1AQTA

Epsilon subunit of f1f0-atp synthase from escherichia coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE
publication title Crystal structure of the epsilon subunit of the proton-translocating ATP synthase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1aqtA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1aqtA01
2CK3H 2JDIH 2QE7H 2V7QH 3OAAH 2HLDH 2RQ7A 4TLFA 3EFFK 1E79H 5FL7H 3OEHH 2E5YA 1BSHA 2RQ6A 2XOKH 3FKSH 4ASUH 1BSNA 2E5TA 1FS0E 4DJGA 3USSA 5DN6I 1IFPA 4WVZA 4QMAA 3PJSK 3OE7H 2W6JH 1JEKA 2XNDH 1AQTA 4YXWH 3OFNH 1H8EH 2WSSH
chains in the Genus database with same CATH superfamily
3B5ND 1N86A 2O1KA 4ZMDA 5CCHC 1U57A 4RKUJ 1GTWA 2JWDA 2KLVA 1KQSO 3CI9A 2H43A 1YTZI 3CX5E 1SQVJ 1NTKE 4QMAA 3PJSK 1M1JA 3HRNA 3II6A 3TK1A 3V2PA 4U3FD 1VQOP 1Q90D 3CXHH 4NPEA 2KZIA 3A5TA 3H1HD 3BRTB 1N7SD 1GU5A 4IFDK 3GW6A 4Z1MH 2FY8A 1JY3P 3BCCJ 2JO1A 4N78E 1J1DB 1LP1A 1HJBA 2ZYAA 2GA1A 2P58A 3HUSC 2O01H 2P7JA 3OEHH 1DEBA 3H25A 1VQNP 4OGQB 3VMYA 3PH0A 1EDKA 2K3RA 3PTZA 1IFPA 1KD1Q 2QM7A 3T97B 3TGUE 2QIWA 3RK3C 1RH5B 3AEFC 1KYOH 1SQXG 3RL0B 3L71E 2W8ZA 1YHQP 2KIKA 4AYCA 1QVFO 1SQVD 1DD3A 1M1JC 3PHLA 1PP9G 1JNMA 1M56D 1H8EH 4BXLA 2E75C 3LIDA 2Q6QA 2WT7A 2RMZA 1LT9B 1NAYA 2YKOA 4UB6E 3WMM0 2ZFCA 1SVFA 3KYQA 1FOSE 3CCSP 1PV3A 1IFJA 1EZVG 1P84I 2JP3A 1QL1A 3HE5B 3GHGB 4L75A 2RQ7A 1L0LJ 2BCCE 4I7ZB 3SSUA 4NPDA 1PFIA 1CZQA 3VN0A 1SQPK 5GTIH 2Q1KA 2Z5IA 4L76A 1SQBG 1HGZA 2QA4P 1FS0E 2IBZE 3FXDA 2D2CD 1S4XA 4XFJA 2LXBA 3P8CE 3K5BA 1VQ5P 3Q5SA 1VQMP 2E42A 4C7NA 1X0TA 2V4HA 1K73Q 3L72G 2OTJP 2FKWB 3L37A 2WSCJ 2AXCA 3ABVC 2FYZA 5KLVE 2R5BA 4D6TG 1FE6A 2AXTH 1RQVA 3L75D 2B89A 1SFCB 5KLIB 1A02F 1LTBC 3H1LD 3GF3A 5CCGD 4WY4D 3VOPA 5AVSB 3CLQA 3Q2YA 1N73B 1L0LD 3CPWO 1BDDA 3H1KJ 1KB9D 3W67A 1GD2E 2FYNB 2KSJA 3FWNA 4I2LC 2NPSA 4DJGA 1S1CX 1L4AD 4WB4A 1GU4A 1VF5D 1IC2A 1ZP0C 5CCGA 1GL2B 1R5LA 3TGUJ 1VL2A 4BWNA 1BGYG 2YMYA 4EYYQ 1OIPA 3CL3D 3L71J 3HE4B 1YBKA 1T2KD 3CX5D 4H13D 1NTKD 2IPPA 1YITP 2WPSA 1MFTA 2K88A 2WPQA 2FXPA 3IN6A 3SWFA 2W27A 3RK2B 1J1EC 2RH0A 1MKMA 3RL0D 2B87B 5AVYB 3H1JJ 4DT0A 5AVVB 2LKMA 1EDLA 1IK7A 1LJ2A 1AJYA 1P84E 2NPSC 2BCCJ 2RKLA 1X22A 1ZRTE 2QSIA 1SQXE 3E1IA 2YMKA 2WSFH 2NZ2A 3TGUD 2KNCB 5CCGC 2HODA 4PD4H 5H2FE 1PP9E 5AVXB 1YI2P 3HD7B 3C8VA 1R8EA 2PFXA 2AEFA 3U1AA 5TISH 1BDCA 2YNYA 1CW5A 2V7QH 2XDJA 2W6AA 1KB9I 2J5UA 1EZVE 3VP9A 1USEA 1S9KD 3BATA 4YPCA 2K37A 4N3YB 2ZYDA 3HE5A 3A0HE 1D7MA 5CHXA 1SQBE 3L73G 1J1DC 3L74G 1KZUB 1LTJA 4Y99B 1IFDA 1NTZK 3CC7P 3H32B 1TU3F 4OGQC 4H0LB 2W6JH 2IBZD 3CX5I 1SFCD 1N7SB 3N7NA 4H44C 3P8CD 2R3CA 3RL0C 5APWA 4PV1B 2WTYA 1RF1A 1JB0J 3AE8C 1E79H 3M9BA 2DW3A 1M7LA 2FYUD 2PP6A 2XNXA 1WMKA 4W80A 1SQPG 5K5GB 1NYHA 5EFWB 4EIJA 1LT9C 5KLVD 2ZVOB 2ZXEB 1EDIA 5AW0B 3S9OA 2A45G 1NO4A 2P1JA 2W83C 3AEBC 2HYNA 2YXQB 4WBAA 3GHGC 1BE3J 