4XA 1ZN5A 2FXPA 2V7QJ 4EI2A 1LTJB 1R5SA 2R3SA 3OEHH 1RF1C 2JEEA 1KYOI 2WMMA 5KTBA 4H0LD 3D70A 3D6YA 2FYZA 1P84E 4UB6H 1GW4A 3HD7A 1LGHB 4JYBA 1LTAC 1R8EA 2P10A 2OYIB 1VQ8P 3H1IE 1GZLA 1DD4A 1SQQE 1USEA 5GTHH 1PGJA 2K9YA 1IZNB 1N7SB 2KS1B 2XOKH 4DOJA 1JO5A 5CJ4A 2IDBA 2QJYC 3B4SA 3CXHH 4GOFA 3RL0D 1EC5A 1FDMA 2PRRA 3M9HA 2O01H 2WZ7A 1SQQK 2IBZG 1FJPA 2N9BA 4H44B 2IBZI 4JF7A 1BGYE 1Q86Q 1BCCJ 3RK3B 3FXDA 1YJWP 3H1HJ 2WSSH 3L72G 4N6JA 1S2EA 4Y28J 1RQVA 2OYHA 3TGUG 3H6PA 1ZXGA 1BE3E 2YXQB 1N8RQ 2E76C 3GG2A 1YIJP 1S72P 2ZXEB 4WWIA 4LC1A 2YKQA 1D7MA 3SWFA 2XV5A 5KKZC 2P2UA 5H2FH 1JM0A 1NTKJ 4DT0A 3EFGA 2LXCB 3LW5J 1K05A 3Q2YA 2GA1A 2WPQA 4K3AA 1Y8AA 3L74E 3GLMA 3V2PA 1BDDA 1SQXE 1DEEG 1EZVI 3L71E 5KAIE 3P8CD 3WUVA 3PJSK 3VP8A 3IR9A 4OGQC 2YO3A 1QL1A 1N73A 3B71A 3KZIH 3RK2C 3N7NA 2ZYAA 1KYOE 1G2CA 2H7HA 1KZUB 4N78E 1NTZJ 1X22A 2ZFCA 4W7ZA 1KQSO 4PV1C 3Q1MA 3L75D 3OAAH 2WSFJ 2H43A 4D6TG 1IFPA 1FU1A 4PD4H 2FFDC 4LGDE 1G1JA 5AVXB 1LTTC 4UB8H 2JWAA 5AW3B 3AE2C 2SPZA 2NRGA 1M1JB 1CW5A 1L4AA 5CCGA 1IK7A 3ITKA 5AVUB 1WT6A 2LR2A 2B89A 2K88A 2QM8A 3WU2E 1HUCA 2N1TA 3E1RA 3Q5RA 4KT0J 1SQBD 1M57D 1S5LH 2E42A 5C39A 2D2CC 4OWFA 1QVGO 1NYHA 2KNCA 2E76D 4GOEA 3L73G 1CI6A 1L0NE 3II6A 3KXDA 5BU8B 2JWDA 3T97B 3TGUE 3BCCE 2K3RA 1SQVE 1S5LX 3H1JE 1U7MA 1H0TA 2QRXA 2R5BA 1LNQA 4PJ0E 4U3FE 3IAOA 1N73C 3NTNA 1BSNA 1J1EC 3GHGA 5E79H 5APYA 1M56D 4EYYQ 4WY4B 1JY3P 1L0NK 2PGDA 4BRYB 3M06A 1OW6A 1P84D 1SQVK 4IL6H 5KLIC 4OGQD 1VQ7P 3RK2D 3AEDC 1BCCG 1EZVE 1HJ0A 4L75A 4RO0A 3H1ID 4TT3H 1SQQD 4ZKUA 2ZT9B 2Y0DA 5APVA 1RE3A 4H13B 4PV1D 1L4AC 5CCGC 1SLQA 2OQQA 1MV8A 3C8VA 1AFOA 3H25A 1FOSE 3R2PA 1IJDB
chains in the Genus database with same CATH topology
3OEHH 2QE7H 1FS0E 3EFFK 2XNDH 4DJGA 5FL7H 2E5YA 4YXWH 2HLDH 2RQ7A 2CK3H 3OE7H 3PJSK 4ASUH 3OFNH 4TLFA 1AQTA 4WVZA 1BSHA 1JEKA 2V7QH 2XOKH 1E79H 1BSNA 3FKSH 3OAAH 2JDIH 2RQ6A 2E5TA 1IFPA 1H8EH 2WSSH 2W6JH 4QMAA 3USSA 5DN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEH H;  2QE7 H;  1FS0 E;  3EFF K;  2XND H;  4DJG A;  5FL7 H;  2E5Y A;  4YXW H;  2HLD H;  2RQ7 A;  2CK3 H;  3OE7 H;  3PJS K;  4ASU H;  3OFN H;  4TLF A;  1AQT A;  4WVZ A;  1BSH A;  1JEK A;  2V7Q H;  2XOK H;  1E79 H;  1BSN A;  3FKS H;  3OAA H;  2JDI H;  2RQ6 A;  2E5T A;  1IFP A;  1H8E H;  2WSS H;  2W6J H;  4QMA A;  3USS A;  5DN6 I; 
