4YXWH

Bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
131
structure length
128
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title How release of phosphate from mammalian F1-ATPase generates a rotary substep.
pubmed doi rcsb
total genus 23
structure length 128
sequence length 131
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4yxwH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 4yxwH01
3OFNH 2CK3H 3USSA 3EFFK 2V7QH 3PJSK 2WSSH 1FS0E 4TLFA 3OEHH 1E79H 1IFPA 2E5YA 2JDIH 1H8EH 3OE7H 3FKSH 2RQ6A 5FL7H 5DN6I 4DJGA 2XOKH 1JEKA 2RQ7A 4WVZA 2XNDH 3OAAH 4YXWH 2HLDH 1BSNA 2QE7H 4ASUH 1AQTA 2E5TA 1BSHA 4QMAA 2W6JH
chains in the Genus database with same CATH superfamily
1MUUA 1RY3A 1X9VA 1EZVI 3BCCE 2ZVNB 4H0LC 2XNXA 3H1IG 3CCRP 3HD7D 3L74J 2ZJSE 4GKGA 3AE1C 2JKVA 4Y99B 1FZBA 1QL1A 1KYOE 1OZHA 1URQC 4TLFA 2H43A 5AW2B 3C1LA 2OTKE 1FC2C 2J5UA 1NU1E 2IZ0A 1LT9B 1YTZI 1Q2NA 1N7SB 1VF5D 3AEAC 2K1AA 4I7ZC 1KFMA 3N7NA 2FY8A 4H13D 2KNCB 2CPBA 1M1JC 1G1JA 2OYHA 2YXRB 1LTJA 2D2CD 2WT7B 1KYOI 2RN0A 1VDFA 2BCCJ 2QA4P 2FFDB 2JDIH 4HKZH 2FYUE 1UIXA 2P67A 3ABVC 3L4FA 4IL6E 1SQPJ 1GU5A 3GF7A 5L8RJ 1VQOP 2FYZA 1L0ND 2A06E 3E1RA 1ZW0A 4W7YA 4N78E 4YXDC 1UIIA 3BATA 1LTBC 1H89A 3B71A 1KZUB 1MFTA 3R2PA 1Y47A 5CBNA 2K9YA 1JY3O 4XE5B 3QWOC 5CJ0A 1OFCX 4ZNCA 1SQXG 3WMM0 2YMYA 1SQPK 2E74B 1KC8Q 3L71G 3Q3DA 1CZQA 3IR9A 2H88C 2O1JA 5KLVG 3BRVB 3BRTB 2O3JA 2G8YA 2K9JB 1NO4A 1ZMEC 3M0AA 3G6EP 4Y99C 2CPSA 3RK3C 2IYPA 1NAYA 1LTAC 4I6MC 2JWAA 5KLIB 2Y0DA 1GMJA 1KQSO 3VN0A 5B66E 3HUSA 4OGQC 3TNUA 3CCLP 1LT9C 2WTYA 1NTKE 2E74D 3H1JJ 1N7SC 1VQ9P 1EDLA 1L4AB 5CCHD 1RQUA 1M57D 1KILD 2Z4EA 5APYA 1LWUB 1AQTA 1YJWP 4YPCA 1NTME 3P8CE 3H1HE 2OTJP 3AE3C 3S1KA 1H8AA 3CC2P 1YIJP 2B88A 2XU6A 4RESB 1VQ6P 1SQVE 1IFDA 4K3AA 3D6YA 3TGUD 1XTGB 3CMEP 1YITP 1U57A 3HRNA 2CK3H 5AW0B 2QM8A 3L70D 2KLUA 1L4AD 2YO2A 4JBZA 1AQ5A 2WVRA 3CXHI 1E79H 4GOEA 2PRRA 3O6QB 2I8DA 3L73J 3B5NC 1J1EC 2KK7A 1W2EA 1M7LA 1KB9E 3CCMP 2JR8A 1USDA 4IFMA 5C39A 3U1AA 3WU2H 3LW5H 1SQQJ 1L2PA 3FKSH 1SVFA 1EDKA 3RBXA 4RO0A 2RKLA 1CW5A 1BCCD 2Q7CA 1QVFO 3M9QA 1BGYE 2RH0A 3TF5A 1SQPG 4IOIH 1SQBE 1PV3A 3II6A 1GU4A 4NPDA 2ZFCA 2KXPB 4H44B 2I1JA 5GTIE 4MN4C 1OVRA 1YHQP 3P8MC 4GT1A 1KB9I 2QJYB 1MZ9A 2JJLA 1BSHA 1IZNB 2NPSD 2FBWC 2ZXEB 4DCKA 5KLIC 1SQQK 3CD6P 2QJPB 3CWBG 1L0LG 2ZXXA 3RL0C 5CCGD 3H1KJ 3S4RA 1JCDA 1ZN5A 2ZYGA 1NTZG 3CX5E 2WMMA 2QJKC 1W5CE 3V2RA 1EXJA 3RL0g 1M90Q 1VQ7P 2WPRA 4U3FJ 3VP9A 1A02F 1RF1B 2AXCA 4H44D 4PD4H 1LWUC 5AVYB 2OYIA 5CJ4A 4U7JA 3B5NA 3L71D 3L75J 3TK1A 2W6BA 3P32A 1HF9A 4BXLA 3AE8C 4BWNA 1PGPA 1LP1A 2H7HA 4A7PA 5E79H 2M8RA 4LGDE 2WZ7A 2HPCA 2JO1A 4WB4A 2N1TD 1EDIA 4PJ0H 2KZJA 3HTKA 2OYHB 1LTJB 3RK2D 4PD4D 3M9BA 1K04A 1DD3A 3CX5I 3SWKA 3PTZA 1OVVA 4GOFA 2POHA 3I55P 2AXTE 1OMIA 5AVWB 1IK9A 2WSFH 2Q3IA 2IBZE 3D71A 