2B9BA 2IZ0A 3AEDC 2E76D 3GMAA 1M90Q 3HTKB 4JYBA 5AVTB 1IZNB 1YJ9P 2KB7P 3RK2D 4M3LA 2UWJE 1SQXJ 5AVQB 1GL2A 1SP4A 5FL7H 1FZCB 4ZNCA 1S5LX 2WPRA 3M9QA 3CCEP 3VP8A 3HE4A 3BASA 1PP9J 1JO5A 2XU6A 5AVWB 4AQRD 4PJ0H 3U59A 2ZXXA 3H1IG 3MGNA 1SFCC 5KLIC 3R4YA 2P10A 2L91A 2HR3A 1RF0A 1LT1A 3TNUB 2A06G 2B87A 2OQQA 3JCUE 1IFMA 3P32A 1N73C 2IBZI 4UB8H 3CMAP 3LW5J 3Q3DA 3L70J 3G9RA 2PGDA 2Y9ZA 1SS1A 3HD7D 2FYNC 1SQBJ 3AEGC 4ASUH 2RN0A 1EXJA 1FJKA 1KILA 1ZR4A 3SFDC 1G2CA 1RQUA 1P84D 1ZRTD 1MZ9A 1SQXD 1K05A 3G4SP 2KNCA 4WY4B 1GL2C 3B8EB 2PRRA 2QJPB 4YTPC 1L0NK 5KAIH 3L72J 2H8PD 1HGVA 4BRYB 1H89A 1PP9D 1QL2A 2K1AA 3RBZA 4D6TJ 2CPBA 2GM4A 1ZR2A 5BU8B 2YO2A 3A7OA 1HF9A 1SQQG 1L4AB 4H0LD 1Q82Q 3D71A 2Z5HA 3V6IA 2C0XA 1VF5B 2IYOA 3RK2C 1NGMB 3B5NA 1RF0C 5B66H 1Y9BA 5B5EH 3V2NA 2IFNA 4ZKUA 3IFMA 2HG5D 4PV1D 4R4LA 3V4QA 1URQB 3H1KE 2P2UA 2Z4EA 3G6EP 1YQ4C 1NJIQ 1BE3G 1VQ7P 1NWQA 4OWFA 3WU2E 1SQBD 4H13B 2R32A 1AQ5A 1Y8AA 3I55P 2XZRA 1IK9A 5KKZB 3H32A 1KILC 1PL5A 1S3JA 5APSA 3OFNH 1N7SA 2AEMA 1OVVA 1Q2NA 3IAOA 1BGYJ 3OAAH 4LC1A 1QVGO 1SQPE 2WSEJ 2JR8A 3CWBG 2YIUB 2KK7A 3D70A 1XTCC 5DN6I 1NTMG 3HD7C 1CI6B 2QEXP 1HVVA 2YKQA 1NTZG 1FZBA 3PLNA 3TSIA 3KZIH 1JTHB 4IL6H 3GF7A 3VMZA 3FXEA 5APQA 3B5NC 1DH3A 1N2DC 2MJZA 5KJ7D 3H1JE 2KSEA 3CC4P 1L0NJ 2R44A 3ITKA 1X79B 3BCCD 2QJKB 1JMBA 1LNQA 4U3FG 3L70G 2KLUA 1OXZA 3C9IA 3NMDA 5AW1B 4Y99C 3CCJP 2OYHB 3B71A 2WQYC 1KQFB 2FFDB 1JEKA 2GUSA 2M5AB 4HH2A 1N7SC 1H0TA 5AVZB 4PV1C 3CMEP 5AW7B 1FZCA 1EZVI 1FAVA 2QVAA 1XTGB 3SWYA 3NXSA 4EI2A 1IFNA 3H1IE 5APVA 4K35A 2BEZF 2A06E 1GZLA 1KV4A 4XA4A 1LWUB 1NVOA 1HUCA 3A0BE 3IF4A 3TNUA 3L35A 1RY3A 1AFOA 2J59M 4N6JA 3QWOC 3L73J 2CK3H 5CJ4A 3L74J 2KS1B 5GTHH 3JSVC 2WZ7A 2Q9IA 1QX8A 4W7ZA 5DJUB 4KJMA 2ZAEB 1NU1K 4WWIA 3S1KA 3SWKA 4WY4A 1FZEA 3U1CA 4HB1A 1FZCC 1Q7YQ 1URQD 3V5BA 1HTLC 1PPJG 2E76B 1PGOA 1JM0A 3OE7H 1SQPJ 3A3YB 1DEEG 5KAFH 1KB9H 3Q1MA 2D2CC 2ZT9B 1L4AA 2WMMA 2ZYGA 1M1KQ 2IDBA 5E79E 4ASVA 1JY2O 1YQ3C 1FDOA 1BE3E 4O9BA 1L0NG 5AW8B 3GG2A 3H1KD 2M3EA 3AE2C 2C9NY 1YJWP 2VRSA 3RK3E 1NHLA 3L75G 2Q7CA 4N78D 2FXOA 2WSCH 4CPGA 3CCLP 3R2PA 2H89C 1YJNP 3H1LG 1OW6A 1GW4A 1SQQK 3CX5H 3KHUA 1WT6A 3T97A 2WPVB 4R4MA 3CXHE 5CBOA 3GLMA 3CWBE 2C9LY 3PP5A 4WY4C 2O01N 1X8YA 2QJPC 3CCMP 4MN4C 3AE6C 4EDFA 3L71D 2NRGA 1NTZE 1SQPD 1HJ0A 2HPCB 3M0DA 4IL6X 1KFNA 3VTPC 2K9YA 1LT9A 4EOTA 1L4AC 3H1IJ 1PGQA 2I1KA 1BSHA 1G1JA 1VF5C 2FBWC 3TF5A 3RL0g 1KQGB 1M57D 5AW2B 4DCKA 1RE4C 3EQ2A 1M1JB 5APUA 3MP7B 5C39A 1KQLA 1JY3O 3L70E 1URQC 1ZV8A 3H1JD 4GODA 1KYOE 1OFCX 3GHGA 1NTKG 1Y47A 1NTMK 3BRVB 1T2KC 2R3SA 4H13C 2WWWA 3M91A 2BCCD 1N8RQ 2IYPA 4I1LA 1NOHA 4XE5B 5APXA 4HYTB 2H88C 1FZGA 3A2AA 1FOSF 3TYYA 2M5AA 3L72E 1MFZA 4UB6H 2N1TD 1K8AQ 4D6TE 1R5SA 3SFEC 2Y0DA 2G8YA 2I1JA 1NAFA 3M0DC 5GTIE 3H1ID 4IFFA 2AEJA 1IJDB 1SQQJ 3G3ZA 2YO3A 4PD4I 