4YXWH

Bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
131
structure length
128
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How release of phosphate from mammalian F1-ATPase generates a rotary substep.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
total genus 23
structure length 128
sequence length 131
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4yxwH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 4yxwH01
1BSHA 4QMAA 3FKSH 1H8EH 1BSNA 5FL7H 2XNDH 2E5TA 3USSA 4ASUH 3EFFK 2V7QH 2CK3H 3OE7H 1JEKA 4YXWH 3OFNH 1IFPA 3PJSK 1FS0E 2W6JH 2RQ6A 2XOKH 3OEHH 2WSSH 3OAAH 1E79H 2RQ7A 4TLFA 4DJGA 2JDIH 5DN6I 2E5YA 1AQTA 2HLDH 2QE7H 4WVZA
chains in the Genus database with same CATH superfamily
2RMZA 2O01H 3CL3D 3CD6P 4L75A 4U3FJ 1EZVI 1IFMA 4IFMA 4I7ZC 1YQ3C 2A06E 2C9NY 5GTIE 2NPSB 2XNDH 3BASA 4N78D 3KDPB 1FZBA 1KILD 3CPWO 1LGHB 5AW7B 1OWAA 5APSA 1YQ4C 2E43A 5AW3B 1BSHA 3AE7C 3VYIA 1Q7YQ 1G1IA 1SLQA 1M57D 1YJWP 3T97A 4D6TD 1DD4A 3L75E 4DOJA 1S5LH 2JP3A 3VMXA 3B71A 3Q2YA 3Q3DA 2N9BA 4PD4I 4WWIA 3P8MC 1G2CB 3AE1C 4IL6H 3L72E 4WBAA 1NU1G 4WB4A 3KHUA 5AW9B 3H25A 2XV5A 1HVVA 2DW3A 2JDIH 3MUDC 3EWKA 3R4YA 3L71J 3D6ZA 1K8AQ 1GDTA 1IFJA 1SQXJ 1VQ5P 2WSFJ 3TF5A 2YXQB 3SWFA 2B88A 3M9BA 2M5AB 4H44C 2ZXXA 4OWFA 1HTLC 1VQ6P 1Y9BA 3BVHA 1KILE 1VF5B 1Y8AA 5EFWB 2ZYDA 4AQRD 5KLIC 4L73A 2E5TA 2VRSA 3HD7D 1W2EA 1HH0A 2M0BA 1KB9H 2FFDC 2K9JA 1D7MA 2FYUG 2P2UA 1J1DB 1L0ND 3FXEA 2KLVA 3HUSA 3P32A 4B86A 1J2JB 1EXJA 3TYYA 3QH9A 2BASA 4WY4A 3S9OA 3WUTA 1VQ9P 2KSJA 2ZT9C 1IFPA 2QJYC 1T2KD 1L4AA 2PAJA 1KFMA 2XU6A 5AW5B 1YTZI 1LP1A 1UIXA 2QJPC 3C9IA 4GDOA 2H7HA 3QWOC 3R2PA 2KZIA 5AW8B 2C0WA 1S4XA 2B87A 3H1HG 1AA0A 1HJ0A 5AVWB 2YIUB 2E74B 4PV1D 2QVAA 4EIJA 4YXDC 2WTYA 4BXLA 1VQMP 2W6AA 1FBMA 1GZLA 1ZMEC 2HPCA 1DD3A 2QA4P 5B5EH 2PGDA 3CXHD 5TISH 1SP4A 4PJ0E 4YPCA 2KS1A 5AW2B 4JQ0D 5CMZA 1PGPA 3USSA 2E74D 4EYYQ 3D70A 1VQOP 4ASUH 2OTJP 1LT1A 2M3EA 2KIKA 1VQKP 1NTZK 1CI6B 1N73C 2E42A 1FU1A 2E75D 2N1TB 3HE5B 3L73D 4R4LA 4D6TJ 1BGYE 1H89A 1RF1A 1FOSF 3TSIA 1SVFA 1KV4A 2G8YA 1URQA 3GHGB 1IO4A 2H89C 2WSFH 1HUCA 1PPJD 5KLVJ 3E1RA 1QL2A 5KAFH 5B66H 1DX7A 2K1AA 5CCGA 1SQVK 1SQXK 2RQ7A 2E75B 2N1TD 3VP9A 2AEJA 1BCCG 3AEFC 3SWYA 4PD4D 3ZDMA 1BE3E 2D2CB 4U3FG 1FZAA 1N7SA 2H43A 2PP6A 4O9BA 2GA1A 2FYZA 2L91A 4UB6E 3GHGA 2L5GB 2YO2A 1SQVJ 2W27A 1ZP0C 3H1IE 3RBZA 3HUSC 1GL2A 1S5LE 2ZT9B 1NTMD 1H88A 1VQ4P 3MHVA 1N7SB 2Y9ZA 1PFIA 5GTIH 2AEMA 3TGUE 3O6QA 1X79B 1JO5A 3L73J 2OYIA 1S3JA 2QJKC 3L71D 2HPCB 1NTZD 1OW6A 5KLVK 2O01N 1RF0A 2ZYGA 1U7JA 4N78E 1PL5A 3D71A 3IN6A 3TK1A 1ZV8A 3N7NA 3O8ZA 3CCVP 2A06D 1ZN5A 2WSSH 1RF1C 2FYUK 3H1LG 1M90Q 1FZEA 1NVOA 2J58A 1T3JA 3HE5A 2KI7B 3L36A 3OAKA 1IFNA 1JY2O 3L75D 4LC1A 1L0LG 2HODB 5KLIB 1EXIA 1NTKJ 3CMEP 1NTMK 2QEXP 2K88A 3A0BE 5AW1B 1IC2A 2YMKA 4EI2A 3AEEC 2R44A 