4YXWH

Bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
131
structure length
128
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title How release of phosphate from mammalian F1-ATPase generates a rotary substep.
pubmed doi rcsb
molecule tags Hydrolase
total genus 23
structure length 128
sequence length 131
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4yxwH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 4yxwH01
1BSNA 1AQTA 2XNDH 1FS0E 4TLFA 3OE7H 3PJSK 3OEHH 2E5YA 4QMAA 2QE7H 1JEKA 4YXWH 3OAAH 5FL7H 2E5TA 1BSHA 2V7QH 2W6JH 5DN6I 2WSSH 2XOKH 1IFPA 4DJGA 3OFNH 2JDIH 1H8EH 2RQ7A 1E79H 3EFFK 3FKSH 2HLDH 4WVZA 3USSA 2CK3H 4ASUH 2RQ6A
chains in the Genus database with same CATH superfamily
1KILA 1R8EA 4WY4D 1PP9E 1PP9D 5KJ7C 4H0LD 4OGQD 2ZXEB 4I2LC 4JYBA 3A0HH 1FZGA 4PJ0E 2QG4A 2K9JB 1NWQA 2LR2A 2YNYA 3G6EP 2YXRB 3B5NA 3L71E 3MD0A 2VRSA 2WPRA 3RL0C 4ZNCA 5DJUB 4GT1A 1VQLP 3CCEP 3GW6A 3L75E 4WY4B 3L75D 1PP9G 1G2CA 5AW6B 4H0LB 3AEGC 4OGQB 1BCCJ 3GHGB 3AEBC 3OEHH 3RK3E 5CJ4A 1YITP 1AQ5A 1VF5C 3B5NC 2V7QJ 3V5BA 5AVWB 1H89A 1SP4A 1LTBC 1T3JA 1K05A 1W2EA 3CCSP 1NTZD 1XTGB 2HFED 1NKNA 1RE3A 2FYZA 1J1EB 2R5DA 2FYNB 3L75G 2KK7A 5AW2B 1JB0J 2I1KA 1OWAA 1VQ7P 2C0WA 2BEZF 3U1CA 2Q6QA 2KIKA 2QJKC 3AE4C 5CCGA 1WRGA 2O01J 4MN4C 2AEFA 2D2CD 1T2KC 4B86A 1FZFA 3TF5A 1RE3C 1NTZG 4Z1MH 1SQPJ 4CPGA 1QL2A 4JBZA 2A45H 1M1JB 3GF3A 3GF7A 2PFXA 1YQ4C 2R5BA 3H6PA 4I7ZC 1L0LJ 1MFZA 4AQRD 2FFDB 3CC4P 1M90Q 4GDOA 5CCGC 2GM4A 1URQA 4W7YA 3CC7P 1S1CX 3AE9C 4NPFX 1SFCD 2XNDH 1VPCA 1L0NE 2ZAEB 5B66H 1L0ND 1KZUB 1USDA 2XDJA 2HLOA 3HE4B 5APYA 4AUWA 1H0TB 2JWDA 2QA4P 1JY2P 3D71A 4KHXA 1JY2N 3BVHA 4YTPC 3RBXA 3BATA 3CMEP 3CCJP 2IYOA 1URQC 1YQ3C 1MV8A 1HGVA 3TK1A 4IFFA 3CCQP 4JYCA 1NOHA 3SFEC 1J2JB 4XE5B 2FYUJ 3AEDC 2Z5IA 1U57A 4EDFA 1SFCB 2MJZA 2H8PD 1L0NG 3L70D 2FBWC 3KPEA 1YIJP 1AQTA 3O6QA 1S4XA 2YXQB 3E7KA 3AE8C 3WUVA 1SQVJ 3BCCD 4LC1A 4UB6E 3EFGA 1SVFA 1SQQJ 1SQXJ 4DJGA 1JY2O 3SWYA 1EXJA 1KV4A 3V4WA 1Y47A 2OYOA 2QJPC 2KNCA 1HJBA 5KAIH 4ASVA 1GW3A 3M9QA 1SQBG 3H32A 1NTZK 3L70G 1GL2A 1OZHA 3CXHE 2Y0EA 3L73D 3CXHD 2NPSC 3KZIE 2WSCJ 2Q9IA 1Q2NA 1JMMA 3BCCG 2W8ZA 2B88A 1SQPK 1M8OB 3VP8A 3H1LJ 1FDMA 1BGYE 1EC5A 1BGYD 1VQ4P 2IPPA 3TGUE 2BCCD 1JO5A 5KTBA 2G3AA 3OAKA 1FJKA 4H13C 2LXBA 3V2QA 4WB4A 2O1KA 2K9JA 2P2UA 2KB7P 2ZVOB 4W80A 1PL5A 1GL2C 3B4SA 3L73G 2OYIC 4K35A 1X9VA 3NTNA 1EDJA 1FZCB 4WY4A 2IZ0A 1NHLA 1BGYG 2BCCG 3GHGA 1NVOA 3W68A 4TLFA 1PGQA 1QVGO 3L74J 3AEFC 1J1DB 3NFQA 2IYPA 3F89A 3SSUA 1ZLLA 4PD4E 1HWTC 4PD4D 1IO4A 2Y0DA 3H1JE 2FYUK 1OVRA 2YO3A 3UIAA 1LTSC 3CCVP 3AE3C 2A06D 4Y99B 1RF0A 3V2NA 4GKGA 5AVZB 1CI6B 2RQ7A 2A45I 1SQVK 1OW6A 2YIUB 1SQBK 2XU6A 2QE7H 1SQQK 1SQXK 5FL7H 4KT0J 2FYNC 3VMXA 2WSFH 1M1JA 1Q86Q 3B71A 3H1IG 2A06G 1KFNA 1R5SA 1RH5B 3G4SP 3AE2C 1D7MA 2MKVA 1NKZB 2FFDA 4GIFA 