3IR9A 4C7RA 1SFCA 3VYIA 2A06D 4OH8B 1LWUA 1QGKB 1JCDA 4ZKPA 1T8ZA 1N73A 2QJKC 1QLED 2FXMA 2KS1A 3V2QA 2B88A 4I7ZC 1OMIA 1DX7A 1JY2N 1EQ7A 5CCHD 5APTA 1BGYE 4GDOA 4YXWH 2ZT9D 2AXTE 2KXPB 1HBWA 1PPJE 1ZMEC 1SQVK 4U7JA 1FZAA 3M9HA 3O6QB 3CWBJ 1OX3A 2A45I 1PGPA 1NTMJ 4GOEA 3AE1C 1UIIA 1NTZJ 3OAKA 1FC2C 1CSBA 3G71P 1GK6A 3KDPB 3AE3C 1EC5A 1L0NE 1NU1G 2O01J 1LWUC 1AVYA 2FYUG 1AQTA 1LGHB 1KFMA 3NTNA 2YXRB 1BE3D 1OW8A 1YTZT 1GW3A 1H8AA 2KI7B 4U3FJ 3H1LE 1FU1A 5KLVG 1ZOYC 3RK3D 1S5LE 3AECC 4GOFA 1JY3N 1W2EA 5AVRB 2N9BA 2H7HA 3MUDA 3I5CA 2M3BA 3CWBD 4Y28J 2PAJA 3O8ZA 2XOKH 3AE7C 1LTAC 2NPSB 4DZOA 1AVOA 2E75D 1MV8A 1KC8Q 5KTBA 2E76C 1YIJP 3ZDMA 2L5GB 3HD7A 2HPCA 1NTZD 3OW2O 3V2RA 3CD6P 2ZT9C 1LTTC 1W2BO 4B86A 2Y0EA 3OJAB 1EZVD 2KYVA 2QRXA 1L0LK 3L73E 1P84H 3L74E 2W90A 3P8MC 3CCVP 3H6PA 4PD4E 3L70D 2QE7H 3MD0A 1KYOD 4IFMA 1J2JB 3KXDA 4JQ0D 2J58A 5H2FH 4LLHA 2GUVA 2M0BA 5CJ0A 5TISE 2IFMA 3MUDC 2JJLA 3RGUA 5M1BA 1ZN5A 4GT1A 3L36A 1BCCG 1HH0A 3L72D 5BVZA 3D6ZA 2E43A 1AA0A 3AEEC 2ZJSE 4C46A 1NTKK 4D6TD 3LW5H 4H44B 2OTKE 2HODB 3WUVA 1S2EA 2KZJA 4TT3H 3A0HH 2KP8A 3EFGA 1JUNA 1RE3A 1H88A 1A02J 1FJPA 3MHVA 3AE9C 2E5TA 1UIXA 4I6MC 1U7JA 2XV5A 1S9KE 3CXHI 2BASA 5AW6B 3L75J 1T3UA 3HTKA 1X9VA 3V4WA 3H1LJ 3H1HG 4H0LC 1K04A 2WSSH 2OYIB 4JBZA 4KHXA 2QJYB 1BGYD 2OARA 5KJ7A 1LTJB 4TLFA 1PPJD 3CCRP 3O6QA 2G3AA 3W68A 2BEQD 3D6YA 1VQLP 1NKNA 4W7YA 2Q5UA 2CPSA 2K9JB 1T3JA 1NU1E 1ZLLA 1RF1B 2FYUE 3VMXA 2R5DA 1KYOI 2YKPA 1RE3C 4ASWA 2KOGA 2O1JA 2OGUA 1L2PA 1QEXA 4JPZB 1OZHA 1L0ND 1SQVG 2POHA 1NH4A 4DOJA 2N1TB 4JYCA 1NTKJ 3S4RA 1PIXA 2NPSD 2WITA 2JDIH 2WSFJ 2WSEH 1MUUA 2E74B 2M8RA 2E5YA 2Q3IA 3L4FA 2XNDH 2HFED 4PJ0E 2JEEA 1DD4A 1GDTA 3BCCG 5L8RJ 5KJ7C 2FYUK 1U7MA 2LR2A 3MZWB 4L74A 1LTGC 2V7QJ 2RQ6A 1AV1A 1ZW0A 1JOCA 4BRYA 2XKMA 3FWLA 2C0WA 4UB8E 5KLVK 1N7LA 1SQQE 3JCUH 3AEAC 3M06A 2IZ1A 1NKZB 2LXCB 2JWAA 2W6BA 1OVRA 1S5LH 5BU5A 1RE4A 2IX7C 1KMIZ 1KILE 1URQA 3L73D 1VPCA 2MKVA 1PZQA 3L74D 2HLOA 4OGQD 3NFQA 5KAIE 4PD4D 4OVNF 2QG4A 1VDFA 1VQ9P 1PGJA 4H44D 3CC2P 1LTIC 3QH9A 4YXDC 3E1RA 1BCCE 1JCCA 4JF7A 3TDKA 1L0LG 1Q86Q 3HUSB 1NTME 5B66E 1IO4A 5B5EE 1KILB 1G2CB 1CI6A 3RK3B 4RESB 3KPEA 2KUBA 3JC22 1LTSC 3EFFK 3Q5RA 1JTHA 1JMMA 1NU1J 3WU2H 2OTLP 2FYUJ 2QM8A 5CMZA 4U3FE 2E75B 4A7PA 3H1HE 5KLVJ 2I8DA 4KT0J 2ITAA 3B5NB 3EWKA 1G1IA 2OYHA 3KQGA 3RBXA 1SQXK 3VMAA 5KKZC 1DIPA 3F5HA 2O3JA 1RHZB 3OA7A 2FFDA 1Q81Q 2OYIA 3KZIE 1LP1B 4IL6E 1OVUA 1Z56A 3H1KG 2SPZA 5CBNA 1EXIA 3FKSH 2A45H 2Y0CA 2YIUC 4RO0A 3LIEA 2E74D 1VQPP 1OW7A 3F89A 1WRGA 2K9JA 3TGUG 1NU1D 1OWAA 1SQVE 3UIAA 5AW3B 5AW4B 2N9YB 4GKGA 4HJGH 3MTUE 2Q3EA 1S72P 3FX0A 1HWTC 2JKVA 3L71G 4RJTA 1EDJA 1USDA 3M0AA 4WVZA 1KORA 5AVUB 3WUTA 2N1TA 3P7KA 1SQBK 3WUUA 2WT7B 3AE5C 4HKZH 1T6AA 2OYHC 4GIFA 1M8OB 1VQ4P 3BCCE 1GL2D 3FGAD 1GK4A 2FFDC 2WVRA 2OYIC 2QJYC 