#chains in the Genus database with same CATH topology
 1OVV A;  4GIF A;  1U57 A;  1BGY D;  1N86 A;  2HG5 D;  1KIL B;  1NTM K;  3CD6 P;  5EFW B;  1OWA A;  1JCC A;  1T8Z A;  2Q7C A;  3AEG C;  1NTK G;  1URQ A;  2N9Y B;  2FBW C;  4IOI H;  3U1A A;  1KV4 A;  3H1K J;  3PP5 A;  1EDL A;  1BE3 D;  1AA0 A;  2D2C D;  2IFM A;  1W2E A;  3P32 A;  1JY3 O;  3BAS A;  3EWK A;  1ZLL A;  3CLQ A;  1JY2 N;  1SQB G;  2WSE H;  1KN7 A;  1ZR4 A;  1PP9 J;  3A0B E;  1J1D C;  3A2A A;  3OW2 O;  1PGP A;  4ASU H;  2I8D A;  1M7L A;  3TSI A;  3G71 P;  3L74 D;  2KK7 A;  2OTJ P;  1HF9 A;  2Z5H A;  1SQX D;  2IYO A;  4W7Y A;  3L71 D;  5TIS E;  3L37 A;  3JSV C;  1FZB A;  5AW1 B;  2XKM A;  1VF5 C;  2NZ2 A;  2KZJ A;  3RK3 E;  1RE3 C;  1IFM A;  1KYO D;  2WT7 A;  2HPC B;  1G1I A;  2WPV B;  4N78 D;  3NMD A;  1FC2 C;  4OH8 B;  3F89 A;  3AEB C;  1CZQ A;  3G3Z A;  1LT1 A;  1SQV J;  5M1B A;  2RN0 A;  4JPZ B;  2RQ7 A;  5AW9 B;  1L4A D;  5CCG D;  1BCC E;  3HUS B;  3CPW O;  5B66 E;  1H8A A;  1SQQ G;  2E75 B;  2KSJ A;  3GF3 A;  1URQ C;  3K5B A;  1SFC C;  3H1H E;  2WIT A;  3U59 A;  3TK1 A;  1NO4 A;  1VQK P;  3I56 P;  3A0H H;  2YKP A;  2A45 H;  4M3L A;  1UII A;  5AW5 B;  2FYU K;  3O6Q A;  2BEZ F;  3JCU H;  2IBZ D;  1BGY G;  2NPS A;  3B5N A;  1OIP A;  2QG4 A;  2LKM A;  3MIW A;  1FE6 A;  3L72 D;  1JCD A;  1P84 H;  4JQ0 D;  3F5H A;  1J1D B;  1NTM J;  3M0D A;  3VN0 A;  4MN4 C;  1VQ9 P;  2VRS A;  3MUD A;  2FYN B;  2RQ6 A;  4Y99 B;  1BE3 G;  5KJ7 A;  3TGU D;  3BCC D;  1S9K E;  3CI9 A;  1GD2 E;  3A7O A;  5BVZ A;  2ITA A;  1FZC A;  1FDO A;  1HVV A;  4XE5 B;  4HH2 A;  2R5D A;  4GOD A;  1FOS F;  2BCC E;  3U1C A;  3S4R A;  1OZH A;  1WMK A;  4OVN F;  1NTZ E;  3V4W A;  1VF5 D;  3AEA C;  1NKN A;  1X79 B;  1EZV D;  1LT9 A;  3L71 G;  2IZ1 A;  2M5A A;  2QJK B;  3TDK A;  1M1J A;  2YNY A;  1NTZ K;  2KB7 P;  1LP1 A;  1MKM A;  2QJP B;  3CC7 P;  1JMB A;  1URQ D;  1R5L A;  1SFC D;  1TU3 F;  4N3Y B;  3CL3 D;  2NPS C;  3B5N C;  1KD1 Q;  3M9Q A;  3AE3 C;  4D6T D;  4WB4 A;  3AE7 C;  3KHU A;  3B8E