4YXWH

Bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
131
structure length
128
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How release of phosphate from mammalian F1-ATPase generates a rotary substep.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
total genus 23
structure length 128
sequence length 131
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4yxwH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 4yxwH01
1H8EH 2CK3H 5FL7H 1BSHA 4TLFA 1BSNA 2WSSH 2QE7H 1FS0E 3OFNH 4DJGA 3USSA 2W6JH 3OEHH 2XOKH 1AQTA 5DN6I 3EFFK 1IFPA 2V7QH 2XNDH 3OAAH 2RQ7A 3OE7H 3FKSH 4YXWH 1E79H 2E5YA 4QMAA 2RQ6A 2HLDH 2E5TA 4ASUH 2JDIH 1JEKA 4WVZA 3PJSK
chains in the Genus database with same CATH superfamily
3NFQA 1NTKG 1AVYA 3KXDA 2FYZA 2ZYGA 3LW5J 1N73C 1KN7A 1KORA 2PFXA 1HH0A 1NTKE 1MZ9A 5KLIB 1N7SD 1SQXG 2QSIA 1Q90D 1X0TA 3E7KA 2YXRB 3LIDA 4RESB 1W2BO 1LTJB 2YMKA 1L0LD 1SFCC 2XV5A 3M9HA 5AW6B 1GK4A 1N7LA 1Z56A 3KYQA 3KZIE 1NTMD 1SQBJ 2WQYC 5APSA 1PGPA 1SLQA 1SVFA 3RL0B 1PIXA 3V2NA 1LWUA 1S9KE 5B66H 2I1KA 2E74D 2QRXA 3F89A 3KPEA 4JYBA 2WSEJ 1BDCA 1FDMA 1VPCA 1BCCE 1J1EC 2HR3A 1GZLA 3EFGA 4D6TD 3CWBD 3GHGA 3L75D 3AE4C 2BCCG 4WVZA 3MHVA 1FZCA 1LGHB 1OX3A 1YQ3C 1YTZI 2YKPA 5KJ7D 1EDLA 1T2KD 1QL1A 4AUWA 4K35A 4BRYB 1NGMB 2POHA 3CWBJ 5C39A 2W6AA 2BASA 1VQ8P 1SQVD 3G6EP 1M1KQ 3CL3D 1G2CB 3CI9A 5CCHD 2XNXA 1QGKB 1KYOE 2W6JH 1H0TB 2WMMA 2A06G 2R3CA 2P7JA 3B5NC 1L4AC 3NTNA 1LP1A 4W7YA 1HWTC 4IFDK 4ZKPA 4ASWA 4PV1B 4H44D 4I1LA 2YKQA 1CW5A 3PP5A 4Z1MH 1H88A 3RL0g 1K04A 2NPSC 3OE7H 2RQ7A 2OYHC 1LT9B 3CCQP 3VP8A 2WITA 4H0LB 3D6YA 2Q3IA 3A2AA 4EI2A 3L74E 4XE5B 2ZYDA 3H25A 2OYIB 3M0AA 3G71P 1EDKA 2DW3A 1EXJA 1PGJA 2Q3EA 1GTWA 1BE3E 4M3LA 2KS1B 2FFDB 4OGQC 3A0HH 1Q2NA 3L73E 1RF1B 1L0ND 2RKLA 3CCVP 1L0LJ 3HUSC 1EZVD 1P84D 5BVZA 1NOHA 2B9BA 2WSFJ 5DJTB 2Y9ZA 1BDDA 3TDKA 5EFWB 3SSUA 1CI6B 1VL2A 2NPSA 2E75C 4IL6E 4PD4D 3WUVA 2M3EA 1JMBA 2AEFA 1M1JC 3M0DA 3B5NA 1BE3J 3HE5A 2IBZG 3BRVB 3HTKA 3L36A 3RK3C 1S9KD 2OYIC 1T8ZA 1X9VA 4DZOA 4GIFA 1GW3A 2IBZE 4W80A 1ZN5A 1NKNA 4C7RA 2XU6A 3U1CA 1NTZE 2FFDC 3M9BA 1BCCD 4MN4C 1D7MA 3H32A 3R4YA 1S5LE 3VMYA 4C7NB 1ZR4A 2HLDH 3HRNA 3HE4A 1EXIA 3MZWB 1KQLA 4EIJA 1HGZA 2KNCB 3CX5H 4BRYA 1YHQP 1YJNP 1SQQE 2M5AB 2XDJA 2SPZA 2OYHB 3H1HE 1EDIA 1OVUA 1OXZA 1W5CE 3AEDC 2CPBA 1PGOA 3H1KG 3P8CD 4H0LC 1SQXJ 4TLFA 4XA4A 1DD4A 1R5LA 3RK3B 2C9LY 1BSHA 2FXPA 3H1LE 3IN6A 1KMIZ 1Q81Q 4C46A 3AE8C 3OFNH 1SQBG 1NU1D 1USEA 1Y9BA 2K9JB 2E74C 2MKVA 1NU1K 4KJMA 1YI2P 1L0LK 3TYYA 1AVOA 1TU3F 3CXHI 2AXCA 3Q1MA 1KILE 3AECC 3ITKA 5AVRB 1JTHA 4GDOA 1NH4A 1NU1J 1OVVA 2FYUJ 2LKMA 2K37A 3VTPC 1OW7A 4OVNF 4ZMDA 1SQPE 4DCKA 2WVRA 3VP9A 3CCJP 1DIPA 1WMKA 1EQ7A 2O01H 1KQFB 3JCUH 1R8EA 5BU8B 4JBZA 1OW8A 4N78E 3CCRP 3KQGA 2Q6QA 4O9BA 3SWYA 1S72P 2L91A 2QJYB 3A7OA 3L73D 4I7ZC 5CJ4A 