2XNDH

Crystal structure of bovine f1-c8 sub-complex of atp synthase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
131
structure length
131
Chain Sequence
b'QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title Bioenergetic Cost of Making an Adenosine Triphosphate Molecule in Animal Mitochondria.
pubmed doi rcsb
molecule tags Hydrolase
total genus 21
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2xndH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2xndH01
2XOKH 2JDIH 3OE7H 3OFNH 1FS0E 3OEHH 4TLFA 4ASUH 2E5YA 4DJGA 2QE7H 2HLDH 2E5TA 2RQ6A 2RQ7A 2XNDH 4WVZA 3EFFK 2WSSH 1JEKA 1IFPA 2V7QH 3PJSK 1BSHA 2CK3H 3OAAH 1H8EH 5DN6I 2W6JH 4QMAA 1AQTA 4YXWH 1BSNA 3FKSH 5FL7H 3USSA 1E79H
chains in the Genus database with same CATH superfamily
4L73A 2QJYB 2K9YA 1YJ9P 1P84D 3MUDA 2E74C 3FXEA 1LT9A 3Q5PA 4XFJA 1ZV8A 4R4MA 2I8DA 4WY4D 2IPPA 1XTGB 2LXCB 3VMZA 2BCCD 1KYOI 3PH0A 2ZVOB 1EZVD 3RBZA 1NYHA 3JSVC 3KQGA 3V4QA 3H1IG 2ZJSE 1FOSF 2KZJA 1ZP0C 2ZAEB 3P8CD 1KFMA 1X8YA 1OX3A 2O1KA 2KNCB 3A3YB 3NTNA 3BCCD 1SQVK 3LW5J 3V2NA 1JY2O 2ZYGA 2NRGA 1DEBA 3L72D 4PV1D 2QJPB 3MTUE 2HR3A 3PRJA 4W80A 1QGKB 1OMIA 2KLUA 3HTKA 1HF9A 1HTLC 5H2FH 1AA0A 1Q86Q 2YO3A 1SQBD 2JKVA 1T2KD 5C39A 4IL6X 3H1HD 3EFGA 1IFNA 1S9KE 2E74B 2Z5HA 2WPVB 1PGJA 4H0LC 4IFDK 4LLHA 1OW7A 3E7KA 1JEKA 4GOFA 1RF1A 3AEAC 3CPWO 4K3AA 1FDMA 1BGYG 1SQXG 1LTBC 5AW6B 2KS1B 1VF5D 1PFIA 5APYA 2KK7A 2NZ2A 3M0AA 5KAIH 5B5EH 3H1ID 3IF4A 1U57A 1GD2E 1FOSE 4U7JA 1R5LA 3B8EB 4H44D 1UIIA 3U1CA 3MIWA 3H1JG 2A06E 5APUA 5AW5B 2V4HA 1GW4A 4Z1MH 1NTKE 2QVAA 1PIXA 1BCCG 1K05A 4AYCA 2OYOA 2PAJA 2HLDH 1NGMB 3MUDC 4LC1A 2GUSA 2R3SA 4R4LA 3RL0C 1NU1E 1WRGA 2KLVA 2ZT9C 1KC8Q 1LT9C 2WQYC 3L71E 4GOEA 1NTKJ 3M9HA 1ZR4A 4H0LB 1N86A 2HG5D 4XE5B 2WSEJ 3H1LG 2DW3A 1K9MQ 5KAFE 1JTHB 4C7NA 2H7HA 1NU1J 3H25A 2WSFH 3L71J 1URQA 3AEBC 1NWQA 2E74D 4AQRD 3H32A 1RH5B 4OGQB 4EOTA 1BGYD 1LTSC 1SFCA 1S2EA 2Y9YA 3CMAP 5APSA 3VP8A 2B9BA 3GMAA 3GF3A 1NTZE 2I1JA 4A7PA 2XOKH 2V7QJ 3H1JD 3TSIA 2RMZA 3KZIH 3OW2O 3CD6P 1P84I 1SQXK 1NTZJ 4IL6H 1FZEA 1OVUA 1VDFA 1G1JA 2XU6A 1UIXA 3RL0B 3VMAA 1BCCD 2ZT9B 1LT9B 1FS0E 3SFDC 1EZVI 1K8AQ 1M90Q 1L0NG 2XDJA 2IBZG 3CC4P 2POHA 3B71A 3VMXA 1RF1C 3HUSA 1FAVA 1KB9H 2M3EA 1Y47A 3R4YA 1QVFO 1FU1A 4MN4C 4IFMA 2P2UA 2KXPB 4DJGA 1OVVA 3H1LD 4PD4E 5AW2B 3WUVA 2M8RA 3WUTA 2Q3EA 2B89A 2QJKC 1WT6A 1RF0A 3L75E 1IFMA 3OAAH 4H0LD 2L91A 2H8PD 1R5SA 4PJ0H 3TGUE 4JYBA 1GU4A 3V2PA 2R44A 1KMIZ 3HTKB 1FC2C 2LKMA 1YQ3C 3PLNA 2K37A 5CCHD 3L75J 4IOIH 3PTZA 4OGQD 1L4AA 1JMMA 4WB4A 3TGUJ 1KN7A 1YHQP 1ZRTE 3FGAD 3AE4C 3VMYA 4ZKUA 3AE6C 1T6AA 1KB9D 3RK3C 1HBWA 3M9BA 3OFNH 1RF1B 1DEEG 1CZQA 1FE6A 2P7JA 4HB1A 1L0ND 1GW3A 2IBZD 1VQPP 5KTBA 1OXZA 3LW5H 1JM0A 1URQC 3RL0D 1JY2P 2ZT9D 3FKSH 2AXTH 3HRNA 3RGUA 2QJKB 2JJLA 1SFCC 2HODA 1KQFB 2QRXA 1VQ5P 4I1LA 5E79E 