B;  3NFQ A;  4O9B A;  1PP9 G;  3RL0 B;  2QEX P;  3E7K A;  1QL2 A;  2B87 B;  3M0D C;  4U7J A;  1BSH A;  4RJT A;  1FDI A;  3T97 A;  1YHQ P;  1GW3 A;  1VQL P;  1GK4 A;  2WTY A;  1EXI A;  5APX A;  2O1K A;  5KJ7 C;  2XDJ A;  4EOT A;  1FZC C;  4W80 A;  3C1L A;  1LWU B;  2H88 C;  2J59 M;  4I7Z C;  4DZO A;  2PAJ A;  1KYO H;  2FYU J;  3AEE C;  1T3J A;  1VQ6 P;  4WY4 A;  1T3U A;  1X0T A;  4BRY A;  3CWB J;  1NHL A;  1QEX A;  3L73 D;  4DJG A;  3PRJ A;  3RL0 g;  1AJY A;  3FWN A;  1L0N G;  4C46 A;  1LT9 C;  4C7N B;  3BCC G;  1SQV G;  3H1J G;  2CPB A;  4Z1M H;  1JEK A;  1LTB C;  2KXP B;  3CME P;  2HOD B;  4U3F G;  2Q5U A;  1NAY A;  1JUN A;  4HYT B;  4CPG A;  1QLE D;  1KB9 I;  4DCK A;  1YYC A;  3L36 A;  1PZQ A;  3H32 B;  1RF1 B;  2RH0 A;  3ZDM A;  3WU2 H;  3HD7 C;  1LJ2 A;  3SSU A;  5TJH A;  1ZR2 A;  1SQP K;  4YTP C;  1PV3 A;  1EZV G;  1BCC D;  1GU5 A;  1EDK A;  1GMJ A;  1M8O B;  3W68 A;  1FZG A;  4I6M C;  3ABV C;  1NTM G;  2BCC J;  1LTS C;  1PIX A;  2NPS D;  4L76 A;  5CHX A;  3RBZ A;  1YIT P;  1JTH B;  1T2K C;  4XFJ A;  3H1K E;  3GW6 A;  2QJY B;  2BEQ D;  2C0X A;  1NU1 J;  5CBO A;  3S1K A;  1AQ5 A;  1W5C E;  3PHL A;  2G3A A;  2V4H A;  5KJ7 D;  1H8E H;  2AXC A;  4JBZ A;  3KQG A;  4HKZ H;  4EDF A;  3TYY A;  1PP9 E;  2WWW A;  2M3E A;  1NTK D;  2XND H;  5AW2 B;  1S1C X;  1VQM P;  3M91 A;  2IYP A;  3VP9 A;  2IX7 C;  3OFN H;  2OYH C;  2Q3E A;  1MFZ A;  2FY8 A;  1S9K D;  2E76 B;  3M9B A;  1KOR A;  4C7R A;  5FL7 H;  5BU5 A;  5CCH A;  3AEF C;  1PGQ A;  5APS A;  5H2F E;  2L91 A;  4WVZ A;  1IFI A;  5KKZ B;  1KFM A;  4ASW A;  1E5W A;  5AW6 B;  2Q3I A;  2PFX A;  4GDO A;  1LTI C;  1NWQ A;  1FAV A;  1L0L J;  1HJB A;  1GL2 A;  2XNX A;  3L70 J;  2A06 E;  5APU A;  2WSC J;  3HD7 D;  2JDI H;  3E1I A;  3MGN A;  1YQ4 C;  1KB9 E;  4OGQ B;  1FBM A;  3G9R A;  2P67 A;  2OYO A;  2YIU C;  3RK2 B;  1OX3 A;  1OXZ A;  3RGU A;  3CCJ P;  3AE1 C;  1VDF A;  5KLV K;  1PPJ E;  2AXT E;  2C9L Y;  2V7Q H;  1IFJ A;  3HE5 A;  3CX5 I;  2W6A A;  3A0B H;  4PV1 B;  2FYU G;  2WVR A;  1T2K D;  1Q2N A;  3BRT B;  2O3J A;  4PD4 E;  1SQP J;  1KTM A;  3H1H G;  1VQ4 P;  2W90 A;  3CWB G;  2FFD B;  3CCR P;  1QGK B;  4IL6 X;  