4D6TE 4YXWH 1P84D 1SLQA 1RF1B 3TSIA 4C7RA 5KLIB 5APSA 4YPCA 1KQLA 2KSJA 1KB9I 2C0XA 4WVZA 4ASUH 3P8MC 2AEJA 1S5LE 1SS1A 3ZDMA 2AXCA 3VMZA 1AVOA 1M1JC 1ZRTE 4JQ0D 1ZRTD 1H0TA 3S4RA 1JY3P 3L36A 2KYVA 1JY3N 2WMMA 2R32A 2WVRA 1NYHA 1HTLC 2KI7B 3L72E 1G1JA 2N1TC 2QM7A 3L72D 5GTIH 1Q90D 1T6AA 5KKZB 5E79E 2QEXP 3P7KA 2ZVNB 1SFCA 4RO0A 5CHXA 2JO1A 2HPCA 1QEXA 3H1KE 4UB8E 3CD6P 2WSEH 2PAJA 3JSVC 4UB6H 3CWBE 3ITKA 2E74D 3MZWB 3Q3DA 1SFCC 2XKMA 2OTKE 1KYOE 1KYOD 4EI2A 4DT0A 1KORA 1LT9C 1YHQP 1LWUB 5DN6I 4U3FJ 1M7LA 3CXHH 1Q81Q 2GUVA 4DCKA 3H1HJ 3R2PA 2ZYDA 1N7SB 1VDFA 4U7JA 1FOSE 2OTLP 3V6IA 1FZAA 2ZXXA 1A02F 2IBZE 1NTKD 1ZR2A 3O8ZA 1MZ9A 2NZ2A 3WU2E 1NU1K 3FGAD 4HYTB 2W27A 4RESB 5AW3B 1EZVE 1FZCA 4XA4A 3VOPA 1E79H 1MUUA 2W83C 2W6BA 3I56P 3A7OA 2WPSA 3L71D 5AW0B 1NTKG 1OX3A 2HODA 1KILC 1Y8AA 3CX5E 3CX5D 4JPZB 3OFNH 4PD4H 4OVNF 1FS0E 5EFWB 1LJ2A 3RK3D 1S2EA 2J5UA 1ZP0C 1LP1B 5KLVK 1DEEG 3E1RA 1CI6A 2H7HA 3SFDC 3L71G 5AW4B 3GMAA 1J1DC 3L75J 1HJ0A 2E76D 3BRVB 1NAYA 2CPBA 1GW4A 1N73B 2ZFCA 1RHZB 3WUUA 2KP8A 3FXDA 1UIXA 2J58A 1YJ9P 2R44A 3TNUA 2WITA 4Y99C 1KQFB 2I1JA 1NTZJ 3RK3B 2RMZA 5APWA 4TT3H 1P84H 4NPDA 2IDBA 3P8CE 3U1AA 1IFDA 1SQPE 2E76B 1RF1A 5AVRB 3P32A 1HH0A 2IZ1A 5CCHD 1L0LE 2LKMA 2W6AA 1L0LD 1S5LH 3V2PA 3VMYA 1JOCA 1IFJA 2P67A 2ITAA 2IX7C 2DW3A 3JCUH 3C9IA 2GUSA 2D2CB 2W90A 2WSFJ 3RK2D 2H43A 5APQA 5KLIC 4BWNA 3MTUE 3OW2O 1S3JA 1PZQA 5E79H 2Q3IA 2V4HA 2RKLA 1L0LG 1HGZA 3TDKA 3L35A 3FXEA 3HTKB 1FAVA 2CK3H 1PFIA 3E1IA 4NPEA 4UB8H 2L5GB 4YXDC 1W2BO 2K9YA 1NH4A 1VQ8P 3RK2B 1Q7YQ 2WSSH 5KKZC 5B5EE 1YBKA 3CXHI 4KJMA 2K3RA 2HG5D 2Y0CA 2KS1B 1KYOH 1JCDA 1SQVE 1GU5A 5CJ0A 2ZJSE 1OXZA 1LWUA 2Z4EA 1YI2P 5AW5B 2JP3A 1SQXE 2YMYA 1SQBJ 2QIWA 4PV1C 3L70J 2AEMA 1AFOA 1BSNA 2WPVB 1N7SA 4R4MA 1E5WA 2QSIA 1EQ7A 1IJDB 2K1AA 1FZEA 1U7JA 3A3YB 2WSEJ 5KJ7D 3HRNA 1KMIZ 3BCCJ 2AXTE 2KOGA 5L8RJ 3A0BH 3KYQA 1KN7A 1MKMA 1LWUC 2WQYC 3RL0D 3Q1MA 1NTME 1LTTC 1JCCA 1NTMD 3TGUD 1N7SC 4HKZH 4GOFA 3M06A 3L73J 3V4QA 4C7NB 4PJ0H 1W5CE 4PD4I 4AYCA 3CCUP 3IN6A 2YKPA 3K5BA 2ZT9D 4BRYB 1BGYJ 1VF5D 2BCCJ 1BSHA 3B5ND 1U7MA 2YMKA 5KAFE 3CX5H 5GTHE 3RL0B 2XV5A 4HB1A 3CC2P 3FKSH 1G1IA 1LNQA 2HLDH 1X8YA 1NTMG 2KXPB 3TGUG 3M0DA 3C1LA 3PLNA 1IK9A 3L74E 3OAAH 2FY8A 3AE6C 5K5GB 1LP1A 2IFMA 2W6JH 3A0HE 3D6ZA 4O9BA 2ZT9B 1L0NK 1VQKP 1VF5B 1OW8A 3B5NB 3H1JD 1N73A 4WY4C 2Y9ZA 1ZXGA 4H0LC 4OGQC 1P84I 4C46A 3GHGC 1BE3J 4ASWA 1N86A 1VQ9P 1BDDA 1EDIA 3WMM0 1GD2E 4WBAA 5CMZA 3KDPB 1OMIA 2KZIA 3H1IJ 1DEBA 3MHVA 1FU1A 3EQ2A 5M1BA 5AVQB 1N73C 1J1EC 3H1JG 3D70A 4IL6E 2Q1KA 1RF0C 4JF7A 3RK3C 3Q2YA 3Q5SA 4D6TD 1NU1J 3V2RA 1OFCX 2YKOA 2OTJP 2RH0A 2JDIH 2E76C 3AE1C 3JC22 3AEAC 1AJYA 3HE4A 3IF4A 3VYIA 1Z56A 3HTKA 2FFDC 3CMAP 1CSBA 3IAOA 1NGMB 3D6YA 4D6TG 4I1LA 1S5LX 5AVSB 3CI9A 2D2CC 4RKUJ 4LLHA 4L73A 2IFNA 5H2FE 2B9BA 2I8DA 4EYYQ 1HBWA 5B5EH 