4DZOA 3BCCJ 1FDOA 1KFNA 3VYIA 2E5TA 3SWFA 2R3SA 1N2DC 3L74D 3W68A 3BVHA 1S9KD 5KJ7A 1NWQA 3G9RA 2E76D 5AW4B 3WUTA 3L72E 1MV8A 1CSBA 1BSNA 1OVUA 3E1IA 4L74A 1NU1J 1NKNA 4D6TE 5KAFH 1SFCD 1KV4A 3B8EB 3AE5C 2W90A 2IBZI 3Q5SA 2B87A 2QJPC 4I7ZB 3NFQA 3H32A 2HLDH 2K88A 5H2FH 4H0LD 4L75A 2M5AA 3PRJA 4R4LA 4OVNF 2Q6QA 1CI6A 3FWNA 4C46A 2E5YA 1IFMA 3AEGC 3VMZA 2KSJA 1URQD 1P84E 2Z5HA 5AVTB 2IFMA 3HUSB 2FYUJ 3TNUB 2BCCD 1WRGA 2V7QJ 1NU1K 1PZQA 1SS1A 2WSSH 1SQPD 2W6AA 1ZRTD 1HTLC 3L75E 5APQA 3VTPC 1HGZA 3C9IA 3OA7A 3Q2YA 2RQ6A 1KN7A 1GDTA 1BE3E 2OTLP 1KILE 2YKQA 2YIUC 3CLQA 5AW5B 2OYHC 2QVAA 1K9MQ 3KHUA 3H1IE 3MP7B 1NOHA 2N9BA 2FYUK 3VMYA 1P84I 4U3FG 1KQGB 1K8AQ 3AE2C 1YJNP 5APWA 1S5LX 4JPZB 2KOGA 3AEBC 3M0DA 1IO4A 3MTUE 4EOTA 4I2LC 2V4HA 3Q5RA 2WPSA 1NGMB 3V2QA 4XFJA 1JOCA 3A0BH 1FAVA 2QIWA 3TGUG 1BDCA 3RK3B 2E43A 2M3BA 3SFEC 1T6AA 3L70G 1EDJA 3V2PA 3KYQA 1OWAA 1U7JA 1X8YA 1RF0C 1NTKJ 5GTHE 4IL6X 4OGQB 1J2JB 5AW3B 1PGOA 4HJGH 3H1JD 4TT3H 2O01J 1S5LE 5AVQB 1PP9G 2H89C 1NTMJ 1FDMA 3K5BA 5KKZC 3AE9C 3H1HJ 2PP6A 2XOKH 2UWJE 3GW6A 1JMMA 1JMBA 3UIAA 5B5EH 1VQMP 3OAAH 1DEEG 2E75C 1SQVJ 3JCUH 3RK3D 3EWKA 2W83C 3IF4A 2W27A 1FU1A 3HUSC 3MGNA 4C7NA 1S72P 4UB6H 1NJIQ 1PPJD 1BCCG 1VQNP 3LIEA 1N86A 4OGQD 1NTKK 1RH5B 1J1DB 1JY2N 1N7SD 1IFJA 3F89A 1RE3C 2KYVA 1R5SA 2OYIB 1G2CA 2WPQA 3FXEA 1OXZA 3L73D 2HYNA 1RE4A 3B5NB 1J1EB 3QH9A 1SQXE 2AEJA 5AW6B 2KP8A 1NTMK 2Q3EA 2IYOA 3M91A 1GL2A 1JY3P 1LP1B 1VQKP 1SQVK 1AVYA 1NYHA 1SQQD 1QL2A 1M1KQ 5KLVE 2HPCB 2M0BA 1YYCA 3H1LG 3HTKB 2AEMA 4C7RA 4N3YB 4BRYA 2L5GB 3M06A 2YKOA 1BGYJ 1RF0A 3EFGA 1SQBJ 4DOJA 1KQLA 2YKPA 1U7MA 2OYOA 1LJ2A 3B5ND 4HH2A 2RQ7A 3CCVP 1G1IA 2R32A 1IK7A 5DJUB 1IFPA 2LR2A 1LGHB 5E79E 4PJ0E 3RL0B 1T2KC 1GW3A 1T8ZA 3RGUA 1WMKA 2OARA 3MHVA 3GHGA 2QJKB 1SQBK 4U3FD 4WBAA 2A45I 2KSEA 3N4XA 3CCEP 3VMXA 4WY4A 1RE3A 4QMAA 3ITKA 1EZVD 3LIDA 2B87B 3L74G 1LTGC 3CL3D 3H32B 3AEFC 5AW8B 3RL0D 2M5AB 1FJKA 1CI6B 4Z1MH 1JUNA 1J1DC 1IFNA 1KD1Q 3VMAA 1EC5A 2OYIC 3L36A 1KYOH 2HODA 1IFIA 4YXWH 4GDOA 3CCSP 3WUUA 1VL2A 5AW1B 2Q1KA 3GLMA 3MIWA 5H2FE 1EXIA 3U59A 1PP9D 1OIPA 2QM7A 1VQLP 3IAOA 1IC2A 1H8EH 1AFOA 3TYYA 2XKMA 1H88A 5TISE 5CMZA 1XTCC 2BCCG 3L72J 1KYOD 2HFED 4PV1B 1AVOA 3CWBE 1L0LE 3MUDA 2IPPA 3A0HH 4ZMDA 3CCQP 4D6TJ 2YNYA 1OW8A 1NTZE 3B4SA 4I1LA 3OFNH 1JNMA 3D70A 3GMAA 1KILC 2IFNA 5KJ7C 4K35A 2QEXP 4KHXA 2FXMA 3H1LD 5KAIE 2B89A 2FYUD 2WSEJ 4AUWA 1GD2E 3ZDMA 5CBOA 3RBZA 3CC7P 5APXA 1BE3J 2XV5A 1VQ5P 4N78D 2C0XA 3AEEC 4EDFA 1FZCC 3CPWO 2Y9YA 3AE6C 2YIUB 1SLQA 3I56P 1OW7A 1N7LA 1Q82Q 3HE4A 1Q90D 4C7NB 3H1IJ 2DW3A 3GF3A 2QRXA 1JB0J 5BVZA 4EYYQ 3H1JG 1MKMA 4XA4A 1ZR2A 3VOPA 3OEHH 5B66H 3JC22 1G2CB 1AJYA 4W80A 3CXHH 2QG4A 4YTPC 1L0NE 5KTBA 3JCUE 4OWFA 1KILA 2E42A 3V5BA 2WSCJ 2O01H 1FBMA 1PPJG 1JY2O 3AEDC 4PV1C 4UB8H 1HJBA 2ZYAA 2KUBA 3A3YB 4BRYB 2P1JA 2W8ZA 