3VTPC 3NFQA 1ZOYC 2K1AA 3RK2D 3D6YA 3QWOC 1S1CX 1L0NK 1VQKP 1YIJP 1N7SA 2QM8A 1WMKA 3A5TA 2MJZA 2H89C 2VRSA 1J2JB 3NMDA 1ZMEC 4D6TE 1JUNA 2OGUA 3CCUP 5K5GB 2O3JA 2YKOA 1HGVA 3E1RA 2E5TA 5AW0B 3RK3B 1VQNP 4I6MC 1L2PA 1OWAA 3Q3DA 3HUSC 2W6BA 1FZCA 3HE4A 4H13C 2WZ7A 1AQ5A 2Q6QA 4JF7A 1AFOA 4C7NB 4D6TJ 2N1TD 2O01N 4KT0J 4KJMA 1T8ZA 1URQB 2RQ7A 5B66E 3H32B 2A06G 1EDLA 1GL2A 2E43A 1RF0C 1SFCB 1Q90D 2C9LY 2YO2A 1NTKG 2E76C 2ZVNB 1Q82Q 2PFXA 3BRVB 1NTME 1QLED 4BRYA 2OYIA 2KUBA 2KOGA 2XNDH 2AXCA 3WU2E 3GLMA 2YMKA 4UB6E 2FYUE 1OVRA 1NU1G 3N4XA 5AVUB 1LWUA 4YXWH 1ZLLA 1L4AC 3L71G 1RE4A 2MKVA 2Q5UA 3K5BA 2YXRB 1GU5A 1NTMJ 3QH9A 3A0HE 5APQA 3AE8C 2WSEH 1N8RQ 1KFNA 2Y9ZA 2LR2A 4Y28J 2BEZF 2FYUJ 1SQVD 1KILE 4EYYQ 1DH3A 2FFDB 3CC7P 1NH4A 2J58A 2CPSA 3HUSB 2W8ZA 1M8OB 1DIPA 4H13B 1OZHA 1G1IA 1S4XA 1IFPA 2KZIA 4I2LC 2KSJA 1GK4A 5KAFH 3M06A 1NTZG 2W27A 1MFZA 1JCDA 1VQLP 3M0DA 4NPDA 1EXIA 1A02F 2O1JA 2A06D 2E76B 3VN0A 1SQQE 4Y99B 1N7SC 1NKZB 3MZWB 1PZQA 1KILA 4HH2A 1HH0A 1IZNB 1NTKD 4N78E 1D7MA 1MKMA 4EDFA 3TF5A 2OTKE 2FKWB 1PPJE 2KP8A 2J5UA 1L4AB 3CWBE 5KJ7A 1H0TA 1SFCD 5KLVE 2C0XA 1KB9I 1SQQJ 3AECC 2Q7CA 1NU1D 1S5LE 3L71D 3MP7B 3R2PA 3BVHA 1CW5A 5CMZA 1NTKK 4U3FE 1YTZT 1OW8A 4UB8E 3AE7C 3S4RA 3HD7D 1FZCC 1LTTC 2IBZI 3CWBJ 1JY3O 5KLVJ 5DN6I 2NPSD 2HFED 4BWNA 1H8AA 1RE3A 3TNUA 3L75G 3AE3C 1NU1K 1YBKA 3V2QA 1IK7A 3L70E 4U3FJ 1GL2C 4L76A 1FDOA 2W83C 2HODB 1AJYA 2RKLA 4ASVA 3GHGA 3RK3E 2P1JA 1JNMA 1KTMA 2HYNA 2J59M 4PD4H 2GA1A 1EDIA 2JDIH 3G9RA 1R8EA 1NTZD 4H13D 3T97A 2N9YB 2OYIC 1N7SB 1USDA 3L70J 1NVOA 2WPSA 5CJ0A 1VQ9P 5AW4B 1LWUC 5L8RJ 3CXHH 3L72E 3II6A 1L0LE 1RE4C 3ZDMA 4WY4A 4L75A 4B86A 2FYZA 3L35A 4YTPC 5AVYB 1NTZK 4ASWA 1SQBE 3G6EP 1A02J 4HYTB 3LIEA 3L72J 1FZBA 1FZCB 1L0LJ 2ZYDA 3HE4B 5AVTB 2ITAA 4W7YA 1KV4A 5TISE 2XZRA 1SQBJ 4PD4D 1GL2B 5AW7B 1LT1A 3L75D 5AW9B 1SQXD 3M0DC 3W68A 2M5AA 1HWTC 2C9NY 3AEGC 4CPGA 1YI2P 1QL1A 2ZFCA 3KHUA 1U7JA 1JCCA 1OFCX 1EDJA 3CXHD 1KILC 1N2DC 1NJIQ 1EDKA 1H89A 1FBMA 1M7LA 3VP9A 4D6TG 1LWUB 5H2FE 2R3CA 1M57D 5KJ7C 3CCQP 2D2CC 5AVRB 2Z4EA 3C8VA 3CX5E 2KI7B 1MFTA 2H43A 1CI6A 1ZRTD 3FWLA 3MHVA 2LXBA 3BATA 1N7SD 3AEEC 3KYQA 2G3AA 3C1LA 3H6PA 2A45G 1FJKA 5TJHA 1QVGO 1S5LX 3PJSK 2YKPA 2KYVA 1RHZB 2H88C 2QIWA 4ZKPA 4WWIA 1ZW0A 2FXPA 2R5BA 4TT3H 1RE3C 5AVSB 5AVQB 2IFMA 1VL2A 1IFDA 1GTWA 2A45H 2WSCJ 4NPEA 1K04A 1NTMG 3GHGC 5APWA 2WVRA 5B66H 1SQPE 2FYUG 3FX0A 1Y9BA 3M91A 5BU5A 5CHXA 3M9QA 1KILB 3O8ZA 2FYNC 1BE3E 1YQ4C 1VQ6P 2W6JH 1BSNA 3WMM0 2IDBA 3WU2H 1H0TB 1SQPJ 2D2CB 1M1JA 4WY4C 4UB6H 3I5CA 1LP1A 4KHXA 1HGZA 4L74A 4DT0A 3GW6A 1W5CE 3SWKA 3L4FA 1BE3J 3A0HH 3G3ZA 4JBZA 3CC2P 2R5DA 3CI9A 3UIAA 3ABVC 4NPFX 3TNUB 2IYPA 3V4WA 1OW6A 1LTAC 2IX7C 1IC2A 1ZN5A 2AEFA 1SQQG 1LTIC 2FXOA 2FBWC 3IFMA 2HPCA 1IO4A 3GHGB 4GIFA 4ZMDA 1KYOE 1HJBA 2K9JA 4JPZB 1BCCJ 3KDPB 4AUWA 2M0BA 4RESB 