3H1JG 1LTJC 1ZXGA 4AUWA 1BCCJ 3CCUP 4IOIH 3AE4C 2BCCG 3A0BH 3C1LA 5GTHE 1H0TB 1YYCA 1KN7A 2IBZG 1SQQD 1RF1C 5APYA 5CCHA 4C7NB 2ZVNB 3Q5PA 1BSNA 1K9MQ 1SLQA 2N1TC 3L75E 2D2CB 1KILD 1IFIA 4K3AA 1FBMA 2E74C 2OYOA 2Y9YA 4LGDE 2P67A 1J1EB 1JY2P 1VQ6P 3H1HJ 5AW5B 1L0LE 5TJHA 5KAFE 1FDMA 4NPFX 3I56P 1KB9E 3N4XA 1W5CE 1KTMA 3CCQP 1BCCD 2HLDH 3PRJA 3CXHD 5AW9B 3HUSA 3B4SA 1VQ8P 3BVHA 1NTMD 1GMJA 5E79H 1VQKP 3USSA 3E7KA 1FZFA 4L73A 3MIWA 1E5WA 1FDIA 5DJTB
chains in the Genus database with same CATH topology
2CK3H 2JDIH 2QE7H 2V7QH 3OAAH 2HLDH 2RQ7A 4TLFA 3EFFK 1E79H 5FL7H 3OEHH 2E5YA 1BSHA 2RQ6A 2XOKH 3FKSH 4ASUH 1BSNA 2E5TA 1FS0E 4DJGA 3USSA 5DN6I 1IFPA 4WVZA 4QMAA 3PJSK 3OE7H 2W6JH 1JEKA 2XNDH 1AQTA 4YXWH 3OFNH 1H8EH 2WSSH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CK3 H;  2JDI H;  2QE7 H;  2V7Q H;  3OAA H;  2HLD H;  2RQ7 A;  4TLF A;  3EFF K;  1E79 H;  5FL7 H;  3OEH H;  2E5Y A;  1BSH A;  2RQ6 A;  2XOK H;  3FKS H;  4ASU H;  1BSN A;  2E5T A;  1FS0 E;  4DJG A;  3USS A;  5DN6 I;  1IFP A;  4WVZ A;  4QMA A;  3PJS K;  3OE7 H;  2W6J H;  1JEK A;  2XND H;  1AQT A;  4YXW H;  3OFN H;  1H8E H;  2WSS H; 
#chains in the Genus database with same CATH topology
 3B5N D;  1N86 A;  2O1K A;  4ZMD A;  5CCH C;  1U57 A;  4RKU J;  1GTW A;  2JWD A;  2KLV A;  1KQS O;  3CI9 A;  2H43 A;  1YTZ I;  3CX5 E;  1SQV J;  1NTK E;  4QMA A;  3PJS K;  1M1J A;  3HRN A;  3II6 A;  3TK1 A;  3V2P A;  4U3F D;  1VQO P;  1Q90 D;  3CXH H;  4NPE A;  2KZI A;  3A5T A;  3H1H D;  3BRT B;  1N7S D;  1GU5 A;  4IFD K;  3GW6 A;  4Z1M H;  2FY8 A;  1JY3 P;  3BCC J;  2JO1 A;  4N78 E;  1J1D B;  1LP1 A;  1HJB A;  2ZYA A;  2GA1 A;  2P58 A;  3HUS C;  2O01 H;  2P7J A;  3OEH H;  1DEB A;  3H25 A;  1VQN P;  4OGQ B;  3VMY A;  3PH0 A;  1EDK A;  2K3R A;  3PTZ A;  1IFP A;  1KD1 Q;  2QM7 A;  3T97 B;  3TGU E;  2QIW A;  3RK3 C;  1RH5 B;  3AEF C;  1KYO H;  1SQX G;  3RL0 B;  3L71 E;  2W8Z A;  1YHQ P;  2KIK A;  4AYC A;  1QVF O;  1SQV D;  1DD3 A;  1M1J C;  3PHL A;  1PP9 G;  1JNM A;  1M56 D;  1H8E H;  4BXL A;  2E75 C;  3LID A;  2Q6Q A;  2WT7 A;  2RMZ A;  1LT9 B;  1NAY A;  2YKO A;  4UB6 E;  3WMM 0;  2ZFC A;  1SVF A;  3KYQ A;  1FOS E;  3CCS P;  1PV3 A;  1IFJ A;  1EZV G;  1P84 I;  2JP3 A;  1QL1 A;  3HE5 B;  3GHG B;  4L75 A;  2RQ7 A;  1L0L J;  2BCC E;  4I7Z B;  3SSU A;  4NPD A;  1PFI A;  1CZQ A;  3VN0 A;  1SQP K;  5GTI H;  2Q1K A;  2Z5I A;  4L76 A;  1SQB G;  1HGZ A;  2QA4 P;  1FS0 E;  2IBZ E;  3FXD A;  2D2C D;  1S4X A;  4XFJ A;  2LXB A;  3P8C E;  3K5B A;  1VQ5 P;  3Q5S A;  1VQM P;  2E42 A;  4C7N A;  1X0T A;  2V4H A;  1K73 Q;  3L72 G;  2OTJ P;  2FKW B;  3L37 A;  2WSC J;  2AXC A;  3ABV C;  2FYZ A;  5KLV E;  2R5B A;  4D6T G;  1FE6 A;  2AXT H;  1RQV A;  3L75 D;  2B89 A;  1SFC B;  5KLI B;  1A02 F;  1LTB C;  3H1L D;  3GF3 A;  5CCG D;  4WY4 D;  3VOP