1AQTA

Epsilon subunit of f1f0-atp synthase from escherichia coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE
publication title Crystal structure of the epsilon subunit of the proton-translocating ATP synthase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1aqtA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1aqtA01
2QE7H 1FS0E 2XNDH 2E5YA 1AQTA 2HLDH 3PJSK 2RQ6A 2V7QH 1BSNA 4WVZA 2JDIH 4ASUH 2WSSH 4TLFA 3OFNH 5FL7H 2XOKH 1JEKA 3OEHH 4QMAA 3FKSH 1E79H 3OAAH 4DJGA 1BSHA 1H8EH 3OE7H 2RQ7A 5DN6I 1IFPA 3EFFK 3USSA 2CK3H 2E5TA 2W6JH 4YXWH
chains in the Genus database with same CATH superfamily
2M5AB 4H44B 3RK3E 3G3ZA 1AV1A 1S5LE 2FXOA 2OGUA 4XE5B 2YNYA 2E74B 2XKMA 5AW2B 2XV5A 4HB1A 1USDA 3QH9A 1BCCJ 5DJTB 1S9KE 4TT3H 1L0LD 1AFOA 1K9MQ 1MUUA 1YJNP 1YJWP 3O8ZA 2QJPC 1Q81Q 4IFMA 5M1BA 1L0NG 3MGNA 1JEKA 4IFDK 2Q3EA 2QJPB 2WPVB 2N1TD 3GHGA 1SQBK 3SSUA 2C9NY 2ZT9D 1CI6A 1S4XA 1HJ0A 1DD4A 5KTBA 3CCEP 2K88A 3JSVC 2NPSC 3FXDA 4W7ZA 3NXSA 2NPSB 2HG5D 4OGQD 2WSFJ 2POHA 4H44D 3WUVA 3KPEA 3L70E 2E74D 1SQVK 5E79E 1WRGA 5AW6B 2OYHC 1SQQG 3JCUH 1PGJA 2W6BA 4YTPC 2O01J 2P7JA 2E76C 3I5CA 2KNCA 2OYHB 2XNXA 4DCKA 1J1DC 2KI7B 2E76B 3SWFA 2A45G 1OW7A 1X8YA 4GT1A 4QMAA 3S1KA 1J1DB 2ITAA 2NRGA 2LKMA 3L72J 3RL0g 3AEAC 3USSA 2FYUK 1PP9D 1H0TB 2IDBA 3L36A 4IL6H 4DZOA 2IBZD 5GTIH 3CMAP 1JTHB 2WZ7A 1NU1K 1QX8A 2N9YB 2KS1A 2NPSD 3C9IA 1RHZB 1YI2P 2ZFCA 3FX0A 3H1HE 3VN0A 1KQLA 1NTZD 1RQUA 1EDLA 2L5GB 1Q7YQ 1URQA 1YTZT 2Z4EA 1HTLC 3M9HA 1N8RQ 1LTSC 2A06G 4C7RA 1BGYE 1VQ8P 1NKNA 4KHXA 3GMAA 4JPZB 2E76D 1PGOA 2DW3A 1ZRTE 1Z56A 3FKSH 1IFDA 5AW5B 2OYIC 2XDJA 3A0HH 2QEXP 1A02J 3H1KJ 3M0AA 4U3FE 3MUDA 2OYIB 1AJYA 3L74D 4L73A 3LIEA 3M91A 3QWOC 1FDMA 1EDIA 3H32B 1SQBG 1M8OB 2WPRA 3TF5A 3AEDC 4PD4H 5AW3B 3L73E 1S3JA 3CWBD 3PLNA 3U1AA 3OA7A 4N78D 1BSNA 3CC2P 3PHLA 2V7QJ 1N7SC 1IK9A 1SQPD 1NTKE 2PGDA 1N7SB 1XTCC 2Y9YA 4LGDE 4MN4C 2A45I 2E75C 3RBXA 5AVUB 2P1JA 1EXJA 3HUSC 2JDIH 2E75B 1SQXJ 3HUSB 1NAYA 1RH5B 2YKQA 3D6YA 4RO0A 3OE7H 1KB9D 3TGUD 4EI2A 3H1LJ 2GUVA 2WMMA 1KV4A 3G4SP 3PH0A 3VMYA 3I55P 1ZMEC 4CPGA 1JY2O 4UB8E 3SFDC 3V2RA 3LW5H 2XOKH 1KQSO 