5AVWB 1OIPA 1Q81Q 3T97B 2KS1A 1BDDA 1NTMD 1PPJG 1HJ0A 1YITP 1YYCA 3CWBG 4XA4A 5KLVG 1KQGB 2FYNB 2WSFJ 1JY3N 3JCUE 1AVOA 1NHLA 4IFFA 4W7ZA 4WY4B 3H1KE 4U3FG 1S72P 1W2BO 3Q5SA 2BEQD 3I56P 3S9OA 1NTMK 3P32A 2W90A 1JY3P 3MD0A 5GTHE 1J1EC 1CSBA 2FYUK 4BXLA 1S5LH 3AE2C 5EFWB 2L5GB 1HUCA 1IJDB 3G4SP 3L70G 1VF5C 3H1KJ 1VQOP 5KJ7D 2HLOA 4PD4I 1AVYA 4UB8H 4RO0A 2RN0A 4HKZH 3G71P 4H44C 5CBNA 2O01J 3LIDA 4EI2A 3CCSP 3L36A 1TU3F 2JWDA 3P8MC 2BASA 2M5AB 1MV8A 3RBXA 1EC5A 3PHLA 1QEXA 3CXHI 3OE7H 3A7OA 2OQQA 1SQQD 5AVZB 5CCHA 3L72G 4PJ0E 1L0LG 2YIUC 1MZ9A 2P67A 1YTZI 4N78D 1KD1Q 5AW8B 3CCVP 2UWJE 2YKQA 4I7ZC 1Y8AA 5DJTB 5KLIC 1PPJD 1SQBG 1M1JC 3HE5A 5KLVD 2Y0CA 1QX8A 1CI6B 4WVZA 1SQQK 5DJUB 3B5NA 3B4SA 2OYHA 1S9KD 1JB0J 2JR8A 3L74E 4U3FD 1J1EB 3OEHH 1NKNA 2KSEA 1Q7YQ 1M56D 2IYOA 1VF5B 2WSSH 5KLVK 3IR9A 2ZYAA 2E75C 2PRRA 2K88A 4H44B 2QSIA 3L70D 3USSA 3L74J 5TISH 1S3JA 4ASUH 3AE1C 3RK3D 2AXTE 3AE5C 1VPCA 3EQ2A 2V7QH 3CCJP 1PL5A 4RJTA 1EXJA 5AVXB 1NO4A 2QEXP 2YIUB 1PP9E 3N7NA 2XKMA 3SSUA 1URQD 2RQ6A 2OTLP 1LJ2A 4I7ZB 3BASA 4DZOA 5KLIB 1L0LD 4WBAA 1M1JB 1LP1B 3L73E 3ITKA 4N6JA 2B87A 1NAFA 2PP6A 5GTIE 1PP9J 2Y0DA 3CX5H 4DCKA 3CMEP 2KIKA 2K3RA 2W6AA 2A45I 2N1TA 1P84E 4QMAA 1L0LK 3FXDA 3L73J 2WSCH 1KQSO 3EWKA 2AEJA 3TK1A 1GDTA 1SQVE 2OARA 2E75B 2BCCE 3Q1MA 1SQPG 1SQBK 1EZVE 3V6IA 3TGUG 2HPCB 1GZLA 2K9JB 1NOHA 5CCGA 3IN6A 1FZAA 1X79B 3P8CE 1BE3G 1H88A 2Q1KA 5CCHC 1SQVJ 3Q5RA 4OGQC 3BCCE 2BCCJ 2P10A 3PP5A 1PGQA 2Y0EA 2JWAA 5CJ4A 1LTGC 1SP4A 2ZXEB 1H8EH 1RQUA 1KQLA 5CBOA 2Q3IA 3A0BE 2GM4A 4JYCA 2E5YA 4O9BA 2JO1A 2JEEA 2WWWA 4GT1A 3CX5D 3GG2A 4HJGH 3B5NC 2OYHC 3TDKA 2E76D 3BCCJ 3D6ZA 3I55P 3W67A 2ZXXA 2Z5IA 1Q2NA 2E42A 3H1HE 3AEDC 1L4AD 1JMBA 2I1KA 4GODA 2CK3H 1X22A 1N73A 1IK9A 2WPRA 3RK2C 3WUUA 4N3YB 1ZR2A 1IFJA 5APVA 3SFEC 2CPBA 3H1HJ 1SQPD 2WTYA 2WT7A 2IFNA 1LTJA 1YJNP 3TGUD 3A2AA 1GK6A 1KYOH 4BRYB 2OYIB 5E79H 3H1IE 2N9BA 2WITA 3F5HA 1G2CA 2E75D 1FDIA 3H1KG 1BE3D 1DX7A 3SWYA 1SVFA 3RL0g 2KB7P 5M1BA 3HE5B 1W2EA 3V2RA 1SQPK 2OTJP 3SWFA 3B5NB 4ZNCA 1JO5A 3AEFC 2OYHB 3H1IJ 3JCUH 3HD7A 2FXMA 3GF7A 1HVVA 1K73Q 1USEA 2NPSA 3O6QA 3U59A 5KKZC 2C0WA 3VOPA 2G8YA 2N1TC 1BSHA 1QL2A 3D71A 1KORA 3VYIA 2O01H 4EIJA 5GTHH 1FZFA 1X9VA 3TYYA 2FFDA 4JQ0D 3EFFK 1T3JA 3RK2B 1GMJA 1KYOD 5CCGC 5KAIE 5B5EE 1RY3A 3CCMP 2RH0A 4OVNF 1JOCA 2AEMA 4YXDC 2XV5A 5APXA 2KNCA 1BGYE 1PGOA 3CCRP 2P58A 1BDCA 1SQXE 2XNXA 2YXQB 1GL2D 1VQMP 5APTA 3L37A 4K35A 3OAKA 3D70A 3CXHE 3H1KD 3L74G 1YJWP 1LNQA 1SS1A 3E1IA 4D6TD 2B87B 3H1JE 1BGYJ 1SQXJ 2R32A 3C9IA 3S1KA 5KKZB 1VQ4P 3KPEA 2N1TB 2QM7A 1MUUA 1NAYA 1BCCE 1VQ7P 1J1DC 5AVVB 2QG4A 1DD3A 1RQVA 1JY2N 3H1JJ 1N73C 2IZ1A 1AQTA 3B5ND 5FL7H 2YMYA 1PGPA 2Q9IA 4PV1C 1FJPA 4GKGA 1E5WA 3OJAB 2YNYA 4C46A 2PGDA 5AW3B 1PP9G 3F89A 2QA4P 1LTJC 5BVZA 1T3UA 3H1LE 1M1KQ 1E79H 1T2KC 1IFIA 3L73G 1X0TA 2FYUD 2QE7H 1AV1A 