A;  5AVS B;  3CLQ A;  3Q2Y A;  1N73 B;  1L0L D;  3CPW O;  1BDD A;  3H1K J;  1KB9 D;  3W67 A;  1GD2 E;  2FYN B;  2KSJ A;  3FWN A;  4I2L C;  2NPS A;  4DJG A;  1S1C X;  1L4A D;  4WB4 A;  1GU4 A;  1VF5 D;  1IC2 A;  1ZP0 C;  5CCG A;  1GL2 B;  1R5L A;  3TGU J;  1VL2 A;  4BWN A;  1BGY G;  2YMY A;  4EYY Q;  1OIP A;  3CL3 D;  3L71 J;  3HE4 B;  1YBK A;  1T2K D;  3CX5 D;  4H13 D;  1NTK D;  2IPP A;  1YIT P;  2WPS A;  1MFT A;  2K88 A;  2WPQ A;  2FXP A;  3IN6 A;  3SWF A;  2W27 A;  3RK2 B;  1J1E C;  2RH0 A;  1MKM A;  3RL0 D;  2B87 B;  5AVY B;  3H1J J;  4DT0 A;  5AVV B;  2LKM A;  1EDL A;  1IK7 A;  1LJ2 A;  1AJY A;  1P84 E;  2NPS C;  2BCC J;  2RKL A;  1X22 A;  1ZRT E;  2QSI A;  1SQX E;  3E1I A;  2YMK A;  2WSF H;  2NZ2 A;  3TGU D;  2KNC B;  5CCG C;  2HOD A;  4PD4 H;  5H2F E;  1PP9 E;  5AVX B;  1YI2 P;  3HD7 B;  3C8V A;  1R8E A;  2PFX A;  2AEF A;  3U1A A;  5TIS H;  1BDC A;  2YNY A;  1CW5 A;  2V7Q H;  2XDJ A;  2W6A A;  1KB9 I;  2J5U A;  1EZV E;  3VP9 A;  1USE A;  1S9K D;  3BAT A;  4YPC A;  2K37 A;  4N3Y B;  2ZYD A;  3HE5 A;  3A0H E;  1D7M A;  5CHX A;  1SQB E;  3L73 G;  1J1D C;  3L74 G;  1KZU B;  1LTJ A;  4Y99 B;  1IFD A;  1NTZ K;  3CC7 P;  3H32 B;  1TU3 F;  4OGQ C;  4H0L B;  2W6J H;  2IBZ D;  3CX5 I;  1SFC D;  1N7S B;  3N7N A;  4H44 C;  3P8C D;  2R3C A;  3RL0 C;  5APW A;  4PV1 B;  2WTY A;  1RF1 A;  1JB0 J;  3AE8 C;  1E79 H;  3M9B A;  2DW3 A;  1M7L A;  2FYU D;  2PP6 A;  2XNX A;  1WMK A;  4W80 A;  1SQP G;  5K5G B;  1NYH A;  5EFW B;  4EIJ A;  1LT9 C;  5KLV D;  2ZVO B;  2ZXE B;  1EDI A;  5AW0 B;  3S9O A;  2A45 G;  1NO4 A;  2P1J A;  2W83 C;  3AEB C;  2HYN A;  2YXQ B;  4WBA A;  3GHG C;  1BE3 J;  2B9B A;  2IZ0 A;  3AED C;  2E76 D;  3GMA A;  1M90 Q;  3HTK B;  4JYB A;  5AVT B;  1IZN B;  1YJ9 P;  2KB7 P;  3RK2 D;  4M3L A;  2UWJ E;  1SQX J;  5AVQ B;  1GL2 A;  1SP4 A;  5FL7 H;  1FZC B;  4ZNC A;  1S5L X;  2WPR A;  3M9Q A;  3CCE P;  3VP8 A;  3HE4 A;  3BAS A;  1PP9 J;  1JO5 A;  2XU6 A;  5AVW B;  4AQR D;  4PJ0 H;  3U59 A;  2ZXX A;  3H1I G;  3MGN A;  1SFC C;  5KLI C;  3R4Y A;  2P10 A;  2L91 A;  2HR3 A;  1RF0 A;  1LT1 A;  3TNU B;  2A06 G;  2B87 A;  2OQQ A;  3JCU E;  1IFM A;  3P32 A;  1N73 C;  2IBZ I;  4UB8 H;  3CMA P;  3LW5 J;  3Q3D A;  3L70 J;  3G9R A;  2PGD A;  2Y9Z A;  1SS1 A;  3HD7 D;  2FYN C;  1SQB J;  3AEG C;  4ASU H;  2RN0 A;  1EXJ A;  1FJK A;  1KIL A;  1ZR4 A;  3SFD C;  1G2C A;  1RQU A;  1P84 D;  1ZRT D;  1MZ9 A;  1SQX D;  1K05 A;  3G4S P;  2KNC A;  4WY4 B;  1GL2 C;  3B8E B;  2PRR A;  2QJP B;  4YTP C;  1L0N K;  5KAI H;  3L72 J;  2H8P D;  1HGV A;  4BRY B;  1H89 A;  1PP9 D;  1QL2 A;  2K1A A;  3RBZ A;  4D6T J;  2CPB A;  2GM4 A;  1ZR2 A;  5BU8 B;  2YO2 A;  3A7O A;  1HF9 A;  1SQQ G;  1L4A B;  4H0L D;  1Q82 Q;  3D71 A;  2Z5H A;  3V6I A;  2C0X A;  1VF5 B;  2IYO A;  3RK2 C;  1NGM B;  3B5N A;  1RF0 