1AQ5A 2O3JA 1YJWP 1G1JA 2K3RA 2QM8A 3TGUJ 1H89A 2HFED 3RK2D 2FFDA 1SQQK 1KZUB 3AE5C 1SQVK 3H1HJ 4NPFX 1LTSC 3W68A 1N73A 1FDOA 3PH0A 1QEXA 3B5ND 3Q5RA 2A45H 2NRGA 3EFFK 1GMJA 3CXHE 2B88A 2R32A 3UIAA 1RQVA 2W27A 5DN6I 4ZKUA 4Y99C 1L0LE 3B5NB 2M3BA 1BGYJ 1UIXA 1YJ9P 4ASVA 1NTME 3IR9A 4HJGH 5AW7B 3L75G 2HPCB 1P84I 2KSEA 4ASUH 2WPSA 1IFIA 1IFJA 1URQB 3AE7C 2FKWB 3H1JG 3HD7B 3V4QA 1RE4C 3WU2E 1M8OB 3PJSK 3L71D 2GUVA 1L0NE 1SFCB 2KZJA 2D2CC 2QJPC 3M91A 3O6QB 4D6TE 1FBMA 1SQXE 1A02F 1N7SB 1QL2A 2Q9IA 3ZDMA 1P84H 2OGUA 1FDIA 2YNYA 2FYUK 2BCCJ 2LXCB 3AE2C 2FYUD 1VQMP 1L4AA 2OYIA 2V7QH 3TGUG 1K73Q 5AVWB 2C0XA 4PJ0H 1YITP 5CCHA 1QVGO 3L70E 2IBZD 3NXSA 3PLNA 2Q1KA 3EWKA 2WSCH 3MD0A 3HD7C 4IOIH 1S5LX 2YKOA 1NHLA 5AW1B 3JSVC 1JM0A 1OMIA 2ZT9C 3HUSA 3L70J 4N78D 3CX5E 1VQPP 1VQOP 1IC2A 1ZV8A 1PP9J 1KFNA 1KILA 3H6PA 3L72J 1LT1A 3GHGC 1IK9A 4BWNA 5CCGD 3FWNA 5KLVK 1YIJP 2JWAA 1H0TA 2JEEA 3H1HD 1SQQG 2H8PD 1S2EA 2O1KA 4Y99B 5KAFH 1PP9D 3L72D 1HJBA 3IFMA 3CCEP 4GOEA 2HODA 1FS0E 1RQUA 1EZVG 2O01J 3L35A 3V6IA 3BCCD 1K05A 1EZVE 3VMAA 1ZLLA 4C7NA 1PFIA 5KAIH 2XNDH 2J58A 1L0LG 1WRGA 3HD7D 5CBOA 4HKZH 1K8AQ 2R5DA 4I2LC 5GTIE 2KNCA 2NPSD 1BGYE 5AW5B 1Q7YQ 3M9QA 3AEEC 4TT3H 3WU2H 1LWUB 3MTUE 2RQ6A 1S4XA 4WBAA 1E5WA 4EYYQ 5KKZB 1BE3G 5CMZA 2W8ZA 2JDIH 2ZVNB 3K5BA 3OA7A 1ZRTE 2OTKE 2QIWA 1JOCA 1JEKA 1X8YA 3FX0A 5AW0B 3MP7B 3L71E 1NTKK 2B87B 1FZEA 2VRSA 1IZNB 1L0NK 1NVOA 2OQQA 1YTZT 2M0BA 2G3AA 1G2CA 2Y0EA 2YMYA 4UB6E 5GTHH 4L75A 3HD7A 2WT7B 5KAIE 1PP9G 3L72G 4W7ZA 2H89C 3AEGC 1KB9H 2WSEH 2HYNA 2OYOA 5BU5A 1JNMA 4RO0A 1GL2C 2NZ2A 5APQA 1KYOI 1M1JA 1T3UA 1G1IA 3S9OA 3Q3DA 1SQPK 2PAJA 1M90Q 1SQVJ 3HE4B 3L70D 2JR8A 3JCUE 4PV1D 1ZOYC 1KYOH 4IFMA 2K9YA 1FOSE 3CC2P 2J59M 2O01N 1JO5A 1SQPJ 1FU1A 1JY2P 1W2EA 2IPPA 2P1JA 2P67A 4DOJA 3B8EB 3CX5D 1FZFA 2YO3A 1PL5A 3OW2O 1VQ6P 1J1DC 2MJZA 1EC5A 1UIIA 1GU5A 1VF5C 1EDJA 2AEMA 1GK6A 3AE6C 2YIUB 1KB9E 5APXA 4RJTA 3RBXA 1MV8A 1LTJA 3E1RA 3H1JE 3VMXA 5TJHA 1T6AA 3TF5A 3CXHH 5FL7H 2ITAA 2FYNB 2KP8A 2QE7H 3A0HE 3BCCG 1S1CX 2BEZF 4GKGA 3H1LG 1NAFA 3GF7A 3T97B 2WPQA 2PP6A 2FYUE 4JF7A 1KTMA 1LTIC 2XKMA 3U59A 3W67A 1GL2A 3G4SP 3FGAD 3PHLA 1OW6A 1NTMK 3CD6P 2YO2A 3RL0D 2GM4A 2QG4A 3GLMA 5H2FH 3L70G 4D6TJ 3ABVC 3RBZA 2W90A 1BE3D 2IDBA 4H44C 3PRJA 1AA0A 1LTGC 1PV3A 2J5UA 4JQ0D 3VMZA 3WMM0 4B86A 2IFNA 5CJ0A 2QEXP 5AW9B 1Q86Q 1JY2O 3M06A 3S1KA 3WUUA 2E43A 1BCCJ 1KB9I 1P84E 2AXTH 3EQ2A 1N73B 4IL6H 1OVRA 4H13B 3G9RA 4NPDA 1PP9E 1HVVA 3L72E 3WUTA 3CPWO 1K9MQ 1H8EH 5KJ7C 1R5SA 5APYA 1BSNA 3RL0C 3JC22 4WY4A 2B89A 1KQSO 1L2PA 2OYHA 1NTZJ 1N2DC 1SP4A 1FZCB 2IFMA 4L74A 3H1JJ 5AVQB 1AJYA 1OZHA 1OFCX 1SQXK 1RF1A 3B4SA 1SQXD 3V2QA 2AEJA 1NTZK 1JY3P 2FYUG 1NTZD 1URQA 5AW3B 3S4RA 2QJKB 2O1JA 2E42A 3BVHA 1J2JB 5APVA 4H13D 5AW4B 3KDPB 5APWA 5KLVE 2C9NY 4U3FE 2RMZA 1L0NJ 1LT9A 2N1TB 1N7SC 3SWKA 1NKZB 