1LGHB 2FY8A 3CX5I 3OA7A 3AE9C 3KZIE 2B88A 3IAOA 3U1AA 2WMMA 3H1LJ 2SPZA 1DD4A 3HD7C 3MGNA 4GDOA 3CL3D 3P7KA 4IL6E 4DOJA 2NPSC 5BU8B 3L74D 1KILD 4M3LA 2M3BA 2QJYC 1SQVG 1KZUB 2GUVA 5GTIH 2BCCG 4RKUJ 4OH8B 1EZVG 4YPCA 1KB9E 2D2CD 1J1DB 1P84H 1N7LA 2FFDC 1N73B 3NXSA 3CLQA 1VQ8P 1SLQA 4PV1B 3KXDA 1L0NE 3BCCG 1JTHA 2IBZE 5AW1B 1Z56A 1XTCC 2WT7B 4OWFA 4TLFA 1LTJB 1EQ7A 3JC22 3CCLP 3BRTB 1G2CB 1PP9D 1FZGA 4LGDE 1L0NJ 2WPQA 4Y99C 2QJPC 3CWBD 1PV3A 2IZ0A 3V5BA 5CCGD 4C7RA 3FWNA 3L73D 3Q2YA 3HD7B 2JP3A 1U7MA 3A0BH 3H1HG 1ZXGA 3CCEP 2NPSB 3O6QB
chains in the Genus database with same CATH topology
2XOKH 2JDIH 3OE7H 3OFNH 1FS0E 3OEHH 4TLFA 4ASUH 2E5YA 4DJGA 2QE7H 2HLDH 2E5TA 2RQ6A 2RQ7A 2XNDH 4WVZA 3EFFK 2WSSH 1JEKA 1IFPA 2V7QH 3PJSK 1BSHA 2CK3H 3OAAH 1H8EH 5DN6I 2W6JH 4QMAA 1AQTA 4YXWH 1BSNA 3FKSH 5FL7H 3USSA 1E79H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOK H;  2JDI H;  3OE7 H;  3OFN H;  1FS0 E;  3OEH H;  4TLF A;  4ASU H;  2E5Y A;  4DJG A;  2QE7 H;  2HLD H;  2E5T A;  2RQ6 A;  2RQ7 A;  2XND H;  4WVZ A;  3EFF K;  2WSS H;  1JEK A;  1IFP A;  2V7Q H;  3PJS K;  1BSH A;  2CK3 H;  3OAA H;  1H8E H;  5DN6 I;  2W6J H;  4QMA A;  1AQT A;  4YXW H;  1BSN A;  3FKS H;  5FL7 H;  3USS A;  1E79 H; 
#chains in the Genus database with same CATH topology
 4L73 A;  2QJY B;  2K9Y A;  1YJ9 P;  1P84 D;  3MUD A;  2E74 C;  3FXE A;  1LT9 A;  3Q5P A;  4XFJ A;  1ZV8 A;  4R4M A;  2I8D A;  4WY4 D;  2IPP A;  1XTG B;  2LXC B;  3VMZ A;  2BCC D;  1KYO I;  3PH0 A;  2ZVO B;  1EZV D;  3RBZ A;  1NYH A;  3JSV C;  3KQG A;  3V4Q A;  3H1I G;  2ZJS E;  1FOS F;  2KZJ A;  1ZP0 C;  2ZAE B;  3P8C D;  1KFM A;  1X8Y A;  1OX3 A;  2O1K A;  2KNC B;  3A3Y B;  3NTN A;  3BCC D;  1SQV K;  3LW5 J;  3V2N A;  1JY2 O;  2ZYG A;  2NRG A;  1DEB A;  3L72 D;  4PV1 D;  2QJP B;  3MTU E;  2HR3 A;  3PRJ A;  4W80 A;  1QGK B;  1OMI A;  2KLU A;  3HTK A;  1HF9 A;  1HTL C;  5H2F H;  1AA0 A;  1Q86 Q;  2YO3 A;  1SQB D;  2JKV A;  1T2K D;  5C39 A;  4IL6 X;  3H1H D;  3EFG A;  1IFN A;  1S9K E;  2E74 B;  2Z5H A;  2WPV B;  1PGJ A;  4H0L C;  4IFD K;  4LLH A;  1OW7 A;  3E7K A;  1JEK A;  4GOF A;  1RF1 A;  3AEA C;  3CPW O;  4K3A A;  1FDM A;  1BGY G;  1SQX G;  1LTB C;  5AW6 B;  2KS1 B;  1VF5 D;  1PFI A;  5APY A;  2KK7 A;  2NZ2 A;  3M0A A;  5KAI H;  5B5E H;  3H1I D;  3IF4 A;  1U57 A;  1GD2 E;  1FOS E;  4U7J A;  1R5L A;  3B8E B;  4H44 D;  1UII A;  3U1C A;  3MIW A;  3H1J G;  2A06 E;  5APU A;  5AW5 B;  2V4H A;  1GW4 A;  4Z1M H;  1NTK E;  2QVA A;  1PIX A;  1BCC G;  1K05 A;  4AYC A;  2OYO A;  2PAJ A;  2HLD H;  1NGM B;  3MUD C;  4LC1 A;  2GUS A;  2R3S A;  4R4L A;  3RL0 C;  1NU1 E;  1WRG A;  2KLV A;  2ZT9 C;  1KC8 Q;  1LT9 C;  2WQY C;  3L71 E;  4GOE A;  1NTK J;  3M9H A;  1ZR4 A;  4H0L B;  1N86 A;  2HG5 D;  4XE5 B;  2WSE J;  3H1L G;  2DW3 A;  1K9M Q;  5KAF E;  1JTH B;  4C7N