2L5G B;  1NTM E;  1NGM B;  5AVV B;  5TIS H;  1DEB A;  1SP4 A;  2N1T C;  1JY2 P;  2Y9Z A;  1YBK A;  3V6I A;  2XU6 A;  2YO2 A;  3GMA A;  2D2C B;  2R44 A;  2AEM A;  2P58 A;  1RQU A;  3AE8 C;  2W6B A;  4IFF A;  1KC8 Q;  2FKW B;  3HRN A;  1XTC C;  2HYN A;  1GL2 C;  2LXB A;  2GM4 A;  2E74 C;  1OMI A;  2O01 J;  3VMZ A;  3N4X A;  1LTJ A;  2C0W A;  2W83 C;  1GTW A;  3GHG C;  3V2N A;  1YJN P;  1N73 B;  2BCC G;  3Q5S A;  5L8R J;  5E79 E;  1J1E B;  1AVO A;  1G2C B;  3P7K A;  1JMM A;  4BXL A;  2IFN A;  1NTZ G;  2AEJ A;  2OYI A;  2J58 A;  5K5G B;  5KLI B;  3HTK B;  2B87 A;  5GTI E;  2WPS A;  1NOH A;  1K04 A;  1KQL A;  1OW7 A;  1N7S A;  2KS1 A;  3FXE A;  3QWO C;  4IFD K;  1JY2 O;  5APQ A;  2YXR B;  1HGV A;  1Y9B A;  2R32 A;  5APW A;  4YXD C;  3H1K D;  1T6A A;  1L4A B;  1MUU A;  4R4M A;  3W67 A;  2A45 I;  1W2B O;  2QA4 P;  2QM7 A;  1RE4 A;  1YTZ T;  4B86 A;  3CX5 E;  4YPC A;  5KLV J;  2RKL A;  1ZW0 A;  2FYU E;  1PP9 D;  3CWB E;  2N1T D;  2KNC B;  3I5C A;  1KFN A;  3CCU P;  4H0L C;  1NVO A;  3H1L J;  4AYC A;  3MZW B;  1FZF A;  1HWT C;  1LTJ C;  3KYQ A;  4EIJ A;  2IZ0 A;  3NXS A;  1OW8 A;  2M8R A;  1A02 J;  3H32 A;  3EFF K;  3P8M C;  1RF1 A;  3PLN A;  3OAK A;  2QVA A;  2E74 D;  2G8Y A;  2K9J B;  1VL2 A;  4WBA A;  3WUU A;  2OYI C;  1A02 F;  1L0N D;  4BWN A;  4L74 A;  1BDC A;  1SQV D;  3H1J D;  1KQF B;  1RHZ B;  3KDP B;  4RES B;  4ZMD A;  1N7S C;  4U3F D;  1SQP G;  1JTH A;  1KB9 D;  1VF5 B;  2HLO A;  2K1A A;  4LLH A;  3VTP C;  4H44 C;  4HB1 A;  1RE4 C;  3RK3 C;  2MJZ A;  1PPJ D;  1KMI Z;  5KAF E;  4NPF X;  4D6T J;  1JOC A;  1NU1 E;  4AQR D;  1YQ3 C;  2Y0E A;  3V2Q A;  2UWJ E;  3G4S P;  1X8Y A;  1NJI Q;  3AE5 C;  1NTM D;  1URQ B;  2O1J A;  1SFC B;  4KHX A;  2W27 A;  3H1K G;  4XA4 A;  3HE4 B;  3CXH I;  3MD0 A;  2Q6Q A;  3TNU B;  1NU1 K;  4ZNC A;  1NH4 A;  2W8Z A;  2KP8 A;  3JCU E;  2KI7 B;  1KQG B;  3FX0 A;  3L73 J;  1QVF O;  1LTG C;  1Y47 A;  1DX7 A;  1Q81 Q;  1E79 H;  3MUD C;  4ASV A;  2J5U A;  1IO4 A;  5KAI H;  3QH9 A;  1L0L E;  2E5Y A;  2KLU A;  3L70 E;  4NPD A;  4A7P A;  1YI2 P;  3CCE P;  3LIE A;  3IF4 A;  1L2P A;  1MZ9 A;  2WT7 B;  1DIP A;  1N7S D;  3S9O A;  1L0L K;  2DW3 A;  