C;  5B66 H;  1Y9B A;  5B5E H;  3V2N A;  2IFN A;  4ZKU A;  3IFM A;  2HG5 D;  4PV1 D;  4R4L A;  3V4Q A;  1URQ B;  3H1K E;  2P2U A;  2Z4E A;  3G6E P;  1YQ4 C;  1NJI Q;  1BE3 G;  1VQ7 P;  1NWQ A;  4OWF A;  3WU2 E;  1SQB D;  4H13 B;  2R32 A;  1AQ5 A;  1Y8A A;  3I55 P;  2XZR A;  1IK9 A;  5KKZ B;  3H32 A;  1KIL C;  1PL5 A;  1S3J A;  5APS A;  3OFN H;  1N7S A;  2AEM A;  1OVV A;  1Q2N A;  3IAO A;  1BGY J;  3OAA H;  4LC1 A;  1QVG O;  1SQP E;  2WSE J;  2JR8 A;  3CWB G;  2YIU B;  2KK7 A;  3D70 A;  1XTC C;  5DN6 I;  1NTM G;  3HD7 C;  1CI6 B;  2QEX P;  1HVV A;  2YKQ A;  1NTZ G;  1FZB A;  3PLN A;  3TSI A;  3KZI H;  1JTH B;  4IL6 H;  3GF7 A;  3VMZ A;  3FXE A;  5APQ A;  3B5N C;  1DH3 A;  1N2D C;  2MJZ A;  5KJ7 D;  3H1J E;  2KSE A;  3CC4 P;  1L0N J;  2R44 A;  3ITK A;  1X79 B;  3BCC D;  2QJK B;  1JMB A;  1LNQ A;  4U3F G;  3L70 G;  2KLU A;  1OXZ A;  3C9I A;  3NMD A;  5AW1 B;  4Y99 C;  3CCJ P;  2OYH B;  3B71 A;  2WQY C;  1KQF B;  2FFD B;  1JEK A;  2GUS A;  2M5A B;  4HH2 A;  1N7S C;  1H0T A;  5AVZ B;  4PV1 C;  3CME P;  5AW7 B;  1FZC A;  1EZV I;  1FAV A;  2QVA A;  1XTG B;  3SWY A;  3NXS A;  4EI2 A;  1IFN A;  3H1I E;  5APV A;  4K35 A;  2BEZ F;  2A06 E;  1GZL A;  1KV4 A;  4XA4 A;  1LWU B;  1NVO A;  1HUC A;  3A0B E;  3IF4 A;  3TNU A;  3L35 A;  1RY3 A;  1AFO A;  2J59 M;  4N6J A;  3QWO C;  3L73 J;  2CK3 H;  5CJ4 A;  3L74 J;  2KS1 B;  5GTH H;  3JSV C;  2WZ7 A;  2Q9I A;  1QX8 A;  4W7Z A;  5DJU B;  4KJM A;  2ZAE B;  1NU1 K;  4WWI A;  3S1K A;  3SWK A;  4WY4 A;  1FZE A;  3U1C A;  4HB1 A;  1FZC C;  1Q7Y Q;  1URQ D;  3V5B A;  1HTL C;  1PPJ G;  2E76 B;  1PGO A;  1JM0 A;  3OE7 H;  1SQP J;  3A3Y B;  1DEE G;  5KAF H;  1KB9 H;  3Q1M A;  2D2C C;  2ZT9 B;  1L4A A;  2WMM A;  2ZYG A;  1M1K Q;  2IDB A;  5E79 E;  4ASV A;  1JY2 O;  1YQ3 C;  1FDO A;  1BE3 E;  4O9B A;  1L0N G;  5AW8 B;  3GG2 A;  3H1K D;  2M3E A;  3AE2 C;  2C9N Y;  1YJW P;  2VRS A;  3RK3 E;  1NHL A;  3L75 G;  2Q7C A;  4N78 D;  2FXO A;  2WSC H;  4CPG A;  3CCL P;  3R2P A;  2H89 C;  1YJN P;  3H1L G;  1OW6 A;  1GW4 A;  1SQQ K;  3CX5 H;  3KHU A;  1WT6 A;  3T97 A;  2WPV B;  4R4M A;  3CXH E;  5CBO A;  3GLM A;  3CWB E;  2C9L Y;  3PP5 A;  4WY4 C;  2O01 N;  1X8Y A;  2QJP C;  3CCM P;  4MN4 C;  3AE6 C;  4EDF A;  3L71 D;  2NRG A;  1NTZ E;  1SQP D;  1HJ0 A;  2HPC B;  3M0D A;  4IL6 X;  1KFN A;  3VTP C;  2K9Y A;  1LT9 A;  4EOT A;  1L4A C;  3H1I J;  1PGQ A;  2I1K A;  1BSH A;  1G1J A;  1VF5 C;  2FBW C;  3TF5 A;  3RL0 g;  1KQG B;  1M57 D;  5AW2 B;  4DCK A;  1RE4 C;  3EQ2 A;  1M1J B;  5APU A;  3MP7 B;  5C39 A;  1KQL A;  1JY3 O;  3L70 E;  1URQ C;  1ZV8 A;  3H1J D;  4GOD A;  1KYO E;  1OFC X;  3GHG A;  1NTK G;  1Y47 A;  1NTM K;  3BRV B;  1T2K C;  2R3S A;  4H13 C;  2WWW A;  3M91 A;  2BCC D;  1N8R Q;  2IYP A;  4I1L A;  1NOH A;  4XE5 B;  5APX A;  4HYT B;  2H88 C;  