A;  2H7H A;  1NU1 J;  3H25 A;  2WSF H;  3L71 J;  1URQ A;  3AEB C;  1NWQ A;  2E74 D;  4AQR D;  3H32 A;  1RH5 B;  4OGQ B;  4EOT A;  1BGY D;  1LTS C;  1SFC A;  1S2E A;  2Y9Y A;  3CMA P;  5APS A;  3VP8 A;  2B9B A;  3GMA A;  3GF3 A;  1NTZ E;  2I1J A;  4A7P A;  2XOK H;  2V7Q J;  3H1J D;  3TSI A;  2RMZ A;  3KZI H;  3OW2 O;  3CD6 P;  1P84 I;  1SQX K;  1NTZ J;  4IL6 H;  1FZE A;  1OVU A;  1VDF A;  1G1J A;  2XU6 A;  1UIX A;  3RL0 B;  3VMA A;  1BCC D;  2ZT9 B;  1LT9 B;  1FS0 E;  3SFD C;  1EZV I;  1K8A Q;  1M90 Q;  1L0N G;  2XDJ A;  2IBZ G;  3CC4 P;  2POH A;  3B71 A;  3VMX A;  1RF1 C;  3HUS A;  1FAV A;  1KB9 H;  2M3E A;  1Y47 A;  3R4Y A;  1QVF O;  1FU1 A;  4MN4 C;  4IFM A;  2P2U A;  2KXP B;  4DJG A;  1OVV A;  3H1L D;  4PD4 E;  5AW2 B;  3WUV A;  2M8R A;  3WUT A;  2Q3E A;  2B89 A;  2QJK C;  1WT6 A;  1RF0 A;  3L75 E;  1IFM A;  3OAA H;  4H0L D;  2L91 A;  2H8P D;  1R5S A;  4PJ0 H;  3TGU E;  4JYB A;  1GU4 A;  3V2P A;  2R44 A;  1KMI Z;  3HTK B;  1FC2 C;  2LKM A;  1YQ3 C;  3PLN A;  2K37 A;  5CCH D;  3L75 J;  4IOI H;  3PTZ A;  4OGQ D;  1L4A A;  1JMM A;  4WB4 A;  3TGU J;  1KN7 A;  1YHQ P;  1ZRT E;  3FGA D;  3AE4 C;  3VMY A;  4ZKU A;  3AE6 C;  1T6A A;  1KB9 D;  3RK3 C;  1HBW A;  3M9B A;  3OFN H;  1RF1 B;  1DEE G;  1CZQ A;  1FE6 A;  2P7J A;  4HB1 A;  1L0N D;  1GW3 A;  2IBZ D;  1VQP P;  5KTB A;  1OXZ A;  3LW5 H;  1JM0 A;  1URQ C;  3RL0 D;  1JY2 P;  2ZT9 D;  3FKS H;  2AXT H;  3HRN A;  3RGU A;  2QJK B;  2JJL A;  1SFC C;  2HOD A;  1KQF B;  2QRX A;  1VQ5 P;  4I1L A;  5E79 E;  3VTP C;  3NFQ A;  1ZOY C;  2K1A A;  3RK2 D;  3D6Y A;  3QWO C;  1S1C X;  1L0N K;  1VQK P;  1YIJ P;  1N7S A;  2QM8 A;  1WMK A;  3A5T A;  2MJZ A;  2H89 C;  2VRS A;  1J2J B;  3NMD A;  1ZME C;  4D6T E;  1JUN A;  2OGU A;  3CCU P;  5K5G B;  2O3J A;  2YKO A;  1HGV A;  3E1R A;  2E5T A;  5AW0 B;  3RK3 B;  1VQN P;  4I6M C;  1L2P A;  1OWA A;  3Q3D A;  3HUS C;  2W6B A;  1FZC A;  3HE4 A;  4H13 C;  2WZ7 A;  1AQ5 A;  2Q6Q A;  4JF7 A;  1AFO A;  4C7N B;  4D6T J;  2N1T D;  2O01 N;  4KT0 J;  4KJM A;  1T8Z A;  1URQ B;  2RQ7 A;  5B66 E;  3H32 B;  2A06 G;  1EDL A;  1GL2 A;  2E43 A;  1RF0 C;  1SFC B;  1Q90 D;  2C9L Y;  2YO2 A;  1NTK G;  2E76 C;  2ZVN B;  1Q82 Q;  2PFX A;  3BRV B;  1NTM E;  1QLE D;  4BRY A;  2OYI A;  2KUB A;  2KOG A;  2XND H;  2AXC A;  3WU2 E;  3GLM A;  2YMK A;  4UB6 E;  2FYU E;  1OVR A;  1NU1 G;  3N4X A;  5AVU B;  1LWU A;  4YXW H;  1ZLL A;  1L4A C;  3L71 G;  1RE4 A;  2MKV A;  2Q5U A;  3K5B A;  2YXR B;  1GU5 A;  1NTM J;  3QH9 A;  3A0H E;  5APQ A;  3AE8 C;  2WSE H;  1N8R Q;  1KFN A;  2Y9Z A;  2LR2 A;  4Y28 J;  2BEZ F;  2FYU J;  1SQV D;  1KIL E;  4EYY Q;  1DH3 A;  2FFD B;  3CC7 P;  1NH4 A;  2J58 A;  2CPS A;  3HUS B;  2W8Z A;  1M8O B;  1DIP A;  4H13 B;  1OZH A;  1G1I A;  1S4X A;  1IFP A;  2KZI A;  4I2L C;  2KSJ A;  1GK4 A;  5KAF H;  3M06 A;  1NTZ G;  2W27 A;  1MFZ A;  1JCD A;  1VQL P;  3M0D A;  4NPD A;  1EXI A;  1A02 F;  2O1J A;  2A06 D;  2E76 B;  3VN0 A;  1SQQ E;  4Y99 B;  1N7S C;  1NKZ B;  3MZW B;  1PZQ A;  1KIL A;  4HH2 A;  1HH0 A;  1IZN B;  1NTK D;  4N78 E;  1D7M A;  1MKM A;  4EDF A;  3TF5 A;  2OTK E;  2FKW B;  1PPJ E;  2KP8 A;  2J5U A;  1L4A B;  3CWB E;  5KJ7 A;  1H0T A;  1SFC D;  5KLV E;  2C0X A;  1KB9 I;  1SQQ J;  3AEC C;  2Q7C A;  1NU1 D;  1S5L E;  3L71 D;  3MP7 B;  3R2P A;  3BVH A;  1CW5 A;  5CMZ A;  1NTK K;  4U3F E;  1YTZ T;  1OW8 A;  4UB8 E;  3AE7 C;  3S4R A;  3HD7 D;  1FZC C;  1LTT C;  2IBZ I;  3CWB J;  1JY3 O;  5KLV J;  5DN6 I;  2NPS D;  2HFE D;  4BWN A;  1H8A A;  1RE3 A;  3TNU A;  3L75 G;  3AE3 C;  1NU1 K;  1YBK A;  3V2Q A;  1IK7 A;  3L70 E;  4U3F J;  1GL2 C;  4L76 A;  1FDO A;  2W83 C;  2HOD B;  1AJY A;  2RKL A;  4ASV A;  3GHG A;  3RK3 E;  2P1J A;  1JNM A;  1KTM A;  2HYN A;  2J59 M;  4PD4 H;  2GA1 A;  1EDI A;  2JDI H;  3G9R A;  1R8E A;  1NTZ D;  4H13 D;  3T97 A;  2N9Y B;  2OYI C;  1N7S B;  1USD A;  3L70 J;  1NVO A;  2WPS A;  5CJ0 A;  1VQ9 P;  5AW4 B;  1LWU C;  5L8R J;  3CXH H;  3L72 E;  3II6 A;  1L0L E;  1RE4 C;  3ZDM A;  4WY4 A;  4L75 A;  4B86 A;  2FYZ A;  3L35 A;  4YTP C;  5AVY B;  1NTZ K;  4ASW A;  1SQB E;  3G6E P;  1A02 J;  4HYT B;  3LIE A;  3L72 J;  1FZB A;  1FZC B;  1L0L J;  2ZYD A;  3HE4 B;  5AVT B;  2ITA A;  4W7Y A;  1KV4 A;  5TIS E;  2XZR A;  1SQB J;  4PD4 D;  1GL2 B;  5AW7 B;  1LT1 A;  3L75 D;  5AW9 B;  1SQX D;  3M0D C;  3W68 A;  2M5A A;  1HWT C;  2C9N Y;  3AEG C;  4CPG A;  1YI2 P;  1QL1 A;  2ZFC A;  3KHU A;  1U7J A;  1JCC A;  1OFC X;  1EDJ A;  3CXH D;  1KIL C;  1N2D C;  1NJI Q;  1EDK A;  1H89 A;  1FBM A;  1M7L A;  3VP9 A;  4D6T G;  1LWU B;  5H2F E;  2R3C A;  1M57 D;  5KJ7 C;  3CCQ P;  2D2C C;  5AVR B;  2Z4E A;  3C8V A;  3CX5 E;  2KI7 B;  1MFT A;  2H43 A;  1CI6 A;  1ZRT D;  3FWL A;  3MHV A;  2LXB A;  3BAT A;  1N7S D;  3AEE C;  3KYQ A;  2G3A A;  3C1L A;  3H6P A;  2A45 G;  1FJK A;  5TJH A;  1QVG O;  1S5L X;  3PJS K;  2YKP A;  2KYV A;  1RHZ B;  2H88 C;  2QIW A;  4ZKP A;  4WWI A;  1ZW0 A;  2FXP A;  2R5B A;  4TT3 H;  1RE3 C;  5AVS B;  5AVQ B;  2IFM A;  1VL2 A;  1IFD A;  1GTW A;  2A45 H;  2WSC J;  4NPE A;  1K04 A;  1NTM G;  3GHG C;  5APW A;  2WVR A;  5B66 H;  1SQP E;  2FYU G;  3FX0 A;  1Y9B A;  3M91 A;  5BU5 A;  5CHX A;  3M9Q A;  1KIL B;  3O8Z A;  2FYN C;  1BE3 E;  1YQ4 C;  1VQ6 P;  2W6J H;  1BSN A;  3WMM 0;  2IDB A;  3WU2 H;  1H0T B;  1SQP J;  2D2C B;  1M1J A;  4WY4 C;  4UB6 H;  3I5C A;  1LP1 A;  4KHX A;  1HGZ A;  4L74 A;  4DT0 A;  3GW6 A;  1W5C E;  3SWK A;  3L4F A;  1BE3 J;  3A0H H;  3G3Z A;  4JBZ A;  3CC2 P;  2R5D A;  3CI9 A;  3UIA A;  3ABV C;  4NPF X;  3TNU B;  2IYP A;  3V4W A;  1OW6 A;  1LTA C;  2IX7 C;  1IC2 A;  1ZN5 A;  2AEF A;  1SQQ G;  1LTI C;  2FXO A;  2FBW C;  3IFM A;  2HPC A;  1IO4 A;  