1KC8Q 1VQ7P 3VYIA 4D6TG 3CCLP 1Y8AA 2ZXXA 1IFMA 3GMAA 2GA1A 1YBKA 4EDFA 3HE5B 1FJKA 1NU1E 3KZIH 1NTMJ 1SQBD 2V7QJ 3C1LA 1XTGB 1SQBK 3OJAB 2KZIA 1DEBA 1J1EB 2Z4EA 3I55P 2KLUA 5H2FE 5KAFE 3TGUD 1GL2D 3AEFC 3OEHH 2IBZI 2IZ0A 1SQQJ 1A02J 1HGVA 1LJ2A 1IFPA 3KHUA 2ZT9B 1HTLC 4H13C 1MFTA 1SQPG 1YYCA 1FZBA 5AVUB 1EZVI 2A45I 2D2CB 4HH2A 4WY4C 4AQRD 3AE9C 1CSBA 2KUBA 4YPCA 3CC7P 3L75J 4OGQB 4PD4I 2HLOA 1NO4A 2LR2A 1OWAA 1NWQA 2W83C 4UB6H 2E5TA 1RE4A 3TNUB 5CCGA 1KFMA 1JTHB 1PPJD 2D2CD 3N4XA 1BGYD 5GTIH 5K5GB 3P32A 2Q5UA 3A0BE 4AYCA 2WWWA 2QA4P 1KB9D 2JO1A 3MUDA 2R44A 1LT9C 2FXOA 2BEQD 2Y9YA 2G8YA 2FBWC 2Y0DA 2KOGA 1NYHA 3H1JD 3H1KE 5APTA 1U7JA 4YXDC 5E79H 1FZGA 1ZRTD 2WPRA 1LTBC 2WSSH 3I5CA 1L0NG 1LP1B 3CMEP 4H44B 1QLED 3CXHD 3O6QA 4DJGA 2A06E 3F5HA 4GOFA 2WZ7A 3Q5PA 1MFZA 1URQD 4YTPC 5KTBA 4KT0J 1S5LH 2H43A 1IK7A 1RF1C 4NPEA 1FC2C 2IZ1A 1NTMG 5B5EE 3FKSH 4U3FG 4A7PA 1X22A 4YXWH 1KD1Q 3A0BH 1Q82Q 2E75D 2E5YA 3L74J 1NTKJ 3L73J 2IYPA 2OTLP 4PJ0E 4HYTB 1BCCG 3SWFA 1RHZB 1OIPA 3FXDA 3L37A 1N8RQ 3TK1A 1JUNA 4WB4A 1AV1A 2QVAA 1NTKD 3L71G 4WWIA 4GODA 1PPJG 4IFFA 2K9JA 2PRRA 2XZRA 1HUCA 2KYVA 2HODB 1CI6A 2NPSB 2BCCE 3C9IA 2E74B 1NAYA 1U57A 2QJKC 1U7MA 1ZXGA 2H88C 4UB8E 1SQQD 2Z5HA 2KSJA 2ZYAA 3TSIA 5KKZC 1VQKP 1AFOA 1IJDB 1WT6A 1IFNA 2L5GB 3AE3C 4HB1A 3VN0A 1PGQA 1FOSF 2N1TC 2WPVB 3H1LD 3Q5SA 1SFCA 3D70A 1XTCC 2CPSA 2E76D 3R2PA 3RK3E 3H32B 1RY3A 3QWOC 3I56P 3BCCJ 1USDA 3CWBE 1LNQA 2FXMA 3H1IG 1VF5B 2JKVA 3L75E 1KILD 5APUA 3A3YB 2KIKA 2AXTE 3II6A 4L76A 3RK2C 1RE3A 4U3FD 3AEAC 2K1AA 3CWBG 3H1IE 1VQ4P 3D71A 1VQNP 4LC1A 4OWFA 5KLVG 1S3JA 2FY8A 3CCMP 2WT7A 3H1KD 4U3FJ 1NJIQ 3V4WA 3L73G 5AVYB 2WTYA 3O8ZA 1N86A 1PZQA 2JWDA 3BCCE 1H8AA 1GW4A 3GHGB 3GF3A 4DT0A 2A06D 1DX7A 2OARA 3H1KJ 1LWUC 1FE6A 3USSA 5AW2B 3L71J 3TGUE 3U1AA 1SQVG 5GTHE 1IFDA 1QX8A 1YQ4C 3M0DC 4N6JA 2N9YB 2ZVOB 3IAOA 2I1JA 2YIUC 1JMMA 3IF4A 3L74D 3CCSP 2HPCA 2OTJP 2KK7A 1GDTA 1KILB 3AEBC 2KB7P 4WY4D 1SFCD 4LLHA 1NTZG 1Y47A 2P2UA 5DJUB 4QMAA 2RH0A 2E76B 4BXLA 2P58A 2JJLA 1LTJC 2I8DA 2Q7CA 1DH3A 4UB8H 4WY4B 3MUDC 1ZP0C 3P7KA 5AVVB 3RGUA 1MKMA 2Z5IA 5KLVD 1VQ9P 3H1IJ 3CX5I 1JY2N 3G3ZA 4EOTA 1X79B 5CCGC 3SFEC 1L4AB 3FWLA 2LXBA 4I6MC 5AVXB 3T97A 2CK3H 2Y0CA 3H1LJ 4PV1C 3D6ZA 1ZR2A 3LIEA 3MGNA 3QH9A 5KLVJ 2A45G 3V5BA 2JP3A 5CCHC 1MUUA 1T3JA 1KYOD 1HJ0A 1URQC 1RF0C 2B87A 2XOKH 3NMDA 1JCDA 3L4FA 1IO4A 1QVFO 1HBWA 3BASA 5TISE 1GD2E 1SQBE 5CHXA 3A5TA 2QJYC 4I7ZB 2N1TA 5AVZB 3OAAH 3L74G 3RK2B 1L4AD 1M7LA 2ZJSE 3CLQA 4H0LD 1GL2B 2YXQB 2K88A 2ZAEB 4GT1A 3C8VA 1VDFA 4R4MA 1VQLP 3HTKB 3V2PA 1FZAA 2FYNC 2KLVA 1HF9A 1BGYG 3E1IA 4N3YB 4K3AA 1M56D 3B71A 4IL6X 5KLIC 4R4LA 4CPGA 3CMAP 1SS1A 2QM7A 5E79E 2KXPB 1ZMEC 2IX7C 1T2KC 2V4HA 5AW8B 3P8CE 1N7SA 1M57D 2W6BA 3P8MC 1KILC 4JPZB 4OH8B 2BCCD 4ZNCA 2H7HA 1JY3O 3BRTB 1LTTC 1J1DB 1M1JB 1PPJE 2N1TD 3CC4P 