1KILA 1BCCD 1OX3A 1HGZA 1YHQP 3IAOA 3NTNA 1K73Q 3OFNH 3HRNA 4YTPC 1KQGB 1IZNB 1SFCA 2QSIA 3CX5H 5AW4B 3WU2H 5APTA 2BCCE 3H1KE 3SSUA 2K9JB 3V2NA 2P7JA 3W68A 5KKZC 1KYOE 2N9YB 1GK4A 1N8RQ 1SQXG 3ABVC 1VQ7P 3PLNA 2O01J 3B8EB 3RL0g 1JEKA 1NYHA 1SQVD 2YXRB 1KB9E 3KZIH 1X9VA 2QG4A 3A0HE 5APVA 5APYA 1M1JC 1QLED 1K9MQ 2BEQD 3PJSK 2CPSA 4C7NB 2O1KA 1OVVA 3L74D 2XOKH 2A06G 1WT6A 1YBKA 1NH4A 2KK7A 2OGUA 3P7KA 1G1JA 4GIFA 4H44D 4L76A 3K5BA 2B9BA 1L0NE 3HD7A 1SQVE 3MP7B 3VMYA 5CBOA 1BCCJ 3VMZA 3Q5SA 1MKMA 1OZHA 1X22A 3G9RA 2R5DA 1M1JA 2QJKB 3GLMA 3GF3A 5DJUB 2AXTH 3BATA 3L74G 4M3LA 4U3FD 5AVSB 3CI9A 2KLUA 3L70J 4PV1B 3L72G 3OW2O 1NU1E 1VF5C 1EDJA 3GF7A 4IL6E 3CCSP 1LT9C 1Y47A 2IZ0A 1KTMA 2GM4A 3L4FA 3U59A 2KZJA 1FOSE 1MFZA 3AE3C 1FS0E 1Q2NA 3HTKA 1EDKA 2E76D 3L35A 4ZNCA 3L74J 1DEBA 1PP9J 1RE3C 4OH8B 3OEHH 1FC2C 3OAAH 1E79H 1QGKB 1SQPG 3HE4B 3L72J 4IL6X 1KZUB 2WQYC 3CWBE 1DH3A 1ZRTE 1LT9A 2FYUE 1SQQG 5AVYB 1JMBA 1SFCC 3VTPC 2MJZA 3L75J 2HFED 3AE9C 1GTWA 3IF4A 1IK9A 2A45I 3CCLP 1ZR2A 1LTJB 2D2CD 1PPJE 2KYVA 2QRXA 1W5CE 3RBXA 1ZR4A 3FKSH 2OYHC 2MKVA 3CC4P 4R4MA 1JB0J 2A45G 1LTJC 2LXCB 1SQPE 1QX8A 1NTMG 1NTKK 2BCCJ 2FXOA 2KNCA 3CWBG 3H1KJ 5E79E 4BWNA 3EFFK 1BDDA 2E76C 1SQQE 1VPCA 3GG2A 3H1HE 4N6JA 4U7JA 2Y9YA 1EDIA 2I1JA 2GUSA 1VQNP 1AVOA 4IOIH 3B4SA 5CCGD 1DIPA 1BE3D 2N1TA 4KT0J 1N7SD 5CCHC 1P84I 1SQQD 3M0DA 3G3ZA 3GHGC 2QIWA 3I5CA 4ASVA 4C46A 3MGNA 1KQSO 1OVRA 1QEXA 3JC22 4XE5B 1H0TB 1CI6A 2WSEH 4HKZH 5M1BA 3TGUG 1LTTC 2AXTE 2CPBA 3A3YB 2XZRA 3RK3D 1L0LJ 3FXDA 3CX5I 3CCRP 1JY3O 1K04A 2WPRA 3H6PA 2N1TC 5CCHA 3VP8A 2K9YA 1M1JB 1MZ9A 2W6BA 2FYNC 4ZKUA 4LGDE 3BCCG 2W8ZA 1JNMA 3H1LE 5FL7H 1WMKA 2YKPA 4KHXA 3AECC 1Q90D 3V2PA 2FXPA 3CXHI 3UIAA 1X0TA 2JKVA 4UB8E 3L73G 2W90A 2E75C 2HG5D 1S72P 4MN4C 1BDCA 4BRYA 3CC2P 1N86A 2E74C 1FJKA 4W80A 1KYOD 5TISE 3A7OA 2M5AA 3P8CD 3HD7B 2Y0DA 2WSCH 3GMAA 5B5EE 4A7PA 2BCCG 3H1KG 3WMM0 1MFTA 5K5GB 1KFNA 2I8DA 2M3BA 1GK6A 2ZJSE 3AE8C 3H32A 1RE4A 5APWA 3M0DC 3B5ND 4Z1MH 1H8AA 1N73B 2WPSA 1AQTA 1SQPD 1M56D 1BGYJ 2W83C 3B5NC 1MV8A 3L70G 4H44B 4JPZB 3G71P 4NPEA 4OGQB 3M91A 2BCCD 3H1KD 1PGJA 2C9LY 1H8EH 3BRTB 2R5BA 2AXCA 3HTKB 4ZKPA 4I6MC 1GW3A 2M8RA 5AVUB 1IFIA 3EFGA 2HODA 4W7ZA 1L0LE 5AVXB 1FDMA 1YJNP 1RQVA 1YIJP 1BE3J 1NAFA 2WT7B 2LXBA 3LIDA 5APQA 2IBZG 5BVZA 3PH0A 2C0XA 2K3RA 5C39A 3SFDC 5KLVE 3V6IA 3F5HA 2OYOA 3ITKA 3MIWA 1VQLP 4TLFA 4ZMDA 2FFDA 3CCQP 1Q81Q 3M06A 2WPQA 5KKZB 1EZVE 4JYBA 2P1JA 2E5YA 4HYTB 2O3JA 1AV1A 5KTBA 1NGMB 4EDFA 2KP8A 2YKQA 3A0HH 3H1HD 4WVZA 5H2FE 3RK3C 3G4SP 1WRGA 2K37A 2XDJA 3TDKA 5APUA 4AYCA 1NTZJ 3MUDA 3Q5PA 1DEEG 1GL2D 3TNUB 1Q86Q 1N2DC 4GODA 5CCHD 2CK3H 1BGYD 3EQ2A 5TJHA 4YXWH 2V4HA 1LWUB 1NHLA 5CCGC 4JYCA 4W7YA 1OFCX 5AVQB 1R8EA 2YKOA 1L0LD 2R32A 2RKLA 2POHA 1LWUC 1PPJG 1NTKD 1ZRTD 2NPSA 3C8VA 1EQ7A 1N7LA 3JCUH 3L74E 1EC5A 2WWWA 