3CXHD 1NTKD 3L73G 3M0DC 1D7MA 2IBZG 1GTWA 1FZGA 5DJTB 1A02J 3P7KA 1OX3A 1Y9BA 1FDIA 3NMDA 2QE7H 5AVVB 2C0WA 1SQQG 3OJAB 3P8CD 1IJDB 2ZAEB 2FKWB 5KKZB 4IFFA 3FX0A 5AW9B 1FZCA 1EQ7A 4NPFX 1SQVD 2E75B 2ZT9B 1NKZB 1W2BO 2P58A 4ASVA 2O01N 4WWIA 3A7OA 3GHGB 3NTNA 3RK2C 1M56D 2GUSA 2C9NY 4JQ0D 1KQFB 4WY4B 3T97A 1SQXJ 1KB9D 2R5BA 2I1KA 1VQ8P 1ZP0C 1GW4A 1BDDA 2RMZA 4ASUH 1VPCA 1ZLLA 2QSIA 5GTIH 5BU8B 3H1KG 2E75D 1ZOYC 5KLVJ 1LTSC 4Y28J 2NPSA 1S4XA 1JO5A 5CCGA 4AYCA 3TGUE 3WUVA 4HB1A 1BGYD 4W7ZA 1SQBD 1HWTC 1EZVG 3E7KA 1RE4C 3L70E 3CX5H 2HODB 3L75G 3HE5A 3O8ZA 1DEBA 1SQXK 1GL2C 2XNDH 3C8VA 1N73A 1S1CX 3Q1MA 3Q5PA 2JP3A 4CPGA 3IN6A 3KZIH 4L73A 1VF5B 5KLVK 3KDPB 4HYTB 2P2UA 3V4WA 3A2AA 1PP9E 3H25A 2Q5UA 2NRGA 2C9LY 4EIJA 3CX5D 3G4SP 4B86A 2JWDA 4R4MA 1GK4A 5AVUB 5APSA 4H13B 2WSFJ 1LT1A 2N1TA 4ZKUA 3OAKA 1Q7YQ 1DH3A 2D2CB 1BCCE 3BCCG 1RF1A 2AXTH 2XZRA 3WU2E 2ITAA 2G3AA 4KT0J 1Z56A 5TJHA 1USEA 4JF7A 2ZT9C 5APVA 4AQRD 1T2KD 3GHGC 1JTHA 1RHZB 3A0HE 1NU1G 2BEZF 4KJMA 2R5DA 4WY4C 3H1LE 1S2EA 1VQ4P 2KB7P 3KXDA 3IFMA 1KTMA 2IBZD 4RJTA 2FXPA 3W67A 3V6IA 2WQYC 1YBKA 4WVZA 1FZAA 1SFCA 3L71E 1H0TA 5AVRB 3HD7C 4DT0A 4N6JA 4JYCA 1ZXGA 4RKUJ 3HE4B 2BASA 1WT6A 2FYUG 1N8RQ 4GIFA 3CWBJ 3L72D 1L0LJ 4PD4E 1LTIC 1ZR4A 1FS0E 4D6TD 2A06G 1NTZJ 3GG2A 2FYNC 1URQA 1P84H 2H8PD 5FL7H 1LNQA 1VF5C 2WSEH 5AW7B 2NZ2A 2Y0EA 1RQVA 1KILB 4M3LA 3FWLA 2PFXA 2B9BA 3H1KD 3AECC 1DD4A 2K3RA 4ZKPA 1S3JA 3L74E 4H13C 1YQ4C 2LKMA 1PGQA 2ZVOB 3MUDC 1S9KE 1L0LK 3OE7H 1P84D 2P10A 5DN6I 2O1KA 2A45G 2D2CC 2JEEA 1NAFA 1M1JA 4PD4I 1NTZK 3S9OA 3G3ZA 2PGDA 1FOSE 2LXBA 2YMKA 3CXHE 3V2NA 3L75D 4GODA 1HBWA 2KS1A 2P7JA 2Z5IA 1BE3D 2R44A 3VP8A 5KJ7D 1FJPA 1FZCB 2HLOA 3V4QA 2N9YB 2Q9IA 3D6ZA 4UB8E 3HD7A 1GK6A 1NTKG 3H1ID 2KZIA 2WPVB 5KAFE 2WSCH 2FFDC 1Y8AA 1GZLA 2BCCE 4JYBA 5APUA 3KPEA 3AE4C 2J59M 1NTMG 3SWYA 3TDKA 5GTHH 3T97B 3BCCD 3H1HG 2AEFA 1SQPE 1FZFA 1ZRTE 5K5GB 1L0NJ 1SQVG 1PGJA 1T3UA 2HR3A 1S5LH 2MKVA 2M3EA 3M9HA 3PHLA 1QEXA 2NPSB 5AVXB 1M8OB 1DIPA 3L37A 2LXCB 5BU5A 2GM4A 1NU1D 1X79B 3FXDA 3CMAP 2PAJA 3A5TA 1MFZA 1R5LA 2E74C 3HE5B 5M1BA 3KQGA 3USSA 3BASA 2V7QH 5CCHC 1LT9A 2VRSA 4IL6H 1L0NK 3F5HA 1N7SA 3TSIA 1N73B 1X0TA 4OH8B 3MD0A 2WWWA 2Y0CA 4L76A 2K37A 3PLNA 1K73Q 4PV1D 1Q86Q 5EFWB 2KNCA 1BGYG 1K05A 2OQQA 1SQBG 2WT7A 2N1TB 1HGVA 2FFDA 3RK2B 1L4AC 2A06D 1Q81Q 3H1JE 2Y9ZA 1NH4A 3EFFK 1SQXD 2A45H 3A0BE 1JY3N 1NHLA 3KZIE 1JEKA 3EQ2A 3OW2O 2IDBA 5KLVD 3RK3E 3SSUA 1E5WA 2WITA 1JTHB 5AVZB 3TGUJ 2YO3A 1YTZT 1ZV8A 1PPJE 3L70J 4DJGA 5CHXA 2E76B 4LC1A 1NVOA 2KIKA 3FGAD 3AE7C 1AV1A 1JY2P 2L91A 1R8EA 3G71P 2FXOA 5B5EE 5CCHA 3L73E 2HG5D 1SP4A 1QX8A 1AA0A 1GL2B 1SFCB 3MZWB 4EI2A 1H0TB 3CC4P 2K9JA 1HUCA 1YI2P 1KORA 2NPSC 4UB6E 1PP9J 2MJZA 2IX7C 1SQQE 5CCGC 4H0LB 4LLHA 3CCUP 2XDJA 3PJSK 2ZYDA 1BCCJ 1URQB 1QVGO 5AVSB 4H44C 1L4AA 3CI9A 1N73C 2YXQB 