1FZG A;  3A2A A;  1FOS F;  3TYY A;  2M5A A;  3L72 E;  1MFZ A;  4UB6 H;  2N1T D;  1K8A Q;  4D6T E;  1R5S A;  3SFE C;  2Y0D A;  2G8Y A;  2I1J A;  1NAF A;  3M0D C;  5GTI E;  3H1I D;  4IFF A;  2AEJ A;  1IJD B;  1SQQ J;  3G3Z A;  2YO3 A;  4PD4 I;  3IR9 A;  4C7R A;  1SFC A;  3VYI A;  2A06 D;  4OH8 B;  1LWU A;  1QGK B;  1JCD A;  4ZKP A;  1T8Z A;  1N73 A;  2QJK C;  1QLE D;  2FXM A;  2KS1 A;  3V2Q A;  2B88 A;  4I7Z C;  1OMI A;  1DX7 A;  1JY2 N;  1EQ7 A;  5CCH D;  5APT A;  1BGY E;  4GDO A;  4YXW H;  2ZT9 D;  2AXT E;  2KXP B;  1HBW A;  1PPJ E;  1ZME C;  1SQV K;  4U7J A;  1FZA A;  3M9H A;  3O6Q B;  3CWB J;  1OX3 A;  2A45 I;  1PGP A;  1NTM J;  4GOE A;  3AE1 C;  1UII A;  1NTZ J;  3OAK A;  1FC2 C;  1CSB A;  3G71 P;  1GK6 A;  3KDP B;  3AE3 C;  1EC5 A;  1L0N E;  1NU1 G;  2O01 J;  1LWU C;  1AVY A;  2FYU G;  1AQT A;  1LGH B;  1KFM A;  3NTN A;  2YXR B;  1BE3 D;  1OW8 A;  1YTZ T;  1GW3 A;  1H8A A;  2KI7 B;  4U3F J;  3H1L E;  1FU1 A;  5KLV G;  1ZOY C;  3RK3 D;  1S5L E;  3AEC C;  4GOF A;  1JY3 N;  1W2E A;  5AVR B;  2N9B A;  2H7H A;  3MUD A;  3I5C A;  2M3B A;  3CWB D;  4Y28 J;  2PAJ A;  3O8Z A;  2XOK H;  3AE7 C;  1LTA C;  2NPS B;  4DZO A;  1AVO A;  2E75 D;  1MV8 A;  1KC8 Q;  5KTB A;  2E76 C;  1YIJ P;  3ZDM A;  2L5G B;  3HD7 A;  2HPC A;  1NTZ D;  3OW2 O;  3V2R A;  3CD6 P;  2ZT9 C;  1LTT C;  1W2B O;  4B86 A;  2Y0E A;  3OJA B;  1EZV D;  2KYV A;  2QRX A;  1L0L K;  3L73 E;  1P84 H;  3L74 E;  2W90 A;  3P8M C;  3CCV P;  3H6P A;  4PD4 E;  3L70 D;  2QE7 H;  3MD0 A;  1KYO D;  4IFM A;  1J2J B;  3KXD A;  4JQ0 D;  2J58 A;  5H2F H;  4LLH A;  2GUV A;  2M0B A;  5CJ0 A;  5TIS E;  2IFM A;  3MUD C;  2JJL A;  3RGU A;  5M1B A;  1ZN5 A;  4GT1 A;  3L36 A;  1BCC G;  1HH0 A;  3L72 D;  5BVZ A;  3D6Z A;  2E43 A;  1AA0 A;  3AEE C;  2ZJS E;  4C46 A;  1NTK K;  4D6T D;  3LW5 H;  4H44 B;  2OTK E;  2HOD B;  3WUV A;  1S2E A;  2KZJ A;  4TT3 H;  3A0H H;  2KP8 A;  3EFG A;  1JUN A;  1RE3 A;  1H88 A;  1A02 J;  1FJP A;  3MHV A;  3AE9 C;  2E5T A;  1UIX A;  4I6M C;  1U7J A;  2XV5 A;  1S9K E;  3CXH I;  2BAS A;  5AW6 B;  3L75 J;  1T3U A;  3HTK A;  1X9V A;  3V4W A;  3H1L J;  3H1H G;  4H0L C;  1K04 A;  2WSS H;  2OYI B;  4JBZ A;  4KHX A;  2QJY B;  1BGY D;  2OAR A;  5KJ7 A;  1LTJ B;  4TLF A;  1PPJ D;  3CCR P;  3O6Q A;  2G3A A;  3W68 A;  2BEQ D;  3D6Y A;  1VQL P;  1NKN A;  4W7Y A;  2Q5U A;  2CPS A;  2K9J B;  1T3J A;  1NU1 E;  1ZLL A;  1RF1 B;  2FYU E;  3VMX A;  2R5D A;  1KYO I;  2YKP A;  1RE3 C;  4ASW A;  2KOG A;  2O1J A;  2OGU A;  1L2P A;  1QEX A;  4JPZ B;  1OZH A;  1L0N D;  1SQV G;  2POH A;  1NH4 A;  4DOJ A;  2N1T B;  4JYC A;  1NTK J;  3S4R A;  1PIX A;  2NPS D;  2WIT A;  2JDI H;  2WSF J;  2WSE H;  1MUU A;  2E74 B;  2M8R A;  2E5Y A;  2Q3I A;  3L4F A;  2XND H;  2HFE D;  4PJ0 E;  2JEE A;  1DD4 A;  1GDT A;  3BCC G;  5L8R J;  5KJ7 C;  