2YMYA 3PP5A 3MD0A 3IFMA 1XTGB 1NTME 1OVUA 3I55P 3V2RA 1QVGO 1A02J 4HJGH 1Z56A 3L71G 1JY3P 4I1LA 1L4AB 2LKMA 2ZYAA 2Z5HA 1YITP 2UWJE 1K05A 5CJ0A 1SFCD 1GU5A 4N3YB 4H13D 2ZXEB 1L4AC 1NKNA 2FFDB 1SQBK 2XNXA 4XA4A 3CCMP 2IYOA 3BCCD 5AVTB 4LLHA 1NU1D 1NTMJ 1S9KD 1QVFO 1BCCE 1VDFA 5CJ4A 1SQQK 1NO4A 3P8CE 4U3FE 1GD2E 2J59M 1SS1A 4Y99B 4PD4H 1J1EB 1MUUA 1SQBE 2Q3IA 4RO0A 2IFNA 2O1JA 2R3CA 1JUNA 1P84D 2HLOA 1RHZB 2ITAA 3LIEA 4UB8H 1HWTC 1L0NK 1VQPP 3H1LD 4WY4C 3BRVB 4GT1A 1JTHB 1VF5D 2I1KA 1S9KE 5AVRB 3RGUA 2PFXA 2YIUC 1GMJA 4D6TG 2A45H 2IBZI 2JWDA 2QM8A 3AE6C 3CMAP 3Q5RA 2FYUD 2FBWC 1N73A 2JWAA 1BGYG 2RN0A 2ZAEB 3M0AA 1LT9B 3NMDA 4IFFA 4RESB 1KQLA 2P58A 2PRRA 4K3AA 1NKZB 4H0LB 4QMAA 3H1ID 2OQQA 1JCCA 1AVYA 1JTHA 1M7LA 1PGQA 2RH0A 1L0LK 3B5NB 2KSEA 2HR3A 4K35A 5AW0B 5AW6B 3FGAD 3RK2B 4D6TE 2KUBA 3KZIE 2WT7A 3H1HJ 1GU4A 2V7QH 2WZ7A 3KQGA 1NTKE 3MTUE 3T97B 3WUUA 3V5BA 3V4WA 1FZGA 3LW5H 1S5LX 1EDLA 4H0LD 2ZVOB 1HBWA 3IR9A 3CCUP 1RY3A 1KILB 1FZCA 3BCCJ 3CX5D 1IK7A 2KS1B 3S4RA 1U7MA 3B5NA 1L4AD 3H1IG 1AJYA 1HF9A 3L72D 4H13C 1W2BO 3JSVC 5CHXA 2KOGA 5DN6I 4CPGA 2FKWB 2FYUJ 1SQXD 1NTKG 3CX5E 2WSCJ 2H8PD 3CWBJ 3L73E 1OIPA 3A2AA 3TGUJ 1OXZA 2FXMA 1OW7A 2NZ2A 2ZFCA 3KPEA 1T8ZA 1FDIA 5AVZB 5GTHH 4Y99C 1TU3F 3V4QA 3VN0A 1LWUA 1RF0C 1M8OB 1YTZT 1EZVD 2LR2A 1GW4A 2NPSC 3H1IJ 3JCUE 4L74A 1BSNA 1KQFB 4OGQC 2R3SA 3RK3B 4C7NA 4DZOA 1H0TA 2KNCB 1RQUA 3H1JJ 2Q3EA 4WY4B 1LNQA 4NPFX 2WSEJ 1LJ2A 5KLVD 1NJIQ 3OE7H 1L0NG 1IJDB 1PGOA 1RE3A 1USEA 3O6QB 4OVNF 1KN7A 1GL2C 3RL0D 1G2CA 1NU1J 2OARA 3FX0A 1JM0A 1ZLLA 2HYNA 1JY2N 3L70E 3OJAB 3V2QA 1JY2P 5BU8B 2Q5UA 2W6JH 1IFDA 2OYIC 3CC7P 3NFQA 1CZQA 5KAIE 1NTZG 1KYOI 1JY3N 2IDBA 4UB6H 2OYIB 3H1LJ 1FZFA 2WVRA 3S1KA 1SQXE 3RL0B 3KXDA 1X8YA 3RK3E 1SQBD 2Q6QA 4C7RA 3OA7A 3L75G 2XKMA 3PRJA 1URQC 3AEBC 1LTBC 1T6AA 5KLVG 2WMMA 3LW5J 2IYPA 1NOHA 1NTZE 1URQB 2JJLA 1ZXGA 1LTIC 3AE5C 4I2LC 4JF7A 2OYHB 4IFDK 3C1LA 2B89A 2YNYA 2JEEA 1EZVG 5L8RJ 5KJ7C 1FJPA 1OW8A 1SQVG 1KB9D 4HB1A 3U1CA 1A02F 3HUSB 4PJ0H 2QJPB 2SPZA 3CXHH 1ZW0A 1J1EC 3E1IA 1SQQJ 1KMIZ 4GOEA 2B87B 2YO3A 1QL1A 2ZVNB 1PV3A 2Q7CA 3AEDC 1SQPJ 3NXSA 5APXA 4DJGA 3M9QA 2P67A 1SQPK 3WU2E 4AUWA 4Y28J 1PP9G 1P84H 1R5LA 3KYQA 5BU5A 1KYOH 3VOPA 1USDA 1HGVA 3E7KA 1SQBG 3H1JD 3CWBD 4PV1C 4BRYB 1FZCC 2J5UA 1P84E 1LP1B 1R5SA 1YYCA 2JO1A 3CCJP 4RKUJ 1JMMA 1S1CX 1FZCB 2Z5IA 2FYNB 1ZOYC 1NAYA 2IFMA 4H0LC 2Z4EA 3Q1MA 2OTLP 1JOCA 4GOFA 4JBZA 2Q9IA 1PP9E 1UIIA 2QM7A 5AVVB 3D6YA 4HH2A 1PIXA 2JR8A 2ZT9D 3L71E 1T2KC 1KB9I 3H1JG 3WUVA 3MZWB 4I7ZB 4DT0A 1T3UA 3PHLA 3AE2C 3TGUD 1M1KQ 1CW5A 1L2PA 1FAVA 3CXHE 3M9HA 2AEFA 1PP9D 5KJ7D 3TNUA 3W67A 5KJ7A 1E5WA 1PZQA 3HD7C 3N4XA 4NPDA 3H32B 2KB7P 1KORA 1J1DC 1YI2P 1SFCB 5DJTB 1LTGC 1LTAC 1JCDA 2H88C 2Y0EA 2GUVA 4H13B 2NRGA 1URQD 4TT3H 2Y0CA 1FDOA 2IPPA 3AEGC 3FWNA 3U1AA 1OMIA 1RH5B 3H1JE 3A5TA 