3PP5A 3LW5J 3PH0A 1JCCA 1L0NG 1GL2D 1NTMD 1PIXA 3H1HD 1LWUA 2QJYC 3CCJP 1KB9H 4IFDK 3L72G 3H6PA 1FOSF 2BEQD 2N1TC 4D6TG 3H1KE 3R4YA 3NXSA 1X22A 1LTTC 5TISH 1HVVA 1M1JB 3H1LJ 1JM0A 1RF1C 1OW6A 4U3FE 4O9BA 3O6QA 2KS1B 2OGUA 3U1CA 4ASWA 3L71J 1YJ9P 1TU3F 1EZVE 1YQ3C 4NPEA 2ZT9D 1PFIA 2GUVA 1FE6A 2GA1A 1HJ0A 1QGKB 2SPZA 3JSVC 1HH0A 3HD7B 2R3CA 5APTA 1LTJC 3I5CA 1VQPP 2KLVA 3CWBD 1PL5A 1L0LD 1T3JA 2E76C 3L35A 4WY4D 3SFDC 2J58A 2IZ1A 1KMIZ 2KI7B 1DX7A 1NTZD 1QLED 5KAIH 1FZEA 1BE3G 2FYNB 1SFCC 2W6JH
chains in the Genus database with same CATH topology
3OFNH 2CK3H 3USSA 3EFFK 2V7QH 3PJSK 2WSSH 1FS0E 4TLFA 3OEHH 1E79H 1IFPA 2E5YA 2JDIH 1H8EH 3OE7H 3FKSH 2RQ6A 5FL7H 5DN6I 4DJGA 2XOKH 1JEKA 2RQ7A 4WVZA 2XNDH 3OAAH 4YXWH 2HLDH 1BSNA 2QE7H 4ASUH 1AQTA 2E5TA 1BSHA 4QMAA 2W6JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OFN H;  2CK3 H;  3USS A;  3EFF K;  2V7Q H;  3PJS K;  2WSS H;  1FS0 E;  4TLF A;  3OEH H;  1E79 H;  1IFP A;  2E5Y A;  2JDI H;  1H8E H;  3OE7 H;  3FKS H;  2RQ6 A;  5FL7 H;  5DN6 I;  4DJG A;  2XOK H;  1JEK A;  2RQ7 A;  4WVZ A;  2XND H;  3OAA H;  4YXW H;  2HLD H;  1BSN A;  2QE7 H;  4ASU H;  1AQT A;  2E5T A;  1BSH A;  4QMA A;  2W6J H; 
#chains in the Genus database with same CATH topology
 1MUU A;  1RY3 A;  1X9V A;  1EZV I;  3BCC E;  2ZVN B;  4H0L C;  2XNX A;  3H1I G;  3CCR P;  3HD7 D;  3L74 J;  2ZJS E;  4GKG A;  3AE1 C;  2JKV A;  4Y99 B;  1FZB A;  1QL1 A;  1KYO E;  1OZH A;  1URQ C;  4TLF A;  2H43 A;  5AW2 B;  3C1L A;  2OTK E;  1FC2 C;  2J5U A;  1NU1 E;  2IZ0 A;  1LT9 B;  1YTZ I;  1Q2N A;  1N7S B;  1VF5 D;  3AEA C;  2K1A A;  4I7Z C;  1KFM A;  3N7N A;  2FY8 A;  4H13 D;  2KNC B;  2CPB A;  1M1J C;  1G1J A;  2OYH A;  2YXR B;  1LTJ A;  2D2C D;  2WT7 B;  1KYO I;  2RN0 A;  1VDF A;  2BCC J;  2QA4 P;  2FFD B;  2JDI H;  4HKZ H;  2FYU E;  1UIX A;  2P67 A;  3ABV C;  3L4F A;  4IL6 E;  1SQP J;  1GU5 A;  3GF7 A;  5L8R J;  1VQO P;  2FYZ A;  1L0N D;  2A06 E;  3E1R A;  1ZW0 A;  4W7Y A;  4N78 E;  4YXD C;  1UII A;  3BAT A;  1LTB C;  1H89 A;  3B71 A;  1KZU B;  1MFT A;  3R2P A;  1Y47 A;  5CBN A;  2K9Y A;  1JY3 O;  4XE5 B;  3QWO C;  5CJ0 A;  1OFC X;  4ZNC A;  1SQX G;  3WMM 0;  2YMY A;  1SQP K;  2E74 B;  1KC8 Q;  3L71 G;  3Q3D A;  1CZQ A;  3IR9 A;  2H88 C;  2O1J A;  5KLV G;  3BRV B;  3BRT B;  2O3J A;  2G8Y A;  2K9J B;  1NO4 A;  1ZME C;  3M0A A;  3G6E P;  4Y99 C;  2CPS A;  3RK3 C;  2IYP A;  1NAY A;  1LTA C;  4I6M C;  2JWA A;  5KLI B;  2Y0D A;  1GMJ A;  1KQS O;  3VN0 A;  5B66 E;  3HUS A;  4OGQ C;  3TNU A;  3CCL P;  1LT9 C;  2WTY A;  1NTK E;  2E74 D;  3H1J J;  1N7S C;  1VQ9 P;  1EDL A;  1L4A B;  5CCH D;  1RQU A;  1M57 D;  1KIL D;  2Z4E A;  5APY A;  1LWU B;  1AQT A;  1YJW P;  4YPC A;  1NTM E;  3P8C E;  3H1H E;  2OTJ P;  3AE3 C;  3S1K A;  1H8A A;  3CC2 P;  1YIJ P;  2B88 A;  2XU6 A;  4RES B;  