3A5T A;  4GKG A;  1H88 A;  4IFM A;  5B5E E;  5KLV G;  3KPE A;  2FFD A;  2B88 A;  2A06 G;  2C9N Y;  4HJG H;  4I1L A;  1AV1 A;  4H44 D;  1M1J C;  1ZRT E;  1SQP E;  3RK3 D;  1VQO P;  2WSE J;  5AVZ B;  3CC2 P;  1KIL E;  1JB0 J;  3D71 A;  2KUB A;  3H1L G;  1PL5 A;  4UB6 E;  1PPJ G;  3USS A;  5AVQ B;  3L75 J;  2OGU A;  3O6Q B;  3R4Y A;  3CX5 D;  1KIL A;  2ZAE B;  1QX8 A;  2Y0C A;  2NPS B;  2P7J A;  2FYU D;  3B5N B;  2HFE D;  4PD4 I;  1AQT A;  5GTH E;  1OFC X;  3H1H D;  3CWB D;  3LID A;  3V2R A;  1YJ9 P;  1FZE A;  1SS1 A;  1EXJ A;  3B5N D;  3RBX A;  2ZYG A;  3CXH E;  1VQ5 P;  3PTZ A;  2I1J A;  4PJ0 H;  1ZOY C;  1Q7Y Q;  1SQB J;  1EQ7 A;  1FZC B;  2ZXX A;  1KB9 H;  3VMY A;  2Q9I A;  1EDJ A;  4WY4 C;  4I7Z B;  5AW4 B;  4RKU J;  3FWL A;  1SQX K;  2PP6 A;  2YMK A;  3V5B A;  1NAF A;  2AXT H;  1HTL C;  3HTK A;  2ZT9 C;  2FXO A;  1Q82 Q;  1LT9 B;  2W6J H;  2I1K A;  4H13 C;  3VYI A;  2M5A B;  3A3Y B;  2HPC A;  4YXW H;  3AE4 C;  2Q1K A;  2BCC D;  3Q3D A;  1LP1 B;  3BRV B;  1VQN P;  3MTU E;  3D6Z A;  1FJK A;  1NTZ D;  2JJL A;  2IBZ E;  3HD7 B;  1KIL C;  3HUS A;  3H1I J;  1NU1 D;  1YTZ I;  3L35 A;  3JC2 2;  1SQQ J;  3O8Z A;  2ZJS E;  5KLV E;  1VQP P;  3L72 E;  3CMA P;  2H89 C;  1IK9 A;  1HH0 A;  1J2J B;  5AW7 B;  3KZI E;  3AEC C;  2GUV A;  2Y9Y A;  3H1L E;  1X9V A;  5APT A;  1ZME C;  1BGY J;  5AVS B;  2KIK A;  2O01 N;  2E5T A;  3CCS P;  1GU4 A;  2FXM A;  2K9J A;  2GUS A;  5AW0 B;  2IPP A;  4KJM A;  3M0A A;  1OVU A;  5CMZ A;  4UB8 E;  2JR8 A;  1K8A Q;  1BE3 J;  1WRG A;  1Q90 D;  3FGA D;  4WY4 D;  3VOP A;  2OYH B;  5GTI H;  1L0L D;  2ZVO B;  5DN6 I;  5CBN A;  3L70 D;  5DJU B;  3IN6 A;  5CCH C;  1USD A;  3SWY A;  3WUT A;  1S5L E;  1M1K Q;  2ZT9 D;  3C9I A;  5AVT B;  2AEF A;  3WMM 0;  1JY3 N;  1RY3 A;  3BAT A;  1OVR A;  2WQY C;  3AE6 C;  1SVF A;  3L74 J;  4H13 D;  2B9B A;  1FS0 E;  1SQX J;  3CX5 H;  1K9M Q;  3HUS C;  3BVH A;  3L71 J;  3L75 G;  1HBW A;  1FZA A;  5B66 H;  4D6T E;  2E75 C;  1ZV8 A;  2WPR A;  1CSB A;  3CCL P;  5AVR B;  3G6E P;  1SFC A;  1SQP D;  1ZRT D;  4R4L A;  3CCQ P;  2CPS A;  1KIL D;  3HE4 A;  2HR3 A;  1NKZ B;  3TNU A;  1UIX A;  2XZR A;  2KYV A;  3SFD C;  5AVY B;  