1DD3A 5TISH 2GUSA 2RN0A 1NU1G 2IYOA 4RKUJ 2E76C 4XFJA 3CCUP 2ZFCA 2UWJE 2M5AA 3FXEA 1JY3N 1SQVE 2ZXEB 4LGDE 1KQGB 2KI7B 4JYCA 4PD4E 5M1BA 2M8RA 4Y28J 1SQPD 1AQTA 3N7NA 1RF0A 2R5BA 3PTZA 2WSFH 3LW5H 1GU4A 1RH5B 1ZW0A 2P10A 3AE1C 3OAKA 4KHXA 1FAVA 3RK3D 3TNUA 4L73A 3V2RA 4OGQD 3VOPA 3HUSB 5CBNA 2QJPB 1JCCA 1E79H 1KV4A 5AVSB 2KS1A 3GG2A 1JB0J 2N9BA 3H1ID 5AVTB 2E75B 2PGDA 2ZT9D 4U7JA 1LTAC 5KJ7A 1FZCC 1VQ5P 3MIWA 1CZQA 3SFDC 5B5EH 5B66E 3H1HG 1DEEG 3GW6A 3Q2YA 2R3SA 2HG5D 5L8RJ 3BATA 4PD4H 2WSCJ 1FJPA 1VF5D 1RE3C 2C0WA
chains in the Genus database with same CATH topology
1H8EH 2CK3H 5FL7H 1BSHA 4TLFA 1BSNA 2WSSH 2QE7H 1FS0E 3OFNH 4DJGA 3USSA 2W6JH 3OEHH 2XOKH 1AQTA 5DN6I 3EFFK 1IFPA 2V7QH 2XNDH 3OAAH 2RQ7A 3OE7H 3FKSH 4YXWH 1E79H 2E5YA 4QMAA 2RQ6A 2HLDH 2E5TA 4ASUH 2JDIH 1JEKA 4WVZA 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8E H;  2CK3 H;  5FL7 H;  1BSH A;  4TLF A;  1BSN A;  2WSS H;  2QE7 H;  1FS0 E;  3OFN H;  4DJG A;  3USS A;  2W6J H;  3OEH H;  2XOK H;  1AQT A;  5DN6 I;  3EFF K;  1IFP A;  2V7Q H;  2XND H;  3OAA H;  2RQ7 A;  3OE7 H;  3FKS H;  4YXW H;  1E79 H;  2E5Y A;  4QMA A;  2RQ6 A;  2HLD H;  2E5T A;  4ASU H;  2JDI H;  1JEK A;  4WVZ A;  3PJS K; 
#chains in the Genus database with same CATH topology
 3NFQ A;  1NTK G;  1AVY A;  3KXD A;  2FYZ A;  2ZYG A;  3LW5 J;  1N73 C;  1KN7 A;  1KOR A;  2PFX A;  1HH0 A;  1NTK E;  1MZ9 A;  5KLI B;  1N7S D;  1SQX G;  2QSI A;  1Q90 D;  1X0T A;  3E7K A;  2YXR B;  3LID A;  4RES B;  1W2B O;  1LTJ B;  2YMK A;  1L0L D;  1SFC C;  2XV5 A;  3M9H A;  5AW6 B;  1GK4 A;  1N7L A;  1Z56 A;  3KYQ A;  3KZI E;  1NTM D;  1SQB J;  2WQY C;  5APS A;  1PGP A;  1SLQ A;  1SVF A;  3RL0 B;  1PIX A;  3V2N A;  1LWU A;  1S9K E;  5B66 H;  2I1K A;  2E74 D;  2QRX A;  3F89 A;  3KPE A;  4JYB A;  2WSE J;  1BDC A;  1FDM A;  1VPC A;  1BCC E;  1J1E C;  2HR3 A;  1GZL A;  3EFG A;  4D6T D;  3CWB D;  3GHG A;  3L75 D;  3AE4 C;  2BCC G;  4WVZ A;  3MHV A;  1FZC A;  1LGH B;  1OX3 A;  1YQ3 C;  1YTZ I;  2YKP A;  5KJ7 D;  1EDL A;  1T2K D;  1QL1 A;  4AUW A;  4K35 A;  4BRY B;  1NGM B;  2POH A;  3CWB J;  5C39 A;  2W6A A;  2BAS A;  1VQ8 P;  1SQV D;  3G6E P;  1M1K Q;  3CL3 D;  1G2C B;  3CI9 A;  5CCH D;  2XNX A;  1QGK B;  1KYO E;  2W6J H;  1H0T B;  2WMM A;  2A06 G;  2R3C A;  2P7J A;  3B5N C;  1L4A C;  3NTN A;  1LP1 A;  4W7Y A;  1HWT C;  4IFD K;  4ZKP A;  4ASW A;  4PV1 B;  4H44 D;  4I1L A;  2YKQ A;  1CW5 A;  3PP5 A;  4Z1M H;  1H88 A;  3RL0 g;  1K04 A;  2NPS C;  3OE7 H;  2RQ7 A;  2OYH C;  1LT9 B;  3CCQ P;  3VP8 A;  2WIT A;  4H0L B;  3D6Y A;  2Q3I A;  3A2A A;  4EI2 A;  3L74 E;  4XE5 B;  2ZYD A;  3H25 A;  2OYI B;  3M0A A;  3G71 P;  1EDK A;  2DW3 A;  1EXJ A;  1PGJ A;  2Q3E A;  1GTW A;  1BE3 E;  4M3L A;  2KS1 B;  2FFD B;  4OGQ C;  3A0H H;  1Q2N A;  3L73 E;  1RF1 B;  1L0N D;  2RKL A;  3CCV