1VQ6 P;  1SQV E;  1IFD A;  4K3A A;  3D6Y A;  3TGU D;  1XTG B;  3CME P;  1YIT P;  1U57 A;  3HRN A;  2CK3 H;  5AW0 B;  2QM8 A;  3L70 D;  2KLU A;  1L4A D;  2YO2 A;  4JBZ A;  1AQ5 A;  2WVR A;  3CXH I;  1E79 H;  4GOE A;  2PRR A;  3O6Q B;  2I8D A;  3L73 J;  3B5N C;  1J1E C;  2KK7 A;  1W2E A;  1M7L A;  1KB9 E;  3CCM P;  2JR8 A;  1USD A;  4IFM A;  5C39 A;  3U1A A;  3WU2 H;  3LW5 H;  1SQQ J;  1L2P A;  3FKS H;  1SVF A;  1EDK A;  3RBX A;  4RO0 A;  2RKL A;  1CW5 A;  1BCC D;  2Q7C A;  1QVF O;  3M9Q A;  1BGY E;  2RH0 A;  3TF5 A;  1SQP G;  4IOI H;  1SQB E;  1PV3 A;  3II6 A;  1GU4 A;  4NPD A;  2ZFC A;  2KXP B;  4H44 B;  2I1J A;  5GTI E;  4MN4 C;  1OVR A;  1YHQ P;  3P8M C;  4GT1 A;  1KB9 I;  2QJY B;  1MZ9 A;  2JJL A;  1BSH A;  1IZN B;  2NPS D;  2FBW C;  2ZXE B;  4DCK A;  5KLI C;  1SQQ K;  3CD6 P;  2QJP B;  3CWB G;  1L0L G;  2ZXX A;  3RL0 C;  5CCG D;  3H1K J;  3S4R A;  1JCD A;  1ZN5 A;  2ZYG A;  1NTZ G;  3CX5 E;  2WMM A;  2QJK C;  1W5C E;  3V2R A;  1EXJ A;  3RL0 g;  1M90 Q;  1VQ7 P;  2WPR A;  4U3F J;  3VP9 A;  1A02 F;  1RF1 B;  2AXC A;  4H44 D;  4PD4 H;  1LWU C;  5AVY B;  2OYI A;  5CJ4 A;  4U7J A;  3B5N A;  3L71 D;  3L75 J;  3TK1 A;  2W6B A;  3P32 A;  1HF9 A;  4BXL A;  3AE8 C;  4BWN A;  1PGP A;  1LP1 A;  2H7H A;  4A7P A;  5E79 H;  2M8R A;  4LGD E;  2WZ7 A;  2HPC A;  2JO1 A;  4WB4 A;  2N1T D;  1EDI A;  4PJ0 H;  2KZJ A;  3HTK A;  2OYH B;  1LTJ B;  3RK2 D;  4PD4 D;  3M9B A;  1K04 A;  1DD3 A;  3CX5 I;  3SWK A;  3PTZ A;  1OVV A;  4GOF A;  2POH A;  3I55 P;  2AXT E;  1OMI A;  5AVW B;  1IK9 A;  2WSF H;  2Q3I A;  2IBZ E;  3D71 A;  4DZO A;  3BCC J;  1FDO A;  1KFN A;  3VYI A;  2E5T A;  3SWF A;  2R3S A;  1N2D C;  3L74 D;  3W68 A;  3BVH A;  1S9K D;  5KJ7 A;  1NWQ A;  3G9R A;  2E76 D;  5AW4 B;  3WUT A;  3L72 E;  1MV8 A;  1CSB A;  1BSN A;  1OVU A;  3E1I A;  4L74 A;  1NU1 J;  1NKN A;  4D6T E;  5KAF H;  1SFC D;  1KV4 A;  3B8E B;  3AE5 C;  2W90 A;  2IBZ I;  3Q5S A;  2B87 A;  2QJP C;  4I7Z B;  3NFQ A;  3H32 A;  2HLD H;  2K88 A;  5H2F H;  4H0L D;  4L75 A;  2M5A A;  3PRJ A;  4R4L A;  4OVN F;  2Q6Q A;  1CI6 A;  3FWN A;  4C46 A;  2E5Y A;  1IFM A;  3AEG C;  3VMZ A;  2KSJ A;  1URQ D;  1P84 E;  2Z5H A;  5AVT B;  2IFM A;  3HUS B;  2FYU J;  3TNU B;  2BCC D;  1WRG A;  2V7Q J;  1NU1 K;  1PZQ A;  1SS1 A;  2WSS H;  1SQP D;  2W6A A;  1ZRT D;  1HTL C;  3L75 E;  5APQ A;  3VTP C;  1HGZ A;  3C9I A;  3OA7 A;  3Q2Y A;  2RQ6 A;  1KN7 A;  1GDT A;  1BE3 E;  2OTL P;  1KIL E;  2YKQ A;  2YIU C;  3CLQ A;  5AW5 B;  2OYH C;  2QVA A;  1K9M Q;  3KHU A;  3H1I E;  3MP7 B;  1NOH A;  2N9B A;  2FYU K;  3VMY A;  1P84 I;  4U3F G;  1KQG B;  1K8A Q;  3AE2 C;  1YJN P;  5APW A;  1S5L X;  4JPZ B;  2KOG A;  3AEB C;  3M0D A;  1IO4 A;  3MTU E;  4EOT A;  4I2L C;  2V4H A;  3Q5R A;  2WPS A;  1NGM B;  3V2Q A;  4XFJ A;  1JOC A;  3A0B H;  1FAV A;  2QIW A;  