2YIU B;  2KOG A;  3MP7 B;  2M3B A;  1N2D C;  1ZP0 C;  2KSE A;  4IL6 E;  1RH5 B;  3I55 P;  1NU1 G;  3EQ2 A;  2KLV A;  1S3J A;  1Z56 A;  4K35 A;  2FYN C;  3L73 E;  1VPC A;  3LW5 H;  4Y99 C;  2Z5I A;  2P1J A;  2OAR A;  3IFM A;  3CXH D;  3V4Q A;  2A45 G;  1LWU A;  2MKV A;  1HGZ A;  5CJ0 A;  2N1T B;  5AVW B;  2E43 A;  2QSI A;  3L72 J;  1P84 I;  4JYC A;  2ZVN B;  5KAF H;  1L0N J;  2JP3 A;  5CCH D;  4C7N A;  3TGU J;  3BCC J;  3H1J J;  1CI6 B;  2ZYD A;  1EDI A;  1DH3 A;  2BAS A;  2WSF H;  3H1I G;  1IC2 A;  2HOD A;  2QJK C;  4U3F J;  1RF0 A;  4I2L C;  1L0L G;  3P8C E;  3FKS H;  1GL2 B;  2QIW A;  1H0T B;  3L70 G;  2E74 B;  1K73 Q;  4GT1 A;  2QJP C;  4ZKP A;  2H8P D;  5AW8 B;  3PH0 A;  3GF7 A;  3GHG B;  1GL2 D;  2E75 D;  2OTK E;  3VMX A;  2RMZ A;  1PGO A;  1IFN A;  2KZI A;  1IFD A;  3SFE C;  3L75 E;  3RL0 C;  2R3C A;  2QE7 H;  3HE5 B;  5KLV D;  4NPE A;  2A06 D;  1N7L A;  3TF5 A;  1NTK E;  2POH A;  2CK3 H;  1GK6 A;  1MFT A;  2JKV A;  3UIA A;  2YKO A;  4AUW A;  1M90 Q;  2Z4E A;  4QMA A;  1LWU C;  3SWK A;  1XTG B;  3H1L D;  2M0B A;  4L73 A;  2JO1 A;  1JNM A;  2OTL P;  2HLD H;  1U7J A;  2WSC H;  1GDT A;  3OE7 H;  1NTK K;  3Q5P A;  1SQB E;  3VMA A;  3CCV P;  3MHV A;  3OA7 A;  3CC4 P;  4PD4 D;  5DJT B;  3AE9 C;  1AVY A;  2K37 A;  3L74 G;  3CCM P;  1H89 A;  1DD3 A;  1SQX G;  5B5E H;  4TLF A;  3L4F A;  1PFI A;  1RF0 C;  3OJA B;  1SQB K;  2YMY A;  3A0H E;  4H0L B;  1S4X A;  1ZN5 A;  2FXP A;  2V7Q J;  4EI2 A;  1LTJ B;  1R5S A;  2R3S A;  3OEH H;  1RF1 C;  2JEE A;  1KYO I;  2WMM A;  5KTB A;  4H0L D;  3D70 A;  3D6Y A;  2FYZ A;  1P84 E;  4UB6 H;  1GW4 A;  3HD7 A;  1LGH B;  4JYB A;  1LTA C;  1R8E A;  2P10 A;  2OYI B;  1VQ8 P;  3H1I E;  1GZL A;  1DD4 A;  1SQQ E;  1USE A;  5GTH H;  1PGJ A;  2K9Y A;  1IZN B;  1N7S B;  2KS1 B;  2XOK H;  4DOJ A;  1JO5 A;  5CJ4 A;  2IDB A;  2QJY C;  3B4S A;  3CXH H;  4GOF A;  3RL0 D;  1EC5 A;  1FDM A;  2PRR A;  3M9H A;  2O01 H;  2WZ7 A;  1SQQ K;  2IBZ G;  1FJP A;  2N9B A;  4H44 B;  2IBZ I;  4JF7 A;  1BGY E;  1Q86 Q;  1BCC J;  3RK3 B;  3FXD A;  1YJW P;  3H1H J;  2WSS H;  3L72 G;  4N6J A;  1S2E A;  4Y28 J;  1RQV A;  2OYH A;  3TGU G;  3H6P A;  1ZXG A;  1BE3 E;  2YXQ B;  1N8R Q;  2E76 C;  3GG2 A;  1YIJ P;  1S72 P;  2ZXE B;  4WWI A;  4LC1 A;  2YKQ A;  1D7M A;  3SWF A;  2XV5 A;  5KKZ C;  2P2U A;  5H2F H;  1JM0 A;  1NTK J;  4DT0 A;  3EFG A;  2LXC B;  3LW5 J;  1K05 A;  3Q2Y A;  2GA1 A;  2WPQ A;  4K3A A;  1Y8A A;  3L74 E;  3GLM A;  3V2P A;  1BDD A;  1SQX E;  1DEE G;  1EZV I;  3L71 E;  5KAI E;  3P8C D;  3WUV A;  3PJS K;  3VP8 A;  3IR9 A;  4OGQ C;  2YO3 A;  1QL1 A;  1N73 A;  3B71 A;  3KZI H;  3RK2 C;  3N7N A;  2ZYA A;  1KYO E;  1G2C A;  2H7H A;  1KZU B;  4N78 E;  1NTZ J;  1X22 A;  2ZFC A;  4W7Z A;  1KQS O;  4PV1 C;  3Q1M A;  3L75 D;  3OAA H;  2WSF J;  2H43 A;  4D6T G;  1IFP A;  1FU1 A;  4PD4 H;  2FFD C;  4LGD E;  1G1J A;  5AVX B;  1LTT C;  4UB8 H;  2JWA A;  5AW3 B;  3AE2 C;  2SPZ A;  2NRG A;  1M1J B;  1CW5 A;  1L4A A;  5CCG A;  1IK7 A;  3ITK A;  5AVU B;  1WT6 A;  2LR2 A;  2B89 A;  2K88 A;  2QM8 A;  3WU2 E;  1HUC A;  2N1T A;  3E1R A;  3Q5R A;  4KT0 J;  1SQB D;  1M57 D;  1S5L H;  2E42 A;  5C39 A;  2D2C C;  4OWF A;  1QVG O;  1NYH A;  2KNC A;  2E76 D;  4GOE A;  3L73 G;  1CI6 A;  1L0N E;  3II6 A;  3KXD A;  5BU8 B;  2JWD A;  3T97 B;  3TGU E;  3BCC E;  2K3R A;  1SQV E;  1S5L X;  3H1J E;  1U7M A;  1H0T A;  2QRX A;  2R5B A;  1LNQ A;  4PJ0 E;  4U3F E;  3IAO A;  1N73 C;  3NTN A;  1BSN A;  1J1E C;  3GHG A;  5E79 H;  5APY A;  1M56 D;  4EYY Q;  4WY4 B;  1JY3 P;  1L0N K;  2PGD A;  4BRY B;  3M06 A;  1OW6 A;  1P84 D;  1SQV K;  4IL6 H;  5KLI C;  4OGQ D;  1VQ7 P;  3RK2 D;  3AED C;  1BCC G;  1EZV E;  1HJ0 A;  4L75 A;  4RO0 A;  3H1I D;  4TT3 H;  1SQQ D;  4ZKU A;  2ZT9 B;  2Y0D A;  5APV A;  1RE3 A;  4H13 B;  4PV1 D;  1L4A C;  5CCG C;  1SLQ A;  2OQQ A;  1MV8 A;  3C8V A;  1AFO A;  3H25 A;  1FOS E;  3R2P A;  1IJD B; 
#chains in the Genus database with same CATH homology
 3OEH H;  2QE7 H;  1FS0 E;  3EFF K;  2XND H;  4DJG A;  5FL7 H;  2E5Y A;  4YXW H;  2HLD H;  2RQ7 A;  2CK3 H;  3OE7 H;  3PJS K;  4ASU H;  3OFN H;  4TLF A;  1AQT A;  4WVZ A;  1BSH A;  1JEK A;  2V7Q H;  2XOK H;  1E79 H;  1BSN A;  3FKS H;  3OAA H;  2JDI H;  2RQ6 A;  2E5T A;  1IFP A;  1H8E H;  2WSS H;  2W6J H;  4QMA A;  3USS A;  5DN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...