P;  1L0L J;  3HUS C;  1EZV D;  1P84 D;  5BVZ A;  1NOH A;  2B9B A;  2WSF J;  5DJT B;  2Y9Z A;  1BDD A;  3TDK A;  5EFW B;  3SSU A;  1CI6 B;  1VL2 A;  2NPS A;  2E75 C;  4IL6 E;  4PD4 D;  3WUV A;  2M3E A;  1JMB A;  2AEF A;  1M1J C;  3M0D A;  3B5N A;  1BE3 J;  3HE5 A;  2IBZ G;  3BRV B;  3HTK A;  3L36 A;  3RK3 C;  1S9K D;  2OYI C;  1T8Z A;  1X9V A;  4DZO A;  4GIF A;  1GW3 A;  2IBZ E;  4W80 A;  1ZN5 A;  1NKN A;  4C7R A;  2XU6 A;  3U1C A;  1NTZ E;  2FFD C;  3M9B A;  1BCC D;  4MN4 C;  1D7M A;  3H32 A;  3R4Y A;  1S5L E;  3VMY A;  4C7N B;  1ZR4 A;  2HLD H;  3HRN A;  3HE4 A;  1EXI A;  3MZW B;  1KQL A;  4EIJ A;  1HGZ A;  2KNC B;  3CX5 H;  4BRY A;  1YHQ P;  1YJN P;  1SQQ E;  2M5A B;  2XDJ A;  2SPZ A;  2OYH B;  3H1H E;  1EDI A;  1OVU A;  1OXZ A;  1W5C E;  3AED C;  2CPB A;  1PGO A;  3H1K G;  3P8C D;  4H0L C;  1SQX J;  4TLF A;  4XA4 A;  1DD4 A;  1R5L A;  3RK3 B;  2C9L Y;  1BSH A;  2FXP A;  3H1L E;  3IN6 A;  1KMI Z;  1Q81 Q;  4C46 A;  3AE8 C;  3OFN H;  1SQB G;  1NU1 D;  1USE A;  1Y9B A;  2K9J B;  2E74 C;  2MKV A;  1NU1 K;  4KJM A;  1YI2 P;  1L0L K;  3TYY A;  1AVO A;  1TU3 F;  3CXH I;  2AXC A;  3Q1M A;  1KIL E;  3AEC C;  3ITK A;  5AVR B;  1JTH A;  4GDO A;  1NH4 A;  1NU1 J;  1OVV A;  2FYU J;  2LKM A;  2K37 A;  3VTP C;  1OW7 A;  4OVN F;  4ZMD A;  1SQP E;  4DCK A;  2WVR A;  3VP9 A;  3CCJ P;  1DIP A;  1WMK A;  1EQ7 A;  2O01 H;  1KQF B;  3JCU H;  1R8E A;  5BU8 B;  4JBZ A;  1OW8 A;  4N78 E;  3CCR P;  3KQG A;  2Q6Q A;  4O9B A;  3SWY A;  1S72 P;  2L91 A;  2QJY B;  3A7O A;  3L73 D;  4I7Z C;  5CJ4 A;  1AQ5 A;  2O3J A;  1YJW P;  1G1J A;  2K3R A;  2QM8 A;  3TGU J;  1H89 A;  2HFE D;  3RK2 D;  2FFD A;  1SQQ K;  1KZU B;  3AE5 C;  1SQV K;  3H1H J;  4NPF X;  1LTS C;  3W68 A;  1N73 A;  1FDO A;  3PH0 A;  1QEX A;  3B5N D;  3Q5R A;  2A45 H;  2NRG A;  3EFF K;  1GMJ A;  3CXH E;  2B88 A;  2R32 A;  3UIA A;  1RQV A;  2W27 A;  5DN6 I;  4ZKU A;  4Y99 C;  1L0L E;  3B5N B;  2M3B A;  1BGY J;  1UIX A;  1YJ9 P;  4ASV A;  1NTM E;  3IR9 A;  4HJG H;  5AW7 B;  3L75 G;  2HPC B;  1P84 I;  2KSE A;  4ASU H;  2WPS A;  1IFI A;  1IFJ A;  1URQ B;  3AE7 C;  2FKW B;  3H1J G;  3HD7 B;  3V4Q A;  1RE4 C;  3WU2 E;  1M8O B;  3PJS K;  3L71 D;  2GUV A;  1L0N E;  1SFC B;  2KZJ A;  2D2C C;  2QJP C;  3M91 A;  3O6Q B;  4D6T E;  1FBM A;  1SQX E;  1A02 F;  1N7S B;  1QL2 A;  2Q9I A;  3ZDM A;  1P84 H;  2OGU A;  1FDI A;  2YNY A;  2FYU K;  2BCC J;  2LXC B;  3AE2 C;  2FYU D;  1VQM P;  1L4A A;  2OYI A;  2V7Q H;  3TGU G;  1K73 Q;  5AVW B;  2C0X A;  4PJ0 H;  1YIT P;  5CCH A;  1QVG O;  3L70 E;  2IBZ D;  3NXS A;  3PLN A;  2Q1K A;  3EWK A;  2WSC H;  3MD0 A;  3HD7 C;  4IOI H;  1S5L X;  2YKO A;  1NHL A;  5AW1 B;  3JSV C;  1JM0 A;  1OMI A;  2ZT9 C;  3HUS A;  3L70 J;  4N78 D;  3CX5 E;  1VQP P;  1VQO P;  1IC2 A;  1ZV8 A;  1PP9 J;  1KFN A;  1KIL A;  3H6P A;  3L72 