1Q82Q 2C0XA 4W7YA 4Z1MH 3OAKA 5KLIC 1SFCA 1ZXGA 1RF0C 1VQ6P 3Q2YA 1AQTA 5KLIB 1S2EA 3PTZA 1RE3A 1L0ND 1NU1G 2I1JA 2Z5IA 3CCSP 1SQPK 1FOSF 2L91A 1N7SD 3CXHH 2H43A 4ASUH 2E75D 2AXTH 3C8VA 2QVAA 2WSCJ 4HH2A 1Y47A 3WMM0 3MTUE 1QLED 2K9JB 1YYCA 3BRVB 1SQQE 4TLFA 5BVZA 5AW7B 1PGPA 3L72E 1X22A 3K5BA 3CCVP 2KLVA 4RESB 1E5WA 1PP9G 2KZJA 1CZQA 1JO5A 1L4AA 1OXZA 1JY3N 2E5YA 2XNDH 2YO3A 1T8ZA 2R3CA 3S9OA 4WY4A 1Y8AA 1M57D 3CCUP 3BCCE 1MZ9A 2P58A 2R3SA 2YKOA 1RE4A 1G2CA 4R4MA 2YMYA 1HBWA 1D7MA 3MIWA 1LTAC 3OW2O 3GHGC 2FBWC 3WUTA 4A7PA 5FL7H 2QSIA 2OYOA 3GHGB 3P8CE 2BCCG 1KYOE 4WWIA 1H8EH 2AXCA 1CI6B 3IAOA 2ZAEB 3O6QA 2H88C 5GTHH 1T2KC 3AE4C 5AVWB 4O9BA 3CL3D 1YTZI 3E7KA 2YIUC 3L75D 3H1HJ 1KORA 3HTKA 4N3YB 3KZIE 2A06E 4JF7A 2YIUB 1DD3A 2Y0DA 1FBMA 1GL2A 2ZVNB 4ZMDA 1HF9A 3IFMA 1QL2A 1GU4A 1JNMA 3CD6P 4UB6E 1BGYJ 3OEHH 2FYZA 1WT6A 3L37A 2H7HA 2WSEJ 1DX7A 2KNCB 1JM0A 3CWBG 2CPBA 2QE7H 2HLDH 4U3FJ 3JC22 1NTME 2IFNA 2WPSA 1SQPG 5KAFE 1N86A 5KLVJ 2IZ0A 1SQBD 3M9QA 3H1JD 1FZEA 5DN6I 3CXHI 1KFNA 4L76A 1IK7A 3EQ2A 3H1ID 3I56P 3L73J 1L2PA 1CSBA 1LP1A 1IFIA 1HVVA 3OJAB 3AE6C 1KN7A 1T2KD 2GUSA 2KB7P 1LTGC 3HE4A 2KS1B 4AYCA 5CCGA 3HRNA 1RF1C 4EOTA 3R4YA 4PD4D 1KILE 1YQ3C 1M1KQ 2R5DA 1URQC 1K8AQ 1RF1B 1SQVD 1L0LE 1JY2P 2I1KA 3L71E 1URQB 2JKVA 1BCCG 1YBKA 3SWYA 3VMXA 3WU2H 1VQ7P 2Q9IA 3MUDC 4IFFA 1SLQA 1FZFA 5C39A 1NWQA 1G1IA 5KJ7A 2FYUD 4BXLA 3CC7P 1LGHB 1W2EA 3NTNA 2UWJE 2ZYAA 3P8MC 5B5EH 1Q2NA 5AVSB 2WPQA 2QM7A 5AVVB 3OFNH 1NU1D 5BU5A 2O01H 3CI9A 4ZKUA 2W27A 3GW6A 2FXPA 4Y99C 1W5CE 2O1JA 3PJSK 1AQ5A 3KHUA 5L8RJ 4Y99B 3AE7C 4PJ0E 3VYIA 1FZAA 1KZUB 5APTA 3VMZA 1URQD 1SQXK 1MFTA 2YMKA 4NPEA 1GU5A 5H2FE 1ZP0C 4C46A 3CXHD 1VQMP 1SQQJ 1E79H 1PP9E 1KILA 3CX5H 2JP3A 1LTBC 3L70D 2IBZE 1H88A 3G6EP 2R32A 4N6JA 3ABVC 1ZR4A 1U7MA 1GK4A 2QA4P 1SFCC 1LTJA 2FY8A 2WITA 1KB9I 1JB0J 2Y0EA 2KSEA 2ZXXA 1GMJA 1SFCB 2P2UA 1RE3C 2LXBA 3V2NA 1NO4A 3BCCJ 3EFFK 1NTZE 1P84H 3P7KA 1BE3D 5CCHC 2BEQD 4H0LC 2IYPA 1PIXA 1GZLA 3V2PA 1HWTC 1FE6A 3L75G 3EFGA 2OTKE 2BCCD 4H0LB 1PPJD 5B66H 3CCJP 1M56D 2Y9ZA 1QVGO 1YHQP 1UIIA 2PAJA 1FJPA 5APVA 4RJTA 2QJKC 2IPPA 1VQ4P 3L74E 1JCCA 3CMEP 