2FYU K;  1U7M A;  2LR2 A;  3MZW B;  4L74 A;  1LTG C;  2V7Q J;  2RQ6 A;  1AV1 A;  1ZW0 A;  1JOC A;  4BRY A;  2XKM A;  3FWL A;  2C0W A;  4UB8 E;  5KLV K;  1N7L A;  1SQQ E;  3JCU H;  3AEA C;  3M06 A;  2IZ1 A;  1NKZ B;  2LXC B;  2JWA A;  2W6B A;  1OVR A;  1S5L H;  5BU5 A;  1RE4 A;  2IX7 C;  1KMI Z;  1KIL E;  1URQ A;  3L73 D;  1VPC A;  2MKV A;  1PZQ A;  3L74 D;  2HLO A;  4OGQ D;  3NFQ A;  5KAI E;  4PD4 D;  4OVN F;  2QG4 A;  1VDF A;  1VQ9 P;  1PGJ A;  4H44 D;  3CC2 P;  1LTI C;  3QH9 A;  4YXD C;  3E1R A;  1BCC E;  1JCC A;  4JF7 A;  3TDK A;  1L0L G;  1Q86 Q;  3HUS B;  1NTM E;  5B66 E;  1IO4 A;  5B5E E;  1KIL B;  1G2C B;  1CI6 A;  3RK3 B;  4RES B;  3KPE A;  2KUB A;  3JC2 2;  1LTS C;  3EFF K;  3Q5R A;  1JTH A;  1JMM A;  1NU1 J;  3WU2 H;  2OTL P;  2FYU J;  2QM8 A;  5CMZ A;  4U3F E;  2E75 B;  4A7P A;  3H1H E;  5KLV J;  2I8D A;  4KT0 J;  2ITA A;  3B5N B;  3EWK A;  1G1I A;  2OYH A;  3KQG A;  3RBX A;  1SQX K;  3VMA A;  5KKZ C;  1DIP A;  3F5H A;  2O3J A;  1RHZ B;  3OA7 A;  2FFD A;  1Q81 Q;  2OYI A;  3KZI E;  1LP1 B;  4IL6 E;  1OVU A;  1Z56 A;  3H1K G;  2SPZ A;  5CBN A;  1EXI A;  3FKS H;  2A45 H;  2Y0C A;  2YIU C;  4RO0 A;  3LIE A;  2E74 D;  1VQP P;  1OW7 A;  3F89 A;  1WRG A;  2K9J A;  3TGU G;  1NU1 D;  1OWA A;  1SQV E;  3UIA A;  5AW3 B;  5AW4 B;  2N9Y B;  4GKG A;  4HJG H;  3MTU E;  2Q3E A;  1S72 P;  3FX0 A;  1HWT C;  2JKV A;  3L71 G;  4RJT A;  1EDJ A;  1USD A;  3M0A A;  4WVZ A;  1KOR A;  5AVU B;  3WUT A;  2N1T A;  3P7K A;  1SQB K;  3WUU A;  2WT7 B;  3AE5 C;  4HKZ H;  1T6A A;  2OYH C;  4GIF A;  1M8O B;  1VQ4 P;  3BCC E;  1GL2 D;  3FGA D;  1GK4 A;  2FFD C;  2WVR A;  2OYI C;  2QJY C;  3H1J G;  1LTJ C;  1ZXG A;  4AUW A;  1BCC J;  3CCU P;  4IOI H;  3AE4 C;  2BCC G;  3A0B H;  3C1L A;  5GTH E;  1H0T B;  1YYC A;  1KN7 A;  2IBZ G;  1SQQ D;  1RF1 C;  5APY A;  5CCH A;  4C7N B;  2ZVN B;  3Q5P A;  1BSN A;  1K9M Q;  1SLQ A;  2N1T C;  3L75 E;  2D2C B;  1KIL D;  1IFI A;  4K3A A;  1FBM A;  2E74 C;  2OYO A;  2Y9Y A;  4LGD E;  2P67 A;  1J1E B;  1JY2 P;  1VQ6 P;  3H1H J;  5AW5 B;  1L0L E;  5TJH A;  5KAF E;  1FDM A;  4NPF X;  3I56 P;  1KB9 E;  3N4X A;  1W5C E;  1KTM A;  3CCQ P;  1BCC D;  2HLD H;  3PRJ A;  3CXH D;  5AW9 B;  3HUS A;  3B4S A;  1VQ8 P;  3BVH A;  1NTM D;  1GMJ A;  5E79 H;  1VQK P;  3USS A;  3E7K A;  1FZF A;  4L73 A;  3MIW A;  1E5W A;  1FDI A;  5DJT B; 
#chains in the Genus database with same CATH homology
 2CK3 H;  2JDI H;  2QE7 H;  2V7Q H;  3OAA H;  2HLD H;  2RQ7 A;  4TLF A;  3EFF K;  1E79 H;  5FL7 H;  3OEH H;  2E5Y A;  1BSH A;  2RQ6 A;  2XOK H;  3FKS H;  4ASU H;  1BSN A;  2E5T A;  1FS0 E;  4DJG A;  3USS A;  5DN6 I;  1IFP A;  4WVZ A;  4QMA A;  3PJS K;  3OE7 H;  2W6J H;  1JEK A;  2XND H;  1AQT A;  4YXW H;  3OFN H;  1H8E H;  2WSS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...