3TGU G;  1BDC A;  3RK3 B;  2E43 A;  2M3B A;  3SFE C;  1T6A A;  3L70 G;  1EDJ A;  3V2P A;  3KYQ A;  1OWA A;  1U7J A;  1X8Y A;  1RF0 C;  1NTK J;  5GTH E;  4IL6 X;  4OGQ B;  1J2J B;  5AW3 B;  1PGO A;  4HJG H;  3H1J D;  4TT3 H;  2O01 J;  1S5L E;  5AVQ B;  1PP9 G;  2H89 C;  1NTM J;  1FDM A;  3K5B A;  5KKZ C;  3AE9 C;  3H1H J;  2PP6 A;  2XOK H;  2UWJ E;  3GW6 A;  1JMM A;  1JMB A;  3UIA A;  5B5E H;  1VQM P;  3OAA H;  1DEE G;  2E75 C;  1SQV J;  3JCU H;  3RK3 D;  3EWK A;  2W83 C;  3IF4 A;  2W27 A;  1FU1 A;  3HUS C;  3MGN A;  4C7N A;  1S72 P;  4UB6 H;  1NJI Q;  1PPJ D;  1BCC G;  1VQN P;  3LIE A;  1N86 A;  4OGQ D;  1NTK K;  1RH5 B;  1J1D B;  1JY2 N;  1N7S D;  1IFJ A;  3F89 A;  1RE3 C;  2KYV A;  1R5S A;  2OYI B;  1G2C A;  2WPQ A;  3FXE A;  1OXZ A;  3L73 D;  2HYN A;  1RE4 A;  3B5N B;  1J1E B;  3QH9 A;  1SQX E;  2AEJ A;  5AW6 B;  2KP8 A;  1NTM K;  2Q3E A;  2IYO A;  3M91 A;  1GL2 A;  1JY3 P;  1LP1 B;  1VQK P;  1SQV K;  1AVY A;  1NYH A;  1SQQ D;  1QL2 A;  1M1K Q;  5KLV E;  2HPC B;  2M0B A;  1YYC A;  3H1L G;  3HTK B;  2AEM A;  4C7R A;  4N3Y B;  4BRY A;  2L5G B;  3M06 A;  2YKO A;  1BGY J;  1RF0 A;  3EFG A;  1SQB J;  4DOJ A;  1KQL A;  2YKP A;  1U7M A;  2OYO A;  1LJ2 A;  3B5N D;  4HH2 A;  2RQ7 A;  3CCV P;  1G1I A;  2R32 A;  1IK7 A;  5DJU B;  1IFP A;  2LR2 A;  1LGH B;  5E79 E;  4PJ0 E;  3RL0 B;  1T2K C;  1GW3 A;  1T8Z A;  3RGU A;  1WMK A;  2OAR A;  3MHV A;  3GHG A;  2QJK B;  1SQB K;  4U3F D;  4WBA A;  2A45 I;  2KSE A;  3N4X A;  3CCE P;  3VMX A;  4WY4 A;  1RE3 A;  4QMA A;  3ITK A;  1EZV D;  3LID A;  2B87 B;  3L74 G;  1LTG C;  3CL3 D;  3H32 B;  3AEF C;  5AW8 B;  3RL0 D;  2M5A B;  1FJK A;  1CI6 B;  4Z1M H;  1JUN A;  1J1D C;  1IFN A;  1KD1 Q;  3VMA A;  1EC5 A;  2OYI C;  3L36 A;  1KYO H;  2HOD A;  1IFI A;  4YXW H;  4GDO A;  3CCS P;  3WUU A;  1VL2 A;  5AW1 B;  2Q1K A;  3GLM A;  3MIW A;  5H2F E;  1EXI A;  3U59 A;  1PP9 D;  1OIP A;  2QM7 A;  1VQL P;  3IAO A;  1IC2 A;  1H8E H;  1AFO A;  3TYY A;  2XKM A;  1H88 A;  5TIS E;  5CMZ A;  1XTC C;  2BCC G;  3L72 J;  1KYO D;  2HFE D;  4PV1 B;  1AVO A;  3CWB E;  1L0L E;  3MUD A;  2IPP A;  3A0H H;  4ZMD A;  3CCQ P;  4D6T J;  2YNY A;  1OW8 A;  1NTZ E;  3B4S A;  4I1L A;  3OFN H;  1JNM A;  3D70 A;  3GMA A;  1KIL C;  2IFN A;  5KJ7 C;  4K35 A;  2QEX P;  4KHX A;  2FXM A;  3H1L D;  5KAI E;  2B89 A;  2FYU D;  2WSE J;  4AUW A;  1GD2 E;  3ZDM A;  5CBO A;  3RBZ A;  3CC7 P;  5APX A;  1BE3 J;  2XV5 A;  1VQ5 P;  4N78 D;  2C0X A;  3AEE C;  4EDF A;  1FZC C;  3CPW O;  2Y9Y A;  3AE6 C;  2YIU B;  1SLQ A;  3I56 P;  1OW7 A;  1N7L A;  1Q82 Q;  3HE4 A;  1Q90 D;  4C7N B;  3H1I J;  2DW3 A;  3GF3 A;  2QRX A;  1JB0 J;  5BVZ A;  4EYY Q;  3H1J G;  1MKM A;  4XA4 A;  1ZR2 A;  3VOP A;  3OEH H;  5B66 H;  3JC2 2;  1G2C B;  1AJY A;  4W80 A;  3CXH H;  2QG4 A;  4YTP C;  1L0N E;  5KTB A;  3JCU E;  4OWF A;  1KIL A;  2E42 A;  3V5B A;  2WSC J;  2O01 H;  1FBM A;  1PPJ G;  1JY2 O;  3AED C;  4PV1 C;  4UB8 H;  1HJB A;  2ZYA A;  2KUB A;  3A3Y B;  4BRY B;  2P1J A;  2W8Z A;  3CXH D;  1NTK D;  3L73 G;  3M0D C;  1D7M A;  2IBZ G;  1GTW A;  1FZG A;  5DJT B;  1A02 J;  3P7K A;  1OX3 A;  1Y9B A;  1FDI A;  3NMD A;  2QE7 H;  5AVV B;  2C0W A;  1SQQ G;  3OJA B;  3P8C D;  1IJD B;  2ZAE B;  2FKW B;  5KKZ B;  4IFF A;  3FX0 A;  5AW9 B;  1FZC A;  1EQ7 A;  4NPF X;  1SQV D;  2E75 B;  2ZT9 B;  1NKZ B;  1W2B O;  2P58 A;  4ASV A;  2O01 N;  4WWI A;  3A7O A;  3GHG B;  3NTN A;  3RK2 C;  1M56 D;  2GUS A;  2C9N Y;  4JQ0 D;  1KQF B;  4WY4 B;  3T97 A;  1SQX J;  1KB9 D;  2R5B A;  2I1K A;  1VQ8 P;  1ZP0 C;  1GW4 A;  1BDD A;  2RMZ A;  4ASU H;  1VPC A;  1ZLL A;  2QSI A;  5GTI H;  5BU8 B;  3H1K G;  2E75 D;  1ZOY C;  5KLV J;  1LTS C;  4Y28 J;  2NPS A;  1S4X A;  1JO5 A;  5CCG A;  4AYC A;  3TGU E;  3WUV A;  4HB1 A;  1BGY D;  4W7Z A;  1SQB D;  1HWT C;  1EZV G;  3E7K A;  1RE4 C;  3L70 E;  3CX5 H;  2HOD B;  3L75 G;  3HE5 A;  3O8Z A;  1DEB A;  1SQX K;  1GL2 C;  2XND H;  3C8V A;  1N73 A;  1S1C X;  3Q1M A;  3Q5P A;  2JP3 A;  4CPG A;  3IN6 A;  3KZI H;  4L73 A;  1VF5 B;  5KLV K;  3KDP B;  4HYT B;  2P2U A;  3V4W A;  3A2A A;  1PP9 E;  3H25 A;  2Q5U A;  2NRG A;  2C9L Y;  4EIJ A;  3CX5 D;  3G4S P;  4B86 A;  2JWD A;  4R4M A;  1GK4 A;  5AVU B;  5APS A;  4H13 B;  2WSF J;  1LT1 A;  2N1T A;  4ZKU A;  3OAK A;  1Q7Y Q;  1DH3 A;  2D2C B;  1BCC E;  3BCC G;  1RF1 A;  2AXT H;  2XZR A;  3WU2 E;  2ITA A;  2G3A A;  4KT0 J;  1Z56 A;  5TJH A;  1USE A;  4JF7 A;  2ZT9 C;  5APV A;  4AQR D;  1T2K D;  3GHG C;  1JTH A;  1RHZ B;  3A0H E;  1NU1 G;  2BEZ F;  4KJM A;  2R5D A;  4WY4 C;  3H1L E;  1S2E A;  1VQ4 P;  2KB7 P;  3KXD A;  3IFM A;  1KTM A;  2IBZ D;  4RJT A;  2FXP A;  3W67 A;  3V6I A;  2WQY C;  1YBK A;  4WVZ A;  1FZA A;  1SFC A;  3L71 E;  1H0T A;  5AVR B;  3HD7 C;  4DT0 A;  4N6J A;  4JYC A;  1ZXG A;  4RKU J;  3HE4 B;  2BAS A;  1WT6 A;  2FYU G;  1N8R Q;  4GIF A;  3CWB J;  3L72 D;  1L0L J;  4PD4 E;  1LTI C;  1ZR4 A;  1FS0 E;  4D6T D;  2A06 G;  1NTZ J;  3GG2 A;  2FYN C;  1URQ A;  1P84 H;  2H8P D;  5FL7 H;  1LNQ A;  1VF5 C;  2WSE H;  5AW7 B;  2NZ2 A;  2Y0E A;  1RQV A;  1KIL B;  4M3L A;  3FWL A;  2PFX A;  2B9B A;  3H1K D;  3AEC C;  1DD4 A;  2K3R A;  4ZKP A;  1S3J A;  3L74 E;  4H13 C;  1YQ4 C;  2LKM A;  1PGQ A;  2ZVO B;  3MUD C;  1S9K E;  1L0L K;  3OE7 H;  1P84 D;  2P10 A;  5DN6 I;  2O1K A;  2A45 G;  2D2C C;  2JEE A;  1NAF A;  1M1J A;  4PD4 I;  1NTZ K;  3S9O A;  3G3Z A;  2PGD A;  1FOS E;  2LXB A;  2YMK A;  3CXH E;  3V2N A;  3L75 D;  4GOD A;  1HBW A;  2KS1 A;  2P7J A;  2Z5I A;  1BE3 D;  2R44 A;  3VP8 A;  5KJ7 D;  1FJP A;  1FZC B;  2HLO A;  3V4Q A;  2N9Y B;  2Q9I A;  3D6Z A;  4UB8 E;  3HD7 A;  1GK6 A;  1NTK G;  3H1I D;  2KZI A;  2WPV B;  5KAF E;  