3PTZA 2G3AA 2WPVB 3SFEC 4WY4D 1HJBA 1LTSC 3II6A 1L0NJ 3L37A 4PD4E 2Q1KA 5H2FH 1Q82Q 1NWQA 1KD1Q 1N7SC 3CLQA 4EOTA 2E76B 4DCKA 3L70D 4ASWA 1S2EA 4KJMA 5KAIH 5B66E 1BE3G 1KC8Q 1RE4C 3CCEP 3GW6A 1CSBA 5CBNA 1NU1K 2IBZD 1LTJA 2IZ1A 3RL0C 2OTKE 1RF1B 5KAFE 1VQ8P 1YJ9P 2FY8A 3I56P 2RQ6A 1GL2B 2KXPB 1KILC 2D2CC 3BCCE 1FE6A 3SWKA 1AQ5A 3AEAC 4OGQD 4RJTA 2IX7C 3HE4A 3A0BH 3G6EP 2P10A 2V7QJ 2NPSD 4GKGA 1U57A 2QJYB 3FWLA 2BEZF 1AFOA 5E79H 3F89A 2OYHA 3RK2C 5GTHE 1VL2A 1SQBJ 1XTCC 2IBZE 2WITA 4XFJA 3AE4C 3RK2D 2HLDH 3VMAA 2QE7H
chains in the Genus database with same CATH topology
1BSHA 4QMAA 3FKSH 1H8EH 1BSNA 5FL7H 2XNDH 2E5TA 3USSA 4ASUH 3EFFK 2V7QH 2CK3H 3OE7H 1JEKA 4YXWH 3OFNH 1IFPA 3PJSK 1FS0E 2W6JH 2RQ6A 2XOKH 3OEHH 2WSSH 3OAAH 1E79H 2RQ7A 4TLFA 4DJGA 2JDIH 5DN6I 2E5YA 1AQTA 2HLDH 2QE7H 4WVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSH A;  4QMA A;  3FKS H;  1H8E H;  1BSN A;  5FL7 H;  2XND H;  2E5T A;  3USS A;  4ASU H;  3EFF K;  2V7Q H;  2CK3 H;  3OE7 H;  1JEK A;  4YXW H;  3OFN H;  1IFP A;  3PJS K;  1FS0 E;  2W6J H;  2RQ6 A;  2XOK H;  3OEH H;  2WSS H;  3OAA H;  1E79 H;  2RQ7 A;  4TLF A;  4DJG A;  2JDI H;  5DN6 I;  2E5Y A;  1AQT A;  2HLD H;  2QE7 H;  4WVZ A; 
#chains in the Genus database with same CATH topology
 2RMZ A;  2O01 H;  3CL3 D;  3CD6 P;  4L75 A;  4U3F J;  1EZV I;  1IFM A;  4IFM A;  4I7Z C;  1YQ3 C;  2A06 E;  2C9N Y;  5GTI E;  2NPS B;  2XND H;  3BAS A;  4N78 D;  3KDP B;  1FZB A;  1KIL D;  3CPW O;  1LGH B;  5AW7 B;  1OWA A;  5APS A;  1YQ4 C;  2E43 A;  5AW3 B;  1BSH A;  3AE7 C;  3VYI A;  1Q7Y Q;  1G1I A;  1SLQ A;  1M57 D;  1YJW P;  3T97 A;  4D6T D;  1DD4 A;  3L75 E;  4DOJ A;  1S5L H;  2JP3 A;  3VMX A;  3B71 A;  3Q2Y A;  3Q3D A;  2N9B A;  4PD4 I;  4WWI A;  3P8M C;  1G2C B;  3AE1 C;  4IL6 H;  3L72 E;  4WBA A;  1NU1 G;  4WB4 A;  3KHU A;  5AW9 B;  3H25 A;  2XV5 A;  1HVV A;  2DW3 A;  2JDI H;  3MUD C;  3EWK A;  3R4Y A;  3L71 J;  3D6Z A;  1K8A Q;  1GDT A;  1IFJ A;  1SQX J;  1VQ5 P;  2WSF J;  3TF5 A;  2YXQ B;  3SWF A;  2B88 A;  3M9B A;  2M5A B;  4H44 C;  2ZXX A;  4OWF A;  1HTL C;  1VQ6 P;  1Y9B A;  3BVH A;  1KIL E;  1VF5 B;  1Y8A A;  5EFW B;  2ZYD A;  4AQR D;  5KLI C;  4L73 A;  2E5T A;  2VRS A;  3HD7 D;  1W2E A;  1HH0 A;  2M0B A;  1KB9 H;  2FFD C;  2K9J A;  1D7M A;  2FYU G;  2P2U A;  1J1D B;  1L0N D;  3FXE A;  2KLV A;  3HUS A;  3P32 A;  4B86 A;  1J2J B;  1EXJ A;  3TYY A;  3QH9 A;  2BAS A;  4WY4 A;  3S9O A;  3WUT A;  1VQ9 P;  2KSJ A;  2ZT9 C;  1IFP A;  2QJY C;  1T2K D;  1L4A A;  2PAJ A;  1KFM A;  2XU6 A;  5AW5 B;  1YTZ I;  1LP1 A;  1UIX A;  2QJP C;  3C9I A;  4GDO A;  2H7H A;  3QWO C;  3R2P A;  2KZI A;  5AW8 B;  2C0W A;  1S4X A;  2B87 A;  3H1H G;  1AA0 A;  1HJ0 A;  5AVW B;  2YIU B;  2E74 B;  4PV1 D;  2QVA A;  4EIJ A;  4YXD C;  2WTY A;  4BXL A;  1VQM P;  2W6A A;  1FBM A;  1GZL