3AEEC 2BEQD 3R4YA 2KS1A 2WTYA 3H1KD 5KLVJ 4M3LA 2M5AB 1CW5A 1ZMEC 1KFMA 2OGUA 1K04A 1KB9E 3NMDA 1KB9D 4I6MC 2NPSD 3CWBD 3L72G 3LIEA 1GK6A 2H88C 1USEA 1K8AQ 3AECC 1JY3O 1RQVA 3OJAB 2WT7B 2FXOA 1JM0A 1PGPA 2OQQA 2AXTH 4U3FE 2QJPB 3H1KG 3H1HE 1UIIA 3H1HD 2JR8A 1QVFO 4L76A 3KZIH 2LXCB 1GL2D 1X22A 4RJTA 2XZRA 1LTAC 5C39A 1JEKA 2BASA 5CBOA 3CWBG 2NPSB 2E74B 3LIDA 1L4AD 3M9HA 2IBZD 2P10A 1IZNB 4C7NA 1FC2C 3G9RA 3PRJA 1QGKB 1ZOYC 1L2PA 1IFIA 1VQOP 3SWKA 3OE7H 4BRYA 2RN0A 3H1HG 3U59A 3KQGA 4EOTA 3PHLA 1NTKJ 1EZVD 1VQNP 3WUTA 3EFFK 3A5TA 1JNMA 2OYIB 2Q7CA 3BASA 1L4AB 2KLUA 2IBZG 1PP9J 3AE7C 1OW7A 3MP7B 1KQSO 3KXDA 1NAFA 2G8YA 3CL3D 1FZCC 1BCCE 1M1KQ 2O3JA 1BCCD 1VQMP 3L71J 1EZVG 2ZYAA 4N3YB 3MIWA 4L74A 3OA7A 2XNXA 3QH9A 3IFMA 3IR9A 4IFDK 2QJYB 2PRRA 3PTZA 4DZOA 1Q82Q 1DD4A 1PPJE 1LTJB 1PPJD 1QX8A 2ZT9C 1WT6A 4R4LA 1FOSF 1YJWP 3HUSB 1IFMA 3PP5A 3F5HA 3HE5B 1M57D 1BCCG 1Y9BA 1EDKA 1NTZE 1GZLA 1RY3A 4IL6H 1K73Q 3S1KA 2Y9YA 1M56D 1GDTA 1KTMA 1VQ5P 5AW9B 5BU8B 1S72P 3P8CD 1SQPD 2PP6A 2YIUC 1PPJG 1KC8Q 5DJTB 1FDOA 3M91A 4BXLA 3M9BA 3S9OA 2N1TD 3G3ZA 2KLVA 2E5TA 3Q5PA 2M8RA 3M0AA 3FWNA 1CZQA 4Y28J 3Q5RA 1FDIA 2M3EA 1HVVA 1XTCC 1RF1C 1N2DC 2E43A 1NTKK 1SQPG 1BDCA 3CCLP 2H89C 1LTGC 3RGUA 1PGOA 3TYYA 5H2FH 1VL2A 2N1TB 4H44D 3B8EB 5APTA 4HH2A 2M5AA 3GLMA 4ZMDA 3CLQA 2JKVA 1H88A 1L0NJ 1LGHB 2FYUE 1K9MQ 2FYUD 3C8VA 3G71P 2HYNA 3PH0A 1S9KE 1S9KD 5TISE 1KB9H 1IFPA 4OH8B 3LW5H 2JJLA 2RQ6A 3FX0A 2WT7A 1EXIA 2N9YB 2E75D 5GTIE 3HD7D 3N7NA 3KHUA 1SQVD 4H44B 4DOJA 3VN0A 4IFMA 5AVVB 2ZYGA 1SQBE 2XOKH 1SQQE 1YTZT 1SQBD 2B87B 1SQQD 1SQXD 1VQ6P 3L70E 5AW8B 2HPCB 2FYUG 1JTHB 1LT9B 2M3BA 2YKQA 2Z5HA 2PGDA 3BCCE 2NPSA 2N9BA 2JEEA 1PV3A 1H8AA 2E75B 4W7ZA 3FWLA 3HD7B 1SQVG 4L75A 3WU2H 5AVYB 2M0BA 2OYHB 3H1LE 3H1LD 4K3AA 2KZJA 1SQQG 1SQXG 5APUA 1KILE 2FXPA 1KILD 3L73E 2POHA 4OWFA 2E74C 3EWKA 2OYIA 2Q3EA 1ZR4A 1L4AA 4GODA 1X0TA 2J59M 2BCCE 1IFNA 1ZN5A 1NTMJ 2KUBA 3TGUJ 3CCMP 1YJNP 4A7PA 3T97B 1L0LK 1T8ZA 1KD1Q 3H1LG 5AVUB 3VTPC 1KILB 2C9NY 3VP9A 2CPSA 3GG2A 1FE6A 4QMAA 3H25A 3L74D 1L4AC 2V7QH 1NJIQ 1JMBA 1R5LA 2GA1A 1ZW0A 1LTJA 2QRXA 1T2KD 3HUSA 1DIPA 3CPWO 2E42A 3NXSA 3HE5A 1BE3E 3I5CA 1BE3D 2HODB 3M0DC 2WPQA 3II6A 2C9LY 3MUDA 1TU3F 3L74G 1G2CB 2O01H 3H1JJ 3N4XA 2QJYC 1MFTA 3H1IE 3H1ID 2A06E 3PJSK 4GOEA 3VMAA 1LTJC 5CCGD 2QJKB 3MGNA 1AV1A 3HUSC 1AVYA 1ZV8A 3QWOC 5BVZA 1FZBA 3RBZA 1BE3G 2R3CA 3MUDC 3SWFA 1NU1E 1NU1D 3TNUB 1RQUA 4ZKUA 4IOIH 5AW7B 2L91A 4IL6X 1HF9A 4I7ZB 2Q5UA 2YO2A 4LGDE 1URQD 2O1JA 1X79B 1EDLA 3ABVC 1P84E 2JWAA 2E5YA 4ZKPA 1VQPP 4D6TJ 5CCHA 2N1TA 3CCRP 1NTMK 1NU1G 1FJPA 4N78E 4N78D 1GMJA 3I55P 1T3UA 1RE4A 1KYOI 1QLED 3JCUE 5APVA 2P7JA 2QM8A 5CBNA 5TISH 1URQB 1A02J 5AVTB 2UWJE 1IC2A 2FXMA 4PV1D 1DD3A 1KQGB 5CCHC 5KLVE 4EIJA 5KLVD 3A2AA 2WZ7A 5B66E 3L72J 5AVXB 2A45G 2QVAA 1GTWA 3RL0g 2B87A 1N7LA 