2WSC H;  2FFD C;  1Y8A A;  1GZL A;  2BCC E;  4JYB A;  5APU A;  3KPE A;  3AE4 C;  2J59 M;  1NTM G;  3SWY A;  3TDK A;  5GTH H;  3T97 B;  3BCC D;  3H1H G;  2AEF A;  1SQP E;  1FZF A;  1ZRT E;  5K5G B;  1L0N J;  1SQV G;  1PGJ A;  1T3U A;  2HR3 A;  1S5L H;  2MKV A;  2M3E A;  3M9H A;  3PHL A;  1QEX A;  2NPS B;  5AVX B;  1M8O B;  1DIP A;  3L37 A;  2LXC B;  5BU5 A;  2GM4 A;  1NU1 D;  1X79 B;  3FXD A;  3CMA P;  2PAJ A;  3A5T A;  1MFZ A;  1R5L A;  2E74 C;  3HE5 B;  5M1B A;  3KQG A;  3USS A;  3BAS A;  2V7Q H;  5CCH C;  1LT9 A;  2VRS A;  4IL6 H;  1L0N K;  3F5H A;  1N7S A;  3TSI A;  1N73 B;  1X0T A;  4OH8 B;  3MD0 A;  2WWW A;  2Y0C A;  4L76 A;  2K37 A;  3PLN A;  1K73 Q;  4PV1 D;  1Q86 Q;  5EFW B;  2KNC A;  1BGY G;  1K05 A;  2OQQ A;  1SQB G;  2WT7 A;  2N1T B;  1HGV A;  2FFD A;  3RK2 B;  1L4A C;  2A06 D;  1Q81 Q;  3H1J E;  2Y9Z A;  1NH4 A;  3EFF K;  1SQX D;  2A45 H;  3A0B E;  1JY3 N;  1NHL A;  3KZI E;  1JEK A;  3EQ2 A;  3OW2 O;  2IDB A;  5KLV D;  3RK3 E;  3SSU A;  1E5W A;  2WIT A;  1JTH B;  5AVZ B;  3TGU J;  2YO3 A;  1YTZ T;  1ZV8 A;  1PPJ E;  3L70 J;  4DJG A;  5CHX A;  2E76 B;  4LC1 A;  1NVO A;  2KIK A;  3FGA D;  3AE7 C;  1AV1 A;  1JY2 P;  2L91 A;  1R8E A;  3G71 P;  2FXO A;  5B5E E;  5CCH A;  3L73 E;  2HG5 D;  1SP4 A;  1QX8 A;  1AA0 A;  1GL2 B;  1SFC B;  3MZW B;  4EI2 A;  1H0T B;  3CC4 P;  2K9J A;  1HUC A;  1YI2 P;  1KOR A;  2NPS C;  4UB6 E;  1PP9 J;  2MJZ A;  2IX7 C;  1SQQ E;  5CCG C;  4H0L B;  4LLH A;  3CCU P;  2XDJ A;  3PJS K;  2ZYD A;  1BCC J;  1URQ B;  1QVG O;  5AVS B;  4H44 C;  1L4A A;  3CI9 A;  1N73 C;  2YXQ B;  3PP5 A;  3LW5 J;  3PH0 A;  1JCC A;  1L0N G;  1GL2 D;  1NTM D;  1PIX A;  3H1H D;  1LWU A;  2QJY C;  3CCJ P;  1KB9 H;  4IFD K;  3L72 G;  3H6P A;  1FOS F;  2BEQ D;  2N1T C;  4D6T G;  3H1K E;  3R4Y A;  3NXS A;  1X22 A;  1LTT C;  5TIS H;  1HVV A;  1M1J B;  3H1L J;  1JM0 A;  1RF1 C;  1OW6 A;  4U3F E;  4O9B A;  3O6Q A;  2KS1 B;  2OGU A;  3U1C A;  4ASW A;  3L71 J;  1YJ9 P;  1TU3 F;  1EZV E;  1YQ3 C;  4NPE A;  2ZT9 D;  1PFI A;  2GUV A;  1FE6 A;  2GA1 A;  1HJ0 A;  1QGK B;  2SPZ A;  3JSV C;  1HH0 A;  3HD7 B;  2R3C A;  5APT A;  1LTJ C;  3I5C A;  1VQP P;  2KLV A;  3CWB D;  1PL5 A;  1L0L D;  1T3J A;  2E76 C;  3L35 A;  4WY4 D;  3SFD C;  2J58 A;  2IZ1 A;  1KMI Z;  2KI7 B;  1DX7 A;  1NTZ D;  1QLE D;  5KAI H;  1FZE A;  1BE3 G;  2FYN B;  1SFC C;  2W6J H; 
#chains in the Genus database with same CATH homology
 3OFN H;  2CK3 H;  3USS A;  3EFF K;  2V7Q H;  3PJS K;  2WSS H;  1FS0 E;  4TLF A;  3OEH H;  1E79 H;  1IFP A;  2E5Y A;  2JDI H;  1H8E H;  3OE7 H;  3FKS H;  2RQ6 A;  5FL7 H;  5DN6 I;  4DJG A;  2XOK H;  1JEK A;  2RQ7 A;  4WVZ A;  2XND H;  3OAA H;  4YXW H;  2HLD H;  1BSN A;  2QE7 H;  4ASU H;  1AQT A;  2E5T A;  1BSH A;  4QMA A;  2W6J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...