A;  1ZME C;  2HPC A;  1DD3 A;  2QA4 P;  5B5E H;  2PGD A;  3CXH D;  5TIS H;  1SP4 A;  4PJ0 E;  4YPC A;  2KS1 A;  5AW2 B;  4JQ0 D;  5CMZ A;  1PGP A;  3USS A;  2E74 D;  4EYY Q;  3D70 A;  1VQO P;  4ASU H;  2OTJ P;  1LT1 A;  2M3E A;  2KIK A;  1VQK P;  1NTZ K;  1CI6 B;  1N73 C;  2E42 A;  1FU1 A;  2E75 D;  2N1T B;  3HE5 B;  3L73 D;  4R4L A;  4D6T J;  1BGY E;  1H89 A;  1RF1 A;  1FOS F;  3TSI A;  1SVF A;  1KV4 A;  2G8Y A;  1URQ A;  3GHG B;  1IO4 A;  2H89 C;  2WSF H;  1HUC A;  1PPJ D;  5KLV J;  3E1R A;  1QL2 A;  5KAF H;  5B66 H;  1DX7 A;  2K1A A;  5CCG A;  1SQV K;  1SQX K;  2RQ7 A;  2E75 B;  2N1T D;  3VP9 A;  2AEJ A;  1BCC G;  3AEF C;  3SWY A;  4PD4 D;  3ZDM A;  1BE3 E;  2D2C B;  4U3F G;  1FZA A;  1N7S A;  2H43 A;  2PP6 A;  4O9B A;  2GA1 A;  2FYZ A;  2L91 A;  4UB6 E;  3GHG A;  2L5G B;  2YO2 A;  1SQV J;  2W27 A;  1ZP0 C;  3H1I E;  3RBZ A;  3HUS C;  1GL2 A;  1S5L E;  2ZT9 B;  1NTM D;  1H88 A;  1VQ4 P;  3MHV A;  1N7S B;  2Y9Z A;  1PFI A;  5GTI H;  2AEM A;  3TGU E;  3O6Q A;  1X79 B;  1JO5 A;  3L73 J;  2OYI A;  1S3J A;  2QJK C;  3L71 D;  2HPC B;  1NTZ D;  1OW6 A;  5KLV K;  2O01 N;  1RF0 A;  2ZYG A;  1U7J A;  4N78 E;  1PL5 A;  3D71 A;  3IN6 A;  3TK1 A;  1ZV8 A;  3N7N A;  3O8Z A;  3CCV P;  2A06 D;  1ZN5 A;  2WSS H;  1RF1 C;  2FYU K;  3H1L G;  1M90 Q;  1FZE A;  1NVO A;  2J58 A;  1T3J A;  3HE5 A;  2KI7 B;  3L36 A;  3OAK A;  1IFN A;  1JY2 O;  3L75 D;  4LC1 A;  1L0L G;  2HOD B;  5KLI B;  1EXI A;  1NTK J;  3CME P;  1NTM K;  2QEX P;  2K88 A;  3A0B E;  5AW1 B;  1IC2 A;  2YMK A;  4EI2 A;  3AEE C;  2R44 A;  1KIL A;  1BCC D;  1OX3 A;  1HGZ A;  1YHQ P;  3IAO A;  3NTN A;  1K73 Q;  3OFN H;  3HRN A;  4YTP C;  1KQG B;  1IZN B;  1SFC A;  2QSI A;  3CX5 H;  5AW4 B;  3WU2 H;  5APT A;  2BCC E;  3H1K E;  3SSU A;  2K9J B;  3V2N A;  2P7J A;  3W68 A;  5KKZ C;  1KYO E;  2N9Y B;  1GK4 A;  1N8R Q;  1SQX G;  3ABV C;  1VQ7 P;  3PLN A;  2O01 J;  3B8E B;  3RL0 g;  1JEK A;  1NYH A;  1SQV D;  2YXR B;  1KB9 E;  3KZI H;  1X9V A;  2QG4 A;  3A0H E;  5APV A;  5APY A;  1M1J C;  1QLE D;  1K9M Q;  2BEQ D;  3PJS K;  2CPS A;  4C7N B;  2O1K A;  1OVV A;  3L74 D;  2XOK H;  2A06 G;  1WT6 A;  1YBK A;  1NH4 A;  2KK7 A;  2OGU A;  3P7K A;  1G1J A;  4GIF A;  4H44 D;  4L76 A;  3K5B A;  2B9B A;  1L0N E;  3HD7 A;  1SQV E;  3MP7 B;  3VMY A;  5CBO A;  1BCC J;  3VMZ A;  3Q5S A;  1MKM A;  1OZH A;  1X22 A;  3G9R A;  2R5D A;  1M1J A;  2QJK B;  3GLM A;  3GF3 A;  5DJU B;  2AXT H;  3BAT A;  3L74 G;  4M3L A;  4U3F D;  5AVS B;  3CI9 A;  2KLU A;  3L70 J;  4PV1 B;  3L72 G;  3OW2 O;  1NU1 E;  1VF5 C;  1EDJ A;  3GF7 A;  4IL6 E;  3CCS P;  1LT9 C;  1Y47 A;  2IZ0 A;  1KTM A;  2GM4 A;  3L4F A;  3U59 A;  2KZJ A;  1FOS E;  1MFZ A;  3AE3 C;  1FS0 E;  1Q2N A;  3HTK A;  1EDK A;  2E76 D;  3L35 A;  4ZNC A;  3L74 J;  1DEB A;  1PP9 J;  1RE3 C;  4OH8 B;  3OEH H;  1FC2 C;  