2NRGA 3AE5C 2IBZI 2OARA 1RE4C 4WWIA 3BRTB 3RK2C 1IK7A 1JTHA 1LT9A 3H1KJ 2K37A 4PV1B 1N7SD 1PGJA 2HR3A 4H13D 1LT1A 5KLVG 1YTZI 4U3FD 1EZVI 4H44C 3HD7A 2FKWB 3CWBJ 2WSCH 3L4FA 3LW5J 1JUNA 2SPZA 2OYHA 1LTIC 1DH3A 5TJHA 3O6QB 4HJGH 1OVUA 5AW1B 1N8RQ 1AA0A 3W67A 1PIXA 4N6JA 1QL1A 1GK4A 4XFJA 2WWWA 1OVVA 3CX5I 1DX7A 1H8EH 2R3SA 1WMKA 5BU5A 5KJ7A 1FBMA 5APXA 5KAIE 1HUCA 2KNCB 2E75C 4H13B 1NO4A 3HD7C 4U3FG 1YYCA 2KSEA 2O01N 3H32B 1NTKE 2OYHC 3A0BE 3T97A 5KAFH 2P58A 1GL2B 2P1JA 2K88A 5GTHH 2B89A 1OIPA 3L37A 1GU4A 3USSA
chains in the Genus database with same CATH topology
1BSNA 1AQTA 2XNDH 1FS0E 4TLFA 3OE7H 3PJSK 3OEHH 2E5YA 4QMAA 2QE7H 1JEKA 4YXWH 3OAAH 5FL7H 2E5TA 1BSHA 2V7QH 2W6JH 5DN6I 2WSSH 2XOKH 1IFPA 4DJGA 3OFNH 2JDIH 1H8EH 2RQ7A 1E79H 3EFFK 3FKSH 2HLDH 4WVZA 3USSA 2CK3H 4ASUH 2RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSN A;  1AQT A;  2XND H;  1FS0 E;  4TLF A;  3OE7 H;  3PJS K;  3OEH H;  2E5Y A;  4QMA A;  2QE7 H;  1JEK A;  4YXW H;  3OAA H;  5FL7 H;  2E5T A;  1BSH A;  2V7Q H;  2W6J H;  5DN6 I;  2WSS H;  2XOK H;  1IFP A;  4DJG A;  3OFN H;  2JDI H;  1H8E H;  2RQ7 A;  1E79 H;  3EFF K;  3FKS H;  2HLD H;  4WVZ A;  3USS A;  2CK3 H;  4ASU H;  2RQ6 A; 
#chains in the Genus database with same CATH topology
 1KIL A;  1R8E A;  4WY4 D;  1PP9 E;  1PP9 D;  5KJ7 C;  4H0L D;  4OGQ D;  2ZXE B;  4I2L C;  4JYB A;  3A0H H;  1FZG A;  4PJ0 E;  2QG4 A;  2K9J B;  1NWQ A;  2LR2 A;  2YNY A;  3G6E P;  2YXR B;  3B5N A;  3L71 E;  3MD0 A;  2VRS A;  2WPR A;  3RL0 C;  4ZNC A;  5DJU B;  4GT1 A;  1VQL P;  3CCE P;  3GW6 A;  3L75 E;  4WY4 B;  3L75 D;  1PP9 G;  1G2C A;  5AW6 B;  4H0L B;  3AEG C;  4OGQ B;  1BCC J;  3GHG B;  3AEB C;  3OEH H;  3RK3 E;  5CJ4 A;  1YIT P;  1AQ5 A;  1VF5 C;  3B5N C;  2V7Q J;  3V5B A;  5AVW B;  1H89 A;  1SP4 A;  1LTB C;  1T3J A;  1K05 A;  1W2E A;  3CCS P;  1NTZ D;  1XTG B;  2HFE D;  1NKN A;  1RE3 A;  2FYZ A;  1J1E B;  2R5D A;  2FYN B;  3L75 G;  2KK7 A;  5AW2 B;  1JB0 J;  2I1K A;  1OWA A;  1VQ7 P;  2C0W A;  2BEZ F;  3U1C A;  2Q6Q A;  2KIK A;  2QJK C;  3AE4 C;  5CCG A;  1WRG A;  2O01 J;  4MN4 C;  2AEF A;  2D2C D;  1T2K C;  4B86 A;  1FZF A;  3TF5 A;  1RE3 C;  1NTZ G;  4Z1M H;  1SQP J;  4CPG A;  1QL2 A;  4JBZ A;  2A45 H;  1M1J B;  3GF3 A;  3GF7 A;  2PFX A;  1YQ4 C;  2R5B A;  3H6P A;  4I7Z C;  1L0L J;  1MFZ A;  4AQR D;  2FFD B;  3CC4 P;  1M90 Q;  4GDO A;  5CCG C;  2GM4 A;  1URQ A;  4W7Y A;  3CC7 P;  1S1C X;  3AE9 C;  4NPF X;  1SFC D;  2XND H;  1VPC A;  1L0N E;  2ZAE B;  5B66 H;  1L0N D;  1KZU B;  1USD A;  2XDJ A;  2HLO A;  3HE4 B;  5APY A;  4AUW A;  1H0T B;  2JWD A;  2QA4 P;  1JY2 P;  3D71 A;  4KHX A;  1JY2 N;  3BVH A;  4YTP C;  3RBX A;  3BAT A;  3CME P;  3CCJ P;  2IYO A;  1URQ C;  1YQ3 C;  1MV8 A;  1HGV A;  3TK1 A;  4IFF A;  3CCQ P;  4JYC A;  1NOH A;  3SFE C;  1J2J B;  4XE5 B;  