J;  1LT1 A;  3GHG C;  1IK9 A;  4BWN A;  5CCG D;  3FWN A;  5KLV K;  1YIJ P;  2JWA A;  1H0T A;  2JEE A;  3H1H D;  1SQQ G;  2H8P D;  1S2E A;  2O1K A;  4Y99 B;  5KAF H;  1PP9 D;  3L72 D;  1HJB A;  3IFM A;  3CCE P;  4GOE A;  2HOD A;  1FS0 E;  1RQU A;  1EZV G;  2O01 J;  3L35 A;  3V6I A;  3BCC D;  1K05 A;  1EZV E;  3VMA A;  1ZLL A;  4C7N A;  1PFI A;  5KAI H;  2XND H;  2J58 A;  1L0L G;  1WRG A;  3HD7 D;  5CBO A;  4HKZ H;  1K8A Q;  2R5D A;  4I2L C;  5GTI E;  2KNC A;  2NPS D;  1BGY E;  5AW5 B;  1Q7Y Q;  3M9Q A;  3AEE C;  4TT3 H;  3WU2 H;  1LWU B;  3MTU E;  2RQ6 A;  1S4X A;  4WBA A;  1E5W A;  4EYY Q;  5KKZ B;  1BE3 G;  5CMZ A;  2W8Z A;  2JDI H;  2ZVN B;  3K5B A;  3OA7 A;  1ZRT E;  2OTK E;  2QIW A;  1JOC A;  1JEK A;  1X8Y A;  3FX0 A;  5AW0 B;  3MP7 B;  3L71 E;  1NTK K;  2B87 B;  1FZE A;  2VRS A;  1IZN B;  1L0N K;  1NVO A;  2OQQ A;  1YTZ T;  2M0B A;  2G3A A;  1G2C A;  2Y0E A;  2YMY A;  4UB6 E;  5GTH H;  4L75 A;  3HD7 A;  2WT7 B;  5KAI E;  1PP9 G;  3L72 G;  4W7Z A;  2H89 C;  3AEG C;  1KB9 H;  2WSE H;  2HYN A;  2OYO A;  5BU5 A;  1JNM A;  4RO0 A;  1GL2 C;  2NZ2 A;  5APQ A;  1KYO I;  1M1J A;  1T3U A;  1G1I A;  3S9O A;  3Q3D A;  1SQP K;  2PAJ A;  1M90 Q;  1SQV J;  3HE4 B;  3L70 D;  2JR8 A;  3JCU E;  4PV1 D;  1ZOY C;  1KYO H;  4IFM A;  2K9Y A;  1FOS E;  3CC2 P;  2J59 M;  2O01 N;  1JO5 A;  1SQP J;  1FU1 A;  1JY2 P;  1W2E A;  2IPP A;  2P1J A;  2P67 A;  4DOJ A;  3B8E B;  3CX5 D;  1FZF A;  2YO3 A;  1PL5 A;  3OW2 O;  1VQ6 P;  1J1D C;  2MJZ A;  1EC5 A;  1UII A;  1GU5 A;  1VF5 C;  1EDJ A;  2AEM A;  1GK6 A;  3AE6 C;  2YIU B;  1KB9 E;  5APX A;  4RJT A;  3RBX A;  1MV8 A;  1LTJ A;  3E1R A;  3H1J E;  3VMX A;  5TJH A;  1T6A A;  3TF5 A;  3CXH H;  5FL7 H;  2ITA A;  2FYN B;  2KP8 A;  2QE7 H;  3A0H E;  3BCC G;  1S1C X;  2BEZ F;  4GKG A;  3H1L G;  1NAF A;  3GF7 A;  3T97 B;  2WPQ A;  2PP6 A;  2FYU E;  4JF7 A;  1KTM A;  1LTI C;  2XKM A;  3U59 A;  3W67 A;  1GL2 A;  3G4S P;  3FGA D;  3PHL A;  1OW6 A;  1NTM K;  3CD6 P;  2YO2 A;  3RL0 D;  2GM4 A;  2QG4 A;  3GLM A;  5H2F H;  3L70 G;  4D6T J;  3ABV C;  3RBZ A;  2W90 A;  1BE3 D;  2IDB A;  4H44 C;  3PRJ A;  1AA0 A;  1LTG C;  1PV3 A;  2J5U A;  4JQ0 D;  3VMZ A;  3WMM 0;  4B86 A;  2IFN A;  5CJ0 A;  2QEX P;  5AW9 B;  1Q86 Q;  1JY2 O;  3M06 A;  3S1K A;  3WUU A;  2E43 A;  1BCC J;  1KB9 I;  1P84 E;  2AXT H;  3EQ2 A;  1N73 B;  4IL6 H;  1OVR A;  4H13 B;  3G9R A;  4NPD A;  1PP9 E;  1HVV A;  3L72 E;  3WUT A;  3CPW O;  1K9M Q;  1H8E H;  5KJ7 C;  1R5S A;  5APY A;  1BSN A;  3RL0 C;  3JC2 2;  4WY4 A;  2B89 A;  1KQS O;  1L2P A;  2OYH A;  1NTZ J;  1N2D C;  1SP4 A;  1FZC B;  2IFM A;  4L74 A;  3H1J J;  5AVQ B;  1AJY A;  1OZH A;  1OFC X;  1SQX K;  1RF1 A;  3B4S A;  1SQX D;  3V2Q A;  2AEJ A;  1NTZ K;  1JY3 P;  2FYU G;  1NTZ D;  1URQ A;  5AW3 B;  3S4R A;  2QJK B;  2O1J A;  2E42 A;  3BVH