3GHG B;  4GIF A;  4ZMD A;  1KYO E;  1HJB A;  2K9J A;  4JPZ B;  1BCC J;  3KDP B;  4AUW A;  2M0B A;  4RES B;  5AVW B;  1OIP A;  1Q81 Q;  3T97 B;  2KS1 A;  1BDD A;  1NTM D;  1PPJ G;  1HJ0 A;  1YIT P;  1YYC A;  3CWB G;  4XA4 A;  5KLV G;  1KQG B;  2FYN B;  2WSF J;  1JY3 N;  3JCU E;  1AVO A;  1NHL A;  4IFF A;  4W7Z A;  4WY4 B;  3H1K E;  4U3F G;  1S72 P;  1W2B O;  3Q5S A;  2BEQ D;  3I56 P;  3S9O A;  1NTM K;  3P32 A;  2W90 A;  1JY3 P;  3MD0 A;  5GTH E;  1J1E C;  1CSB A;  2FYU K;  4BXL A;  1S5L H;  3AE2 C;  5EFW B;  2L5G B;  1HUC A;  1IJD B;  3G4S P;  3L70 G;  1VF5 C;  3H1K J;  1VQO P;  5KJ7 D;  2HLO A;  4PD4 I;  1AVY A;  4UB8 H;  4RO0 A;  2RN0 A;  4HKZ H;  3G71 P;  4H44 C;  5CBN A;  2O01 J;  3LID A;  4EI2 A;  3CCS P;  3L36 A;  1TU3 F;  2JWD A;  3P8M C;  2BAS A;  2M5A B;  1MV8 A;  3RBX A;  1EC5 A;  3PHL A;  1QEX A;  3CXH I;  3OE7 H;  3A7O A;  2OQQ A;  1SQQ D;  5AVZ B;  5CCH A;  3L72 G;  4PJ0 E;  1L0L G;  2YIU C;  1MZ9 A;  2P67 A;  1YTZ I;  4N78 D;  1KD1 Q;  5AW8 B;  3CCV P;  2UWJ E;  2YKQ A;  4I7Z C;  1Y8A A;  5DJT B;  5KLI C;  1PPJ D;  1SQB G;  1M1J C;  3HE5 A;  5KLV D;  2Y0C A;  1QX8 A;  1CI6 B;  4WVZ A;  1SQQ K;  5DJU B;  3B5N A;  3B4S A;  2OYH A;  1S9K D;  1JB0 J;  2JR8 A;  3L74 E;  4U3F D;  1J1E B;  3OEH H;  1NKN A;  2KSE A;  1Q7Y Q;  1M56 D;  2IYO A;  1VF5 B;  2WSS H;  5KLV K;  3IR9 A;  2ZYA A;  2E75 C;  2PRR A;  2K88 A;  4H44 B;  2QSI A;  3L70 D;  3USS A;  3L74 J;  5TIS H;  1S3J A;  4ASU H;  3AE1 C;  3RK3 D;  2AXT E;  3AE5 C;  1VPC A;  3EQ2 A;  2V7Q H;  3CCJ P;  1PL5 A;  4RJT A;  1EXJ A;  5AVX B;  1NO4 A;  2QEX P;  2YIU B;  1PP9 E;  3N7N A;  2XKM A;  3SSU A;  1URQ D;  2RQ6 A;  2OTL P;  1LJ2 A;  4I7Z B;  3BAS A;  4DZO A;  5KLI B;  1L0L D;  4WBA A;  1M1J B;  1LP1 B;  3L73 E;  3ITK A;  4N6J A;  2B87 A;  1NAF A;  2PP6 A;  5GTI E;  1PP9 J;  2Y0D A;  3CX5 H;  4DCK A;  3CME P;  2KIK A;  2K3R A;  2W6A A;  2A45 I;  2N1T A;  1P84 E;  4QMA A;  1L0L K;  3FXD A;  3L73 J;  2WSC H;  1KQS O;  3EWK A;  2AEJ A;  3TK1 A;  1GDT A;  1SQV E;  2OAR A;  2E75 B;  2BCC E;  3Q1M A;  1SQP G;  1SQB K;  1EZV E;  3V6I A;  3TGU G;  2HPC B;  1GZL A;  2K9J B;  1NOH A;  5CCG A;  3IN6 A;  1FZA A;  1X79 B;  3P8C E;  1BE3 G;  1H88 A;  2Q1K A;  5CCH C;  1SQV J;  3Q5R A;  4OGQ C;  3BCC E;  2BCC J;  2P10 A;  3PP5 A;  1PGQ A;  2Y0E A;  2JWA A;  5CJ4 A;  1LTG C;  1SP4 A;  2ZXE B;  1H8E H;  1RQU A;  1KQL A;  5CBO A;  2Q3I A;  3A0B E;  2GM4 A;  4JYC A;  2E5Y A;  4O9B A;  2JO1 A;  2JEE A;  2WWW A;  4GT1 A;  3CX5 D;  3GG2 A;  4HJG H;  3B5N C;  2OYH C;  3TDK A;  2E76 D;  3BCC J;  3D6Z A;  3I55 P;  3W67 A;  2ZXX A;  2Z5I A;  1Q2N A;  2E42 A;  3H1H E;  3AED C;  1L4A D;  1JMB A;  2I1K A;  4GOD A;  2CK3 H;  1X22 A;  1N73 A;  1IK9 A;  2WPR A;  3RK2 C;  3WUU A;  4N3Y B;  1ZR2 A;  1IFJ A;  5APV A;  3SFE C;  2CPB A;  3H1H J;  1SQP D;  