3OAA H;  1E79 H;  1QGK B;  1SQP G;  3HE4 B;  3L72 J;  4IL6 X;  1KZU B;  2WQY C;  3CWB E;  1DH3 A;  1ZRT E;  1LT9 A;  2FYU E;  1SQQ G;  5AVY B;  1JMB A;  1SFC C;  3VTP C;  2MJZ A;  3L75 J;  2HFE D;  3AE9 C;  1GTW A;  3IF4 A;  1IK9 A;  2A45 I;  3CCL P;  1ZR2 A;  1LTJ B;  2D2C D;  1PPJ E;  2KYV A;  2QRX A;  1W5C E;  3RBX A;  1ZR4 A;  3FKS H;  2OYH C;  2MKV A;  3CC4 P;  4R4M A;  1JB0 J;  2A45 G;  1LTJ C;  2LXC B;  1SQP E;  1QX8 A;  1NTM G;  1NTK K;  2BCC J;  2FXO A;  2KNC A;  3CWB G;  3H1K J;  5E79 E;  4BWN A;  3EFF K;  1BDD A;  2E76 C;  1SQQ E;  1VPC A;  3GG2 A;  3H1H E;  4N6J A;  4U7J A;  2Y9Y A;  1EDI A;  2I1J A;  2GUS A;  1VQN P;  1AVO A;  4IOI H;  3B4S A;  5CCG D;  1DIP A;  1BE3 D;  2N1T A;  4KT0 J;  1N7S D;  5CCH C;  1P84 I;  1SQQ D;  3M0D A;  3G3Z A;  3GHG C;  2QIW A;  3I5C A;  4ASV A;  4C46 A;  3MGN A;  1KQS O;  1OVR A;  1QEX A;  3JC2 2;  4XE5 B;  1H0T B;  1CI6 A;  2WSE H;  4HKZ H;  5M1B A;  3TGU G;  1LTT C;  2AXT E;  2CPB A;  3A3Y B;  2XZR A;  3RK3 D;  1L0L J;  3FXD A;  3CX5 I;  3CCR P;  1JY3 O;  1K04 A;  2WPR A;  3H6P A;  2N1T C;  5CCH A;  3VP8 A;  2K9Y A;  1M1J B;  1MZ9 A;  2W6B A;  2FYN C;  4ZKU A;  4LGD E;  3BCC G;  2W8Z A;  1JNM A;  3H1L E;  5FL7 H;  1WMK A;  2YKP A;  4KHX A;  3AEC C;  1Q90 D;  3V2P A;  2FXP A;  3CXH I;  3UIA A;  1X0T A;  2JKV A;  4UB8 E;  3L73 G;  2W90 A;  2E75 C;  2HG5 D;  1S72 P;  4MN4 C;  1BDC A;  4BRY A;  3CC2 P;  1N86 A;  2E74 C;  1FJK A;  4W80 A;  1KYO D;  5TIS E;  3A7O A;  2M5A A;  3P8C D;  3HD7 B;  2Y0D A;  2WSC H;  3GMA A;  5B5E E;  4A7P A;  2BCC G;  3H1K G;  3WMM 0;  1MFT A;  5K5G B;  1KFN A;  2I8D A;  2M3B A;  1GK6 A;  2ZJS E;  3AE8 C;  3H32 A;  1RE4 A;  5APW A;  3M0D C;  3B5N D;  4Z1M H;  1H8A A;  1N73 B;  2WPS A;  1AQT A;  1SQP D;  1M56 D;  1BGY J;  2W83 C;  3B5N C;  1MV8 A;  3L70 G;  4H44 B;  4JPZ B;  3G71 P;  4NPE A;  4OGQ B;  3M91 A;  2BCC D;  3H1K D;  1PGJ A;  2C9L Y;  1H8E H;  3BRT B;  2R5B A;  2AXC A;  3HTK B;  4ZKP A;  4I6M C;  1GW3 A;  2M8R A;  5AVU B;  1IFI A;  3EFG A;  2HOD A;  4W7Z A;  1L0L E;  5AVX B;  1FDM A;  1YJN P;  1RQV A;  1YIJ P;  1BE3 J;  1NAF A;  2WT7 B;  2LXB A;  3LID A;  5APQ A;  2IBZ G;  5BVZ A;  3PH0 A;  2C0X A;  2K3R A;  5C39 A;  3SFD C;  5KLV E;  3V6I A;  3F5H A;  2OYO A;  3ITK A;  3MIW A;  1VQL P;  4TLF A;  4ZMD A;  2FFD A;  3CCQ P;  1Q81 Q;  3M06 A;  2WPQ A;  5KKZ B;  1EZV E;  4JYB A;  2P1J A;  2E5Y A;  4HYT B;  2O3J A;  1AV1 A;  5KTB A;  1NGM B;  4EDF A;  2KP8 A;  2YKQ A;  3A0H H;  3H1H D;  4WVZ A;  5H2F E;  3RK3 C;  3G4S P;  1WRG A;  2K37 A;  2XDJ A;  3TDK A;  5APU A;  4AYC A;  1NTZ J;  3MUD A;  3Q5P A;  1DEE G;  1GL2 D;  3TNU B;  1Q86 Q;  1N2D C;  4GOD A;  5CCH D;  2CK3 H;  1BGY D;  3EQ2 A;  5TJH A;  4YXW H;  2V4H A;  1LWU B;  1NHL A;  5CCG C;  4JYC A;  4W7Y A;  1OFC X;  5AVQ B;  1R8E A;  2YKO A;  