A;  1J2J B;  5APV A;  4H13 D;  5AW4 B;  3KDP B;  5APW A;  5KLV E;  2C9N Y;  4U3F E;  2RMZ A;  1L0N J;  1LT9 A;  2N1T B;  1N7S C;  3SWK A;  1NKZ B;  1KC8 Q;  1VQ7 P;  3VYI A;  4D6T G;  3CCL P;  1Y8A A;  2ZXX A;  1IFM A;  3GMA A;  2GA1 A;  1YBK A;  4EDF A;  3HE5 B;  1FJK A;  1NU1 E;  3KZI H;  1NTM J;  1SQB D;  2V7Q J;  3C1L A;  1XTG B;  1SQB K;  3OJA B;  2KZI A;  1DEB A;  1J1E B;  2Z4E A;  3I55 P;  2KLU A;  5H2F E;  5KAF E;  3TGU D;  1GL2 D;  3AEF C;  3OEH H;  2IBZ I;  2IZ0 A;  1SQQ J;  1A02 J;  1HGV A;  1LJ2 A;  1IFP A;  3KHU A;  2ZT9 B;  1HTL C;  4H13 C;  1MFT A;  1SQP G;  1YYC A;  1FZB A;  5AVU B;  1EZV I;  2A45 I;  2D2C B;  4HH2 A;  4WY4 C;  4AQR D;  3AE9 C;  1CSB A;  2KUB A;  4YPC A;  3CC7 P;  3L75 J;  4OGQ B;  4PD4 I;  2HLO A;  1NO4 A;  2LR2 A;  1OWA A;  1NWQ A;  2W83 C;  4UB6 H;  2E5T A;  1RE4 A;  3TNU B;  5CCG A;  1KFM A;  1JTH B;  1PPJ D;  2D2C D;  3N4X A;  1BGY D;  5GTI H;  5K5G B;  3P32 A;  2Q5U A;  3A0B E;  4AYC A;  2WWW A;  2QA4 P;  1KB9 D;  2JO1 A;  3MUD A;  2R44 A;  1LT9 C;  2FXO A;  2BEQ D;  2Y9Y A;  2G8Y A;  2FBW C;  2Y0D A;  2KOG A;  1NYH A;  3H1J D;  3H1K E;  5APT A;  1U7J A;  4YXD C;  5E79 H;  1FZG A;  1ZRT D;  2WPR A;  1LTB C;  2WSS H;  3I5C A;  1L0N G;  1LP1 B;  3CME P;  4H44 B;  1QLE D;  3CXH D;  3O6Q A;  4DJG A;  2A06 E;  3F5H A;  4GOF A;  2WZ7 A;  3Q5P A;  1MFZ A;  1URQ D;  4YTP C;  5KTB A;  4KT0 J;  1S5L H;  2H43 A;  1IK7 A;  1RF1 C;  4NPE A;  1FC2 C;  2IZ1 A;  1NTM G;  5B5E E;  3FKS H;  4U3F G;  4A7P A;  1X22 A;  4YXW H;  1KD1 Q;  3A0B H;  1Q82 Q;  2E75 D;  2E5Y A;  3L74 J;  1NTK J;  3L73 J;  2IYP A;  2OTL P;  4PJ0 E;  4HYT B;  1BCC G;  3SWF A;  1RHZ B;  1OIP A;  3FXD A;  3L37 A;  1N8R Q;  3TK1 A;  1JUN A;  4WB4 A;  1AV1 A;  2QVA A;  1NTK D;  3L71 G;  4WWI A;  4GOD A;  1PPJ G;  4IFF A;  2K9J A;  2PRR A;  2XZR A;  1HUC A;  2KYV A;  2HOD B;  1CI6 A;  2NPS B;  2BCC E;  3C9I A;  2E74 B;  1NAY A;  1U57 A;  2QJK C;  1U7M A;  1ZXG A;  2H88 C;  4UB8 E;  1SQQ D;  2Z5H A;  2KSJ A;  2ZYA A;  3TSI A;  5KKZ C;  1VQK P;  1AFO A;  1IJD B;  1WT6 A;  1IFN A;  2L5G B;  3AE3 C;  4HB1 A;  3VN0 A;  1PGQ A;  1FOS F;  2N1T C;  2WPV B;  3H1L D;  3Q5S A;  1SFC A;  3D70 A;  1XTC C;  2CPS A;  2E76 D;  3R2P A;  3RK3 E;  3H32 B;  1RY3 A;  3QWO C;  3I56 P;  3BCC J;  1USD A;  3CWB E;  1LNQ A;  2FXM A;  3H1I G;  1VF5 B;  2JKV A;  3L75 E;  1KIL D;  5APU A;  3A3Y B;  2KIK A;  2AXT E;  3II6 A;  4L76 A;  3RK2 C;  1RE3 A;  4U3F D;  3AEA C;  2K1A A;  3CWB G;  3H1I E;  1VQ4 P;  3D71 A;  1VQN P;  4LC1 A;  4OWF A;  5KLV G;  1S3J A;  2FY8 A;  3CCM P;  2WT7 A;  3H1K D;  4U3F J;  1NJI Q;  3V4W A;  3L73 G;  5AVY B;  2WTY A;  3O8Z A;  1N86 A;  1PZQ A;  2JWD A;  3BCC E;  1H8A A;  1GW4 A;  3GHG B;  3GF3 A;  4DT0 A;  2A06 D;  1DX7 A;  2OAR A;  3H1K J;  1LWU C;  1FE6 A;  3USS A;  5AW2 B;  3L71 J;  