2WTY A;  2WT7 A;  2IFN A;  1LTJ A;  1YJN P;  3TGU D;  3A2A A;  1GK6 A;  1KYO H;  4BRY B;  2OYI B;  5E79 H;  3H1I E;  2N9B A;  2WIT A;  3F5H A;  1G2C A;  2E75 D;  1FDI A;  3H1K G;  1BE3 D;  1DX7 A;  3SWY A;  1SVF A;  3RL0 g;  2KB7 P;  5M1B A;  3HE5 B;  1W2E A;  3V2R A;  1SQP K;  2OTJ P;  3SWF A;  3B5N B;  4ZNC A;  1JO5 A;  3AEF C;  2OYH B;  3H1I J;  3JCU H;  3HD7 A;  2FXM A;  3GF7 A;  1HVV A;  1K73 Q;  1USE A;  2NPS A;  3O6Q A;  3U59 A;  5KKZ C;  2C0W A;  3VOP A;  2G8Y A;  2N1T C;  1BSH A;  1QL2 A;  3D71 A;  1KOR A;  3VYI A;  2O01 H;  4EIJ A;  5GTH H;  1FZF A;  1X9V A;  3TYY A;  2FFD A;  4JQ0 D;  3EFF K;  1T3J A;  3RK2 B;  1GMJ A;  1KYO D;  5CCG C;  5KAI E;  5B5E E;  1RY3 A;  3CCM P;  2RH0 A;  4OVN F;  1JOC A;  2AEM A;  4YXD C;  2XV5 A;  5APX A;  2KNC A;  1BGY E;  1PGO A;  3CCR P;  2P58 A;  1BDC A;  1SQX E;  2XNX A;  2YXQ B;  1GL2 D;  1VQM P;  5APT A;  3L37 A;  4K35 A;  3OAK A;  3D70 A;  3CXH E;  3H1K D;  3L74 G;  1YJW P;  1LNQ A;  1SS1 A;  3E1I A;  4D6T D;  2B87 B;  3H1J E;  1BGY J;  1SQX J;  2R32 A;  3C9I A;  3S1K A;  5KKZ B;  1VQ4 P;  3KPE A;  2N1T B;  2QM7 A;  1MUU A;  1NAY A;  1BCC E;  1VQ7 P;  1J1D C;  5AVV B;  2QG4 A;  1DD3 A;  1RQV A;  1JY2 N;  3H1J J;  1N73 C;  2IZ1 A;  1AQT A;  3B5N D;  5FL7 H;  2YMY A;  1PGP A;  2Q9I A;  4PV1 C;  1FJP A;  4GKG A;  1E5W A;  3OJA B;  2YNY A;  4C46 A;  2PGD A;  5AW3 B;  1PP9 G;  3F89 A;  2QA4 P;  1LTJ C;  5BVZ A;  1T3U A;  3H1L E;  1M1K Q;  1E79 H;  1T2K C;  1IFI A;  3L73 G;  1X0T A;  2FYU D;  2QE7 H;  1AV1 A;  1LGH B;  2FY8 A;  3CX5 I;  3OA7 A;  3AE9 C;  3KZI E;  2B88 A;  3IAO A;  3U1A A;  2WMM A;  3H1L J;  2SPZ A;  1DD4 A;  3HD7 C;  3MGN A;  4GDO A;  3CL3 D;  3P7K A;  4IL6 E;  4DOJ A;  2NPS C;  5BU8 B;  3L74 D;  1KIL D;  4M3L A;  2M3B A;  2QJY C;  1SQV G;  1KZU B;  2GUV A;  5GTI H;  2BCC G;  4RKU J;  4OH8 B;  1EZV G;  4YPC A;  1KB9 E;  2D2C D;  1J1D B;  1P84 H;  1N7L A;  2FFD C;  1N73 B;  3NXS A;  3CLQ A;  1VQ8 P;  1SLQ A;  4PV1 B;  3KXD A;  1L0N E;  3BCC G;  1JTH A;  2IBZ E;  5AW1 B;  1Z56 A;  1XTC C;  2WT7 B;  4OWF A;  4TLF A;  1LTJ B;  1EQ7 A;  3JC2 2;  3CCL P;  3BRT B;  1G2C B;  1PP9 D;  1FZG A;  4LGD E;  1L0N J;  2WPQ A;  4Y99 C;  2QJP C;  3CWB D;  1PV3 A;  2IZ0 A;  3V5B A;  5CCG D;  4C7R A;  3FWN A;  3L73 D;  3Q2Y A;  3HD7 B;  2JP3 A;  1U7M A;  3A0B H;  3H1H G;  1ZXG A;  3CCE P;  2NPS B;  3O6Q B; 
#chains in the Genus database with same CATH homology
 2XOK H;  2JDI H;  3OE7 H;  3OFN H;  1FS0 E;  3OEH H;  4TLF A;  4ASU H;  2E5Y A;  4DJG A;  2QE7 H;  2HLD H;  2E5T A;  2RQ6 A;  2RQ7 A;  2XND H;  4WVZ A;  3EFF K;  2WSS H;  1JEK A;  1IFP A;  2V7Q H;  3PJS K;  1BSH A;  2CK3 H;  3OAA H;  1H8E H;  5DN6 I;  2W6J H;  4QMA A;  1AQT A;  4YXW H;  1BSN A;  3FKS H;  5FL7 H;  3USS A;  1E79 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...