2FYU J;  3AED C;  2Z5I A;  1U57 A;  4EDF A;  1SFC B;  2MJZ A;  2H8P D;  1L0N G;  3L70 D;  2FBW C;  3KPE A;  1YIJ P;  1AQT A;  3O6Q A;  1S4X A;  2YXQ B;  3E7K A;  3AE8 C;  3WUV A;  1SQV J;  3BCC D;  4LC1 A;  4UB6 E;  3EFG A;  1SVF A;  1SQQ J;  1SQX J;  4DJG A;  1JY2 O;  3SWY A;  1EXJ A;  1KV4 A;  3V4W A;  1Y47 A;  2OYO A;  2QJP C;  2KNC A;  1HJB A;  5KAI H;  4ASV A;  1GW3 A;  3M9Q A;  1SQB G;  3H32 A;  1NTZ K;  3L70 G;  1GL2 A;  1OZH A;  3CXH E;  2Y0E A;  3L73 D;  3CXH D;  2NPS C;  3KZI E;  2WSC J;  2Q9I A;  1Q2N A;  1JMM A;  3BCC G;  2W8Z A;  2B88 A;  1SQP K;  1M8O B;  3VP8 A;  3H1L J;  1FDM A;  1BGY E;  1EC5 A;  1BGY D;  1VQ4 P;  2IPP A;  3TGU E;  2BCC D;  1JO5 A;  5KTB A;  2G3A A;  3OAK A;  1FJK A;  4H13 C;  2LXB A;  3V2Q A;  4WB4 A;  2O1K A;  2K9J A;  2P2U A;  2KB7 P;  2ZVO B;  4W80 A;  1PL5 A;  1GL2 C;  3B4S A;  3L73 G;  2OYI C;  4K35 A;  1X9V A;  3NTN A;  1EDJ A;  1FZC B;  4WY4 A;  2IZ0 A;  1NHL A;  1BGY G;  2BCC G;  3GHG A;  1NVO A;  3W68 A;  4TLF A;  1PGQ A;  1QVG O;  3L74 J;  3AEF C;  1J1D B;  3NFQ A;  2IYP A;  3F89 A;  3SSU A;  1ZLL A;  4PD4 E;  1HWT C;  4PD4 D;  1IO4 A;  2Y0D A;  3H1J E;  2FYU K;  1OVR A;  2YO3 A;  3UIA A;  1LTS C;  3CCV P;  3AE3 C;  2A06 D;  4Y99 B;  1RF0 A;  3V2N A;  4GKG A;  5AVZ B;  1CI6 B;  2RQ7 A;  2A45 I;  1SQV K;  1OW6 A;  2YIU B;  1SQB K;  2XU6 A;  2QE7 H;  1SQQ K;  1SQX K;  5FL7 H;  4KT0 J;  2FYN C;  3VMX A;  2WSF H;  1M1J A;  1Q86 Q;  3B71 A;  3H1I G;  2A06 G;  1KFN A;  1R5S A;  1RH5 B;  3G4S P;  3AE2 C;  1D7M A;  2MKV A;  1NKZ B;  2FFD A;  4GIF A;  4D6T E;  4YXW H;  1P84 D;  1SLQ A;  1RF1 B;  3TSI A;  4C7R A;  5KLI B;  5APS A;  4YPC A;  1KQL A;  2KSJ A;  1KB9 I;  2C0X A;  4WVZ A;  4ASU H;  3P8M C;  2AEJ A;  1S5L E;  1SS1 A;  3ZDM A;  2AXC A;  3VMZ A;  1AVO A;  1M1J C;  1ZRT E;  4JQ0 D;  1ZRT D;  1H0T A;  3S4R A;  1JY3 P;  3L36 A;  2KYV A;  1JY3 N;  2WMM A;  2R32 A;  2WVR A;  1NYH A;  1HTL C;  2KI7 B;  3L72 E;  1G1J A;  2N1T C;  2QM7 A;  3L72 D;  5GTI H;  1Q90 D;  1T6A A;  5KKZ B;  5E79 E;  2QEX P;  3P7K A;  2ZVN B;  1SFC A;  4RO0 A;  5CHX A;  2JO1 A;  2HPC A;  1QEX A;  3H1K E;  4UB8 E;  3CD6 P;  2WSE H;  2PAJ A;  3JSV C;  4UB6 H;  3CWB E;  3ITK A;  2E74 D;  3MZW B;  3Q3D A;  1SFC C;  2XKM A;  2OTK E;  1KYO E;  1KYO D;  4EI2 A;  4DT0 A;  1KOR A;  1LT9 C;  1YHQ P;  1LWU B;  5DN6 I;  4U3F J;  1M7L A;  3CXH H;  1Q81 Q;  2GUV A;  4DCK A;  3H1H J;  3R2P A;  2ZYD A;  1N7S B;  1VDF A;  4U7J A;  1FOS E;  2OTL P;  3V6I A;  1FZA A;  2ZXX A;  1A02 F;  2IBZ E;  1NTK D;  1ZR2 A;  3O8Z A;  1MZ9 A;  2NZ2 A;  3WU2 E;  1NU1 K;  3FGA D;  4HYT B;  2W27 A;  4RES B;  5AW3 B;  1EZV E;  1FZC A;  4XA4 A;  3VOP A;  1E79 H;  1MUU A;  2W83 C;  2W6B A;  3I56 P;  3A7O A;  2WPS A;  3L71 D;  5AW0 B;  1NTK G;  1OX3 A;  2HOD A;  1KIL C;  1Y8A A;  3CX5 E;  3CX5 D;  