1L0L D;  2R32 A;  2RKL A;  2POH A;  1LWU C;  1PPJ G;  1NTK D;  1ZRT D;  2NPS A;  3C8V A;  1EQ7 A;  1N7L A;  3JCU H;  3L74 E;  1EC5 A;  2WWW A;  2YMY A;  3PP5 A;  3MD0 A;  3IFM A;  1XTG B;  1NTM E;  1OVU A;  3I55 P;  3V2R A;  1QVG O;  1A02 J;  4HJG H;  1Z56 A;  3L71 G;  1JY3 P;  4I1L A;  1L4A B;  2LKM A;  2ZYA A;  2Z5H A;  1YIT P;  2UWJ E;  1K05 A;  5CJ0 A;  1SFC D;  1GU5 A;  4N3Y B;  4H13 D;  2ZXE B;  1L4A C;  1NKN A;  2FFD B;  1SQB K;  2XNX A;  4XA4 A;  3CCM P;  2IYO A;  3BCC D;  5AVT B;  4LLH A;  1NU1 D;  1NTM J;  1S9K D;  1QVF O;  1BCC E;  1VDF A;  5CJ4 A;  1SQQ K;  1NO4 A;  3P8C E;  4U3F E;  1GD2 E;  2J59 M;  1SS1 A;  4Y99 B;  4PD4 H;  1J1E B;  1MUU A;  1SQB E;  2Q3I A;  4RO0 A;  2IFN A;  2O1J A;  2R3C A;  1JUN A;  1P84 D;  2HLO A;  1RHZ B;  2ITA A;  3LIE A;  4UB8 H;  1HWT C;  1L0N K;  1VQP P;  3H1L D;  4WY4 C;  3BRV B;  4GT1 A;  1JTH B;  1VF5 D;  2I1K A;  1S9K E;  5AVR B;  3RGU A;  2PFX A;  2YIU C;  1GMJ A;  4D6T G;  2A45 H;  2IBZ I;  2JWD A;  2QM8 A;  3AE6 C;  3CMA P;  3Q5R A;  2FYU D;  2FBW C;  1N73 A;  2JWA A;  1BGY G;  2RN0 A;  2ZAE B;  3M0A A;  1LT9 B;  3NMD A;  4IFF A;  4RES B;  1KQL A;  2P58 A;  2PRR A;  4K3A A;  1NKZ B;  4H0L B;  4QMA A;  3H1I D;  2OQQ A;  1JCC A;  1AVY A;  1JTH A;  1M7L A;  1PGQ A;  2RH0 A;  1L0L K;  3B5N B;  2KSE A;  2HR3 A;  4K35 A;  5AW0 B;  5AW6 B;  3FGA D;  3RK2 B;  4D6T E;  2KUB A;  3KZI E;  2WT7 A;  3H1H J;  1GU4 A;  2V7Q H;  2WZ7 A;  3KQG A;  1NTK E;  3MTU E;  3T97 B;  3WUU A;  3V5B A;  3V4W A;  1FZG A;  3LW5 H;  1S5L X;  1EDL A;  4H0L D;  2ZVO B;  1HBW A;  3IR9 A;  3CCU P;  1RY3 A;  1KIL B;  1FZC A;  3BCC J;  3CX5 D;  1IK7 A;  2KS1 B;  3S4R A;  1U7M A;  3B5N A;  1L4A D;  3H1I G;  1AJY A;  1HF9 A;  3L72 D;  4H13 C;  1W2B O;  3JSV C;  5CHX A;  2KOG A;  5DN6 I;  4CPG A;  2FKW B;  2FYU J;  1SQX D;  1NTK G;  3CX5 E;  2WSC J;  2H8P D;  3CWB J;  3L73 E;  1OIP A;  3A2A A;  3TGU J;  1OXZ A;  2FXM A;  1OW7 A;  2NZ2 A;  2ZFC A;  3KPE A;  1T8Z A;  1FDI A;  5AVZ B;  5GTH H;  4Y99 C;  1TU3 F;  3V4Q A;  3VN0 A;  1LWU A;  1RF0 C;  1M8O B;  1YTZ T;  1EZV D;  2LR2 A;  1GW4 A;  2NPS C;  3H1I J;  3JCU E;  4L74 A;  1BSN A;  1KQF B;  4OGQ C;  2R3S A;  3RK3 B;  4C7N A;  4DZO A;  1H0T A;  2KNC B;  1RQU A;  3H1J J;  2Q3E A;  4WY4 B;  1LNQ A;  4NPF X;  2WSE J;  1LJ2 A;  5KLV D;  1NJI Q;  3OE7 H;  1L0N G;  1IJD B;  1PGO A;  1RE3 A;  1USE A;  3O6Q B;  4OVN F;  1KN7 A;  1GL2 C;  3RL0 D;  1G2C A;  1NU1 J;  2OAR A;  3FX0 A;  1JM0 A;  1ZLL A;  2HYN A;  1JY2 N;  3L70 E;  3OJA B;  3V2Q A;  1JY2 P;  5BU8 B;  2Q5U A;  2W6J H;  1IFD A;  2OYI C;  3CC7 P;  3NFQ A;  1CZQ A;  5KAI E;  1NTZ G;  1KYO I;  1JY3 N;  2IDB A;  4UB6 H;  2OYI B;  3H1L J;  1FZF A;  2WVR A;  3S1K A;  1SQX E;  3RL0 B;  3KXD A;  1X8Y A;  3RK3 E;  1SQB D;  2Q6Q A;  4C7R A;  3OA7 A;  3L75 G;  2XKM A;  3PRJ A;  1URQ C;  3AEB C;  1LTB C;  1T6A A;  5KLV G;  2WMM A;  3LW5 J;  2IYP A;  1NOH A;  1NTZ E;  1URQ B;  2JJL A;  1ZXG A;  1LTI C;  3AE5 C;  4I2L C;  4JF7 A;  2OYH B;  4IFD K;  3C1L A;  2B89 A;  2YNY A;  2JEE A;  1EZV G;  5L8R J;  5KJ7 C;  1FJP A;  1OW8 A;  1SQV G;  1KB9 D;  4HB1 A;  3U1C A;  1A02 F;  3HUS B;  4PJ0 H;  2QJP B;  2SPZ A;  3CXH H;  1ZW0 A;  1J1E C;  3E1I A;  1SQQ J;  1KMI Z;  4GOE A;  2B87 B;  2YO3 A;  1QL1 A;  2ZVN B;  1PV3 A;  2Q7C A;  3AED C;  1SQP J;  3NXS A;  5APX A;  4DJG A;  3M9Q A;  2P67 A;  1SQP K;  3WU2 E;  4AUW A;  4Y28 J;  1PP9 G;  1P84 H;  1R5L A;  3KYQ A;  5BU5 A;  1KYO H;  3VOP A;  1USD A;  1HGV A;  3E7K A;  1SQB G;  3H1J D;  3CWB D;  4PV1 C;  4BRY B;  1FZC C;  2J5U A;  1P84 E;  1LP1 B;  1R5S A;  1YYC A;  2JO1 A;  3CCJ P;  4RKU J;  1JMM A;  1S1C X;  1FZC B;  2Z5I A;  2FYN B;  1ZOY C;  1NAY A;  2IFM A;  4H0L C;  2Z4E A;  3Q1M A;  2OTL P;  1JOC A;  4GOF A;  4JBZ A;  2Q9I A;  1PP9 E;  1UII A;  2QM7 A;  5AVV B;  3D6Y A;  4HH2 A;  1PIX A;  2JR8 A;  2ZT9 D;  3L71 E;  1T2K C;  1KB9 I;  3H1J G;  3WUV A;  3MZW B;  4I7Z B;  4DT0 A;  1T3U A;  3PHL A;  3AE2 C;  3TGU D;  1M1K Q;  1CW5 A;  1L2P A;  1FAV A;  3CXH E;  3M9H A;  2AEF A;  1PP9 D;  5KJ7 D;  3TNU A;  3W67 A;  5KJ7 A;  1E5W A;  1PZQ A;  3HD7 C;  3N4X A;  4NPD A;  3H32 B;  2KB7 P;  1KOR A;  1J1D C;  1YI2 P;  1SFC B;  5DJT B;  1LTG C;  1LTA C;  1JCD A;  2H88 C;  2Y0E A;  2GUV A;  4H13 B;  2NRG A;  1URQ D;  4TT3 H;  2Y0C A;  1FDO A;  2IPP A;  3AEG C;  3FWN A;  3U1A A;  1OMI A;  1RH5 B;  3H1J E;  3A5T A;  3PTZ A;  2G3A A;  2WPV B;  3SFE C;  4WY4 D;  1HJB A;  1LTS C;  3II6 A;  1L0N J;  3L37 A;  4PD4 E;  2Q1K A;  5H2F H;  1Q82 Q;  1NWQ A;  1KD1 Q;  1N7S C;  3CLQ A;  4EOT A;  2E76 B;  4DCK A;  3L70 D;  4ASW A;  1S2E A;  4KJM A;  5KAI H;  5B66 E;  1BE3 G;  1KC8 Q;  1RE4 C;  3CCE P;  3GW6 A;  1CSB A;  5CBN A;  1NU1 K;  2IBZ D;  1LTJ A;  2IZ1 A;  3RL0 C;  2OTK E;  1RF1 B;  5KAF E;  1VQ8 P;  1YJ9 P;  2FY8 A;  3I56 P;  2RQ6 A;  1GL2 B;  2KXP B;  1KIL C;  2D2C C;  3BCC E;  1FE6 A;  3SWK A;  1AQ5 A;  3AEA C;  4OGQ D;  4RJT A;  2IX7 C;  3HE4 A;  3A0B H;  3G6E P;  2P10 A;  2V7Q J;  2NPS D;  4GKG A;  1U57 A;  2QJY B;  3FWL A;  2BEZ F;  1AFO A;  5E79 H;  3F89 A;  2OYH A;  3RK2 C;  5GTH E;  1VL2 A;  1SQB J;  1XTC C;  2IBZ E;  2WIT A;  4XFJ A;  3AE4 C;  3RK2 D;  2HLD H;  3VMA A;  2QE7 H; 
#chains in the Genus database with same CATH homology
 1BSH A;  4QMA A;  3FKS H;  1H8E H;  1BSN A;  5FL7 H;  2XND H;  2E5T A;  3USS A;  4ASU H;  3EFF K;  2V7Q H;  2CK3 H;  3OE7 H;  1JEK A;  4YXW H;  3OFN H;  1IFP A;  3PJS K;  1FS0 E;  2W6J H;  2RQ6 A;  2XOK H;  3OEH H;  2WSS H;  3OAA H;  1E79 H;  2RQ7 A;  4TLF A;  4DJG A;  2JDI H;  5DN6 I;  2E5Y A;  1AQT A;  2HLD H;  2QE7 H;  4WVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...