3TGU E;  3U1A A;  1SQV G;  5GTH E;  1IFD A;  1QX8 A;  1YQ4 C;  3M0D C;  4N6J A;  2N9Y B;  2ZVO B;  3IAO A;  2I1J A;  2YIU C;  1JMM A;  3IF4 A;  3L74 D;  3CCS P;  2HPC A;  2OTJ P;  2KK7 A;  1GDT A;  1KIL B;  3AEB C;  2KB7 P;  4WY4 D;  1SFC D;  4LLH A;  1NTZ G;  1Y47 A;  2P2U A;  5DJU B;  4QMA A;  2RH0 A;  2E76 B;  4BXL A;  2P58 A;  2JJL A;  1LTJ C;  2I8D A;  2Q7C A;  1DH3 A;  4UB8 H;  4WY4 B;  3MUD C;  1ZP0 C;  3P7K A;  5AVV B;  3RGU A;  1MKM A;  2Z5I A;  5KLV D;  1VQ9 P;  3H1I J;  3CX5 I;  1JY2 N;  3G3Z A;  4EOT A;  1X79 B;  5CCG C;  3SFE C;  1L4A B;  3FWL A;  2LXB A;  4I6M C;  5AVX B;  3T97 A;  2CK3 H;  2Y0C A;  3H1L J;  4PV1 C;  3D6Z A;  1ZR2 A;  3LIE A;  3MGN A;  3QH9 A;  5KLV J;  2A45 G;  3V5B A;  2JP3 A;  5CCH C;  1MUU A;  1T3J A;  1KYO D;  1HJ0 A;  1URQ C;  1RF0 C;  2B87 A;  2XOK H;  3NMD A;  1JCD A;  3L4F A;  1IO4 A;  1QVF O;  1HBW A;  3BAS A;  5TIS E;  1GD2 E;  1SQB E;  5CHX A;  3A5T A;  2QJY C;  4I7Z B;  2N1T A;  5AVZ B;  3OAA H;  3L74 G;  3RK2 B;  1L4A D;  1M7L A;  2ZJS E;  3CLQ A;  4H0L D;  1GL2 B;  2YXQ B;  2K88 A;  2ZAE B;  4GT1 A;  3C8V A;  1VDF A;  4R4M A;  1VQL P;  3HTK B;  3V2P A;  1FZA A;  2FYN C;  2KLV A;  1HF9 A;  1BGY G;  3E1I A;  4N3Y B;  4K3A A;  1M56 D;  3B71 A;  4IL6 X;  5KLI C;  4R4L A;  4CPG A;  3CMA P;  1SS1 A;  2QM7 A;  5E79 E;  2KXP B;  1ZME C;  2IX7 C;  1T2K C;  2V4H A;  5AW8 B;  3P8C E;  1N7S A;  1M57 D;  2W6B A;  3P8M C;  1KIL C;  4JPZ B;  4OH8 B;  2BCC D;  4ZNC A;  2H7H A;  1JY3 O;  3BRT B;  1LTT C;  1J1D B;  1M1J B;  1PPJ E;  2N1T D;  3CC4 P;  1DD3 A;  5TIS H;  2GUS A;  2RN0 A;  1NU1 G;  2IYO A;  4RKU J;  2E76 C;  4XFJ A;  3CCU P;  2ZFC A;  2UWJ E;  2M5A A;  3FXE A;  1JY3 N;  1SQV E;  2ZXE B;  4LGD E;  1KQG B;  2KI7 B;  4JYC A;  4PD4 E;  5M1B A;  2M8R A;  4Y28 J;  1SQP D;  1AQT A;  3N7N A;  1RF0 A;  2R5B A;  3PTZ A;  2WSF H;  3LW5 H;  1GU4 A;  1RH5 B;  1ZW0 A;  2P10 A;  3AE1 C;  3OAK A;  4KHX A;  1FAV A;  3RK3 D;  3TNU A;  4L73 A;  3V2R A;  4OGQ D;  3VOP A;  3HUS B;  5CBN A;  2QJP B;  1JCC A;  1E79 H;  1KV4 A;  5AVS B;  2KS1 A;  3GG2 A;  1JB0 J;  2N9B A;  3H1I D;  5AVT B;  2E75 B;  2PGD A;  2ZT9 D;  4U7J A;  1LTA C;  5KJ7 A;  1FZC C;  1VQ5 P;  3MIW A;  1CZQ A;  3SFD C;  5B5E H;  5B66 E;  3H1H G;  1DEE G;  3GW6 A;  3Q2Y A;  2R3S A;  2HG5 D;  5L8R J;  3BAT A;  4PD4 H;  2WSC J;  1FJP A;  1VF5 D;  1RE3 C;  2C0W A; 
#chains in the Genus database with same CATH homology
 1H8E H;  2CK3 H;  5FL7 H;  1BSH A;  4TLF A;  1BSN A;  2WSS H;  2QE7 H;  1FS0 E;  3OFN H;  4DJG A;  3USS A;  2W6J H;  3OEH H;  2XOK H;  1AQT A;  5DN6 I;  3EFF K;  1IFP A;  2V7Q H;  2XND H;  3OAA H;  2RQ7 A;  3OE7 H;  3FKS H;  4YXW H;  1E79 H;  2E5Y A;  4QMA A;  2RQ6 A;  2HLD H;  2E5T A;  4ASU H;  2JDI H;  1JEK A;  4WVZ A;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...