4JPZ B;  3OFN H;  4PD4 H;  4OVN F;  1FS0 E;  5EFW B;  1LJ2 A;  3RK3 D;  1S2E A;  2J5U A;  1ZP0 C;  1LP1 B;  5KLV K;  1DEE G;  3E1R A;  1CI6 A;  2H7H A;  3SFD C;  3L71 G;  5AW4 B;  3GMA A;  1J1D C;  3L75 J;  1HJ0 A;  2E76 D;  3BRV B;  1NAY A;  2CPB A;  1GW4 A;  1N73 B;  2ZFC A;  1RHZ B;  3WUU A;  2KP8 A;  3FXD A;  1UIX A;  2J58 A;  1YJ9 P;  2R44 A;  3TNU A;  2WIT A;  4Y99 C;  1KQF B;  2I1J A;  1NTZ J;  3RK3 B;  2RMZ A;  5APW A;  4TT3 H;  1P84 H;  4NPD A;  2IDB A;  3P8C E;  3U1A A;  1IFD A;  1SQP E;  2E76 B;  1RF1 A;  5AVR B;  3P32 A;  1HH0 A;  2IZ1 A;  5CCH D;  1L0L E;  2LKM A;  2W6A A;  1L0L D;  1S5L H;  3V2P A;  3VMY A;  1JOC A;  1IFJ A;  2P67 A;  2ITA A;  2IX7 C;  2DW3 A;  3JCU H;  3C9I A;  2GUS A;  2D2C B;  2W90 A;  2WSF J;  3RK2 D;  2H43 A;  5APQ A;  5KLI C;  4BWN A;  3MTU E;  3OW2 O;  1S3J A;  1PZQ A;  5E79 H;  2Q3I A;  2V4H A;  2RKL A;  1L0L G;  1HGZ A;  3TDK A;  3L35 A;  3FXE A;  3HTK B;  1FAV A;  2CK3 H;  1PFI A;  3E1I A;  4NPE A;  4UB8 H;  2L5G B;  4YXD C;  1W2B O;  2K9Y A;  1NH4 A;  1VQ8 P;  3RK2 B;  1Q7Y Q;  2WSS H;  5KKZ C;  5B5E E;  1YBK A;  3CXH I;  4KJM A;  2K3R A;  2HG5 D;  2Y0C A;  2KS1 B;  1KYO H;  1JCD A;  1SQV E;  1GU5 A;  5CJ0 A;  2ZJS E;  1OXZ A;  1LWU A;  2Z4E A;  1YI2 P;  5AW5 B;  2JP3 A;  1SQX E;  2YMY A;  1SQB J;  2QIW A;  4PV1 C;  3L70 J;  2AEM A;  1AFO A;  1BSN A;  2WPV B;  1N7S A;  4R4M A;  1E5W A;  2QSI A;  1EQ7 A;  1IJD B;  2K1A A;  1FZE A;  1U7J A;  3A3Y B;  2WSE J;  5KJ7 D;  3HRN A;  1KMI Z;  3BCC J;  2AXT E;  2KOG A;  5L8R J;  3A0B H;  3KYQ A;  1KN7 A;  1MKM A;  1LWU C;  2WQY C;  3RL0 D;  3Q1M A;  1NTM E;  1LTT C;  1JCC A;  1NTM D;  3TGU D;  1N7S C;  4HKZ H;  4GOF A;  3M06 A;  3L73 J;  3V4Q A;  4C7N B;  4PJ0 H;  1W5C E;  4PD4 I;  4AYC A;  3CCU P;  3IN6 A;  2YKP A;  3K5B A;  2ZT9 D;  4BRY B;  1BGY J;  1VF5 D;  2BCC J;  1BSH A;  3B5N D;  1U7M A;  2YMK A;  5KAF E;  3CX5 H;  5GTH E;  3RL0 B;  2XV5 A;  4HB1 A;  3CC2 P;  3FKS H;  1G1I A;  1LNQ A;  2HLD H;  1X8Y A;  1NTM G;  2KXP B;  3TGU G;  3M0D A;  3C1L A;  3PLN A;  1IK9 A;  3L74 E;  3OAA H;  2FY8 A;  3AE6 C;  5K5G B;  1LP1 A;  2IFM A;  2W6J H;  3A0H E;  3D6Z A;  4O9B A;  2ZT9 B;  1L0N K;  1VQK P;  1VF5 B;  1OW8 A;  3B5N B;  3H1J D;  1N73 A;  4WY4 C;  2Y9Z A;  1ZXG A;  4H0L C;  4OGQ C;  1P84 I;  4C46 A;  3GHG C;  1BE3 J;  4ASW A;  1N86 A;  1VQ9 P;  1BDD A;  1EDI A;  3WMM 0;  1GD2 E;  4WBA A;  5CMZ A;  3KDP B;  1OMI A;  2KZI A;  3H1I J;  1DEB A;  3MHV A;  1FU1 A;  3EQ2 A;  5M1B A;  5AVQ B;  1N73 C;  1J1E C;  3H1J G;  3D70 A;  4IL6 E;  2Q1K A;  1RF0 C;  4JF7 A;  3RK3 C;  3Q2Y A;  3Q5S A;  4D6T D;  1NU1 J;  3V2R A;  1OFC X;  2YKO A;  2OTJ P;  2RH0 A;  2JDI H;  2E76 C;  3AE1 C;  3JC2 2;  3AEA C;  1AJY A;  3HE4 A;  3IF4 A;  3VYI A;  1Z56 A;  3HTK A;  2FFD C;  3CMA P;  1CSB A;  3IAO A;  1NGM B;  3D6Y A;  4D6T G;  4I1L A;  1S5L X;  5AVS B;  3CI9 A;  2D2C C;  4RKU J;  4LLH A;  4L73 A;  2IFN A;  5H2F E;  2B9B A;  2I8D A;  4EYY Q;  1HBW A;  5B5E H;  3AEE C;  2BEQ D;  3R4Y A;  2KS1 A;  2WTY A;  3H1K D;  5KLV J;  4M3L A;  2M5A B;  1CW5 A;  1ZME C;  1KFM A;  2OGU A;  1K04 A;  1KB9 E;  3NMD A;  1KB9 D;  4I6M C;  2NPS D;  3CWB D;  3L72 G;  3LIE A;  1GK6 A;  2H88 C;  1USE A;  1K8A Q;  3AEC C;  1JY3 O;  1RQV A;  3OJA B;  2WT7 B;  2FXO A;  1JM0 A;  1PGP A;  2OQQ A;  2AXT H;  4U3F E;  2QJP B;  3H1K G;  3H1H E;  1UII A;  3H1H D;  2JR8 A;  1QVF O;  4L76 A;  3KZI H;  2LXC B;  1GL2 D;  1X22 A;  4RJT A;  2XZR A;  1LTA C;  5C39 A;  1JEK A;  2BAS A;  5CBO A;  3CWB G;  2NPS B;  2E74 B;  3LID A;  1L4A D;  3M9H A;  2IBZ D;  2P10 A;  1IZN B;  4C7N A;  1FC2 C;  3G9R A;  3PRJ A;  1QGK B;  1ZOY C;  1L2P A;  1IFI A;  1VQO P;  3SWK A;  3OE7 H;  4BRY A;  2RN0 A;  3H1H G;  3U59 A;  3KQG A;  4EOT A;  3PHL A;  1NTK J;  1EZV D;  1VQN P;  3WUT A;  3EFF K;  3A5T A;  1JNM A;  2OYI B;  2Q7C A;  3BAS A;  1L4A B;  2KLU A;  2IBZ G;  1PP9 J;  3AE7 C;  1OW7 A;  3MP7 B;  1KQS O;  3KXD A;  1NAF A;  2G8Y A;  3CL3 D;  1FZC C;  1BCC E;  1M1K Q;  2O3J A;  1BCC D;  1VQM P;  3L71 J;  1EZV G;  2ZYA A;  4N3Y B;  3MIW A;  4L74 A;  3OA7 A;  2XNX A;  3QH9 A;  3IFM A;  3IR9 A;  4IFD K;  2QJY B;  2PRR A;  3PTZ A;  4DZO A;  1Q82 Q;  1DD4 A;  1PPJ E;  1LTJ B;  1PPJ D;  1QX8 A;  2ZT9 C;  1WT6 A;  4R4L A;  1FOS F;  1YJW P;  3HUS B;  1IFM A;  3PP5 A;  3F5H A;  3HE5 B;  1M57 D;  1BCC G;  1Y9B A;  1EDK A;  1NTZ E;  1GZL A;  1RY3 A;  4IL6 H;  1K73 Q;  3S1K A;  2Y9Y A;  1M56 D;  1GDT A;  1KTM A;  1VQ5 P;  5AW9 B;  5BU8 B;  1S72 P;  3P8C D;  1SQP D;  2PP6 A;  2YIU C;  1PPJ G;  1KC8 Q;  5DJT B;  1FDO A;  3M91 A;  4BXL A;  3M9B A;  3S9O A;  2N1T D;  3G3Z A;  2KLV A;  2E5T A;  3Q5P A;  2M8R A;  3M0A A;  3FWN A;  1CZQ A;  4Y28 J;  3Q5R A;  1FDI A;  2M3E A;  1HVV A;  1XTC C;  1RF1 C;  1N2D C;  2E43 A;  1NTK K;  1SQP G;  1BDC A;  3CCL P;  2H89 C;  1LTG C;  3RGU A;  1PGO A;  3TYY A;  5H2F H;  1VL2 A;  2N1T B;  4H44 D;  3B8E B;  5APT A;  4HH2 A;  2M5A A;  3GLM A;  4ZMD A;  3CLQ A;  2JKV A;  1H88 A;  1L0N J;  1LGH B;  2FYU E;  1K9M Q;  2FYU D;  3C8V A;  3G71 P;  2HYN A;  3PH0 A;  1S9K E;  1S9K D;  5TIS E;  1KB9 H;  1IFP A;  4OH8 B;  3LW5 H;  2JJL A;  2RQ6 A;  3FX0 A;  2WT7 A;  1EXI A;  2N9Y B;  2E75 D;  5GTI E;  3HD7 D;  3N7N A;  3KHU A;  1SQV D;  4H44 B;  4DOJ A;  3VN0 A;  4IFM A;  5AVV B;  2ZYG A;  1SQB E;  2XOK H;  1SQQ E;  1YTZ T;  1SQB D;  2B87 B;  1SQQ D;  1SQX D;  1VQ6 P;  3L70 E;  5AW8 B;  2HPC B;  2FYU G;  1JTH B;  1LT9 B;  2M3B A;  2YKQ A;  2Z5H A;  2PGD A;  3BCC E;  2NPS A;  2N9B A;  2JEE A;  1PV3 A;  1H8A A;  2E75 B;  4W7Z A;  3FWL A;  3HD7 B;  1SQV G;  4L75 A;  3WU2 H;  5AVY B;  2M0B A;  2OYH B;  3H1L E;  3H1L D;  4K3A A;  2KZJ A;  1SQQ G;  1SQX G;  5APU A;  1KIL E;  2FXP A;  1KIL D;  3L73 E;  2POH A;  4OWF A;  2E74 C;  3EWK A;  2OYI A;  2Q3E A;  1ZR4 A;  1L4A A;  4GOD A;  1X0T A;  2J59 M;  2BCC E;  1IFN A;  1ZN5 A;  1NTM J;  2KUB A;  3TGU J;  3CCM P;  1YJN P;  4A7P A;  3T97 B;  1L0L K;  1T8Z A;  1KD1 Q;  3H1L G;  5AVU B;  3VTP C;  1KIL B;  2C9N Y;  3VP9 A;  2CPS A;  3GG2 A;  1FE6 A;  4QMA A;  3H25 A;  3L74 D;  1L4A C;  2V7Q H;  1NJI Q;  1JMB A;  1R5L A;  2GA1 A;  1ZW0 A;  1LTJ A;  2QRX A;  1T2K D;  3HUS A;  1DIP A;  3CPW O;  2E42 A;  3NXS A;  3HE5 A;  1BE3 E;  3I5C A;  1BE3 D;  2HOD B;  3M0D C;  2WPQ A;  3II6 A;  2C9L Y;  3MUD A;  1TU3 F;  3L74 G;  1G2C B;  2O01 H;  3H1J J;  3N4X A;  2QJY C;  1MFT A;  3H1I E;  3H1I D;  2A06 E;  3PJS K;  4GOE A;  3VMA A;  1LTJ C;  5CCG D;  2QJK B;  3MGN A;  1AV1 A;  3HUS C;  1AVY A;  1ZV8 A;  3QWO C;  5BVZ A;  1FZB A;  3RBZ A;  1BE3 G;  2R3C A;  3MUD C;  3SWF A;  1NU1 E;  1NU1 D;  3TNU B;  1RQU A;  4ZKU A;  4IOI H;  5AW7 B;  2L91 A;  4IL6 X;  1HF9 A;  4I7Z B;  2Q5U A;  2YO2 A;  4LGD E;  1URQ D;  2O1J A;  1X79 B;  1EDL A;  3ABV C;  1P84 E;  2JWA A;  2E5Y A;  4ZKP A;  1VQP P;  4D6T J;  5CCH A;  2N1T A;  3CCR P;  1NTM K;  1NU1 G;  1FJP A;  4N78 E;  4N78 D;  1GMJ A;  3I55 P;  1T3U A;  1RE4 A;  1KYO I;  1QLE D;  3JCU E;  5APV A;  2P7J A;  2QM8 A;  5CBN A;  5TIS H;  1URQ B;  1A02 J;  5AVT B;  2UWJ E;  1IC2 A;  2FXM A;  4PV1 D;  1DD3 A;  1KQG B;  5CCH C;  5KLV E;  4EIJ A;  5KLV D;  3A2A A;  2WZ7 A;  5B66 E;  3L72 J;  5AVX B;  2A45 G;  2QVA A;  1GTW A;  3RL0 g;  2B87 A;  1N7L A;  2NRG A;  3AE5 C;  2IBZ I;  2OAR A;  1RE4 C;  4WWI A;  3BRT B;  3RK2 C;  1IK7 A;  1JTH A;  1LT9 A;  3H1K J;  2K37 A;  4PV1 B;  1N7S D;  1PGJ A;  2HR3 A;  4H13 D;  1LT1 A;  5KLV G;  1YTZ I;  4U3F D;  1EZV I;  4H44 C;  3HD7 A;  2FKW B;  3CWB J;  2WSC H;  3L4F A;  3LW5 J;  1JUN A;  2SPZ A;  2OYH A;  1LTI C;  1DH3 A;  5TJH A;  3O6Q B;  4HJG H;  1OVU A;  5AW1 B;  1N8R Q;  1AA0 A;  3W67 A;  1PIX A;  4N6J A;  1QL1 A;  1GK4 A;  4XFJ A;  2WWW A;  1OVV A;  3CX5 I;  1DX7 A;  1H8E H;  2R3S A;  1WMK A;  5BU5 A;  5KJ7 A;  1FBM A;  5APX A;  5KAI E;  1HUC A;  2KNC B;  2E75 C;  4H13 B;  1NO4 A;  3HD7 C;  4U3F G;  1YYC A;  2KSE A;  2O01 N;  3H32 B;  1NTK E;  2OYH C;  3A0B E;  3T97 A;  5KAF H;  2P58 A;  1GL2 B;  2P1J A;  2K88 A;  5GTH H;  2B89 A;  1OIP A;  3L37 A;  1GU4 A;  3USS A; 
#chains in the Genus database with same CATH homology
 1BSN A;  1AQT A;  2XND H;  1FS0 E;  4TLF A;  3OE7 H;  3PJS K;  3OEH H;  2E5Y A;  4QMA A;  2QE7 H;  1JEK A;  4YXW H;  3OAA H;  5FL7 H;  2E5T A;  1BSH A;  2V7Q H;  2W6J H;  5DN6 I;  2WSS H;  2XOK H;  1IFP A;  4DJG A;  3OFN H;  2JDI H;  1H8E H;  2RQ7 A;  1E79 H;  3EFF K;  3FKS H;  2HLD H;  4WVZ A;  3USS A;  2CK3 H;  4ASU H;  2RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...