3G9RA 1M90Q 2JR8A 4GIFA 2QJKB 3M0DA 1NKZB 4BWNA 1G1JA 5KLVE 3GLMA 3FWLA 3IR9A 5AW4B 3CWBE 2XZRA 1L4AC 2J5UA 1SFCD 3H1JG 5AVYB 3BRTB 5TISH 2CK3H 4WY4C 1L4AB 3H1IG 1SQPE 1RE4C 4WY4B 1TU3F 1NTMJ 2C0WA 1LNQA 1M1JA 3W67A 1IC2A 5CCHD 4GODA 2ZXEB 1G2CB 1NVOA 4H0LD 1IO4A 4I2LC 1H89A 4YXWH 1VF5C 2V4HA 5KAIH 1FDOA 4D6TD 1RQVA 2K9YA 5AVQB 1OX3A 1S5LH 1VF5B 1KB9E 1SQVG 3TGUE 1K05A 1W2BO 2WWWA 2HPCA 3A0BE 3O6QB 2OARA 1NTKD 3HD7A 2KLUA 1SVFA 1MFZA 3E1IA 5APQA 3HTKB 2FFDA 1GL2C 1K04A 2B87A 2QIWA 3Q3DA 1L0LJ 1BCCD 1GL2B 2FYUG 3L71J 1L0NE 3CCRP 1L4AD 3KQGA 2RQ6A 3SWKA 1PV3A 4WY4D 2WSCH 4ZNCA 1CW5A 1WMKA 4JYBA 3IF4A 2LXCB 4WB4A 3A3YB 4JQ0D 2AEMA 1ZLLA 2PRRA 1GK6A 1VQLP 1IZNB 3AEEC 1FOSE 2B88A 1VF5D 1XTGB 3TSIA 3LW5J 5E79H 4DT0A 1N73A 1LP1B 2QG4A 2J59M 1U57A 1VPCA 1NTKK 3L4FA 3TK1A 1FS0E 2JJLA 5H2FH 5CCGC 1NH4A 2HR3A 3HE4B 2WQYC 3B8EB 2M3BA 2KXPB 3M9BA 4OWFA 3BATA 3L70G 1GL2D 1JOCA 3Q1MA 1KFMA 1NJIQ 2WT7A 1FZCA 3II6A 5BU8B 3GG2A 4I7ZC 5AW0B 1QGKB 2BASA 3JCUE 3RGUA 3V5BA 4PD4I 4AUWA 3MD0A 5AW8B 2YXQB 5APYA 4I7ZB 3AEBC 3ZDMA 1PP9J 2PP6A 1T3UA 3L72D 4C7NA 3M06A 4H13C 1BE3G 4IL6X 4YXDC 5KJ7C 1J1EC 1FZBA 4K35A 3Q5RA 4H13B 1J1EB 3VTPC 1YITP 1PPJG 1VQ5P 3RL0C 2P67A 2RQ7A 2E5TA 2RN0A 3WUUA 3CX5D 1NHLA 3D6ZA 4IL6E 1SP4A 3RL0B 1NTZJ 5APSA 1EZVD 2W6AA 3FXEA 3Q5SA 2K1AA 2XU6A 2WSEH 1GTWA 2B9BA 4LC1A 5CCGD 1KC8Q 1JY2N 4U7JA 3R2PA 2O01N 1IFNA 1KYOD 1A02F 1VDFA 1HUCA 1PL5A 1IFJA 1LT9A 1JMMA 1P84D 2VRSA 1KMIZ 5AW1B 2R44A 3GF3A 1JMBA 1SQQK 3U1CA 3H1KD 2Q7CA 1Q90D 3L74J 3FGAD 1KILC 3RK3C 1RY3A 3KYQA 4U3FG 1SQBE 3KDPB 2WSSH 2PFXA 3E1RA 5AW9B 3H1JE 3VP8A 1KILB 4H13D 3RK3B 3VOPA 1OVVA 3A0HE 1YJ9P 5KJ7D 3H1IE 2NZ2A 3RK2C 3CWBJ 1LTJC 5K5GB 3A5TA 2H89C 1KQGB 2FKWB 5AVRB 1DEBA 1GD2E 2MJZA 4D6TG 3RK2B 1NGMB 1LTJB 3RL0D 4GOEA 1ZOYC 1SQPJ 5AVTB 1NTMD 1OMIA 4PD4E 3IN6A 2RH0A 1BDDA 1NTKG 4L75A 1SQVE 3S4RA 2IYOA 4UB8H 1S5LX 2JWAA 3CPWO 3TGUJ 1SQXD 4NPDA 1QVFO 2FXMA 3H1LD 3B71A 1KTMA 1VQ9P 1HJBA 2YXRB 2FYUE 2G3AA 1KILD 3RK3D 2E42A 3H25A 3M0DC 1OZHA 3ITKA 3A2AA 1QEXA 3VMAA 2WSFH 1LT1A 3L71D 2W6JH 1X9VA 1DH3A 1NU1E 3CCLP 2M3EA 2GA1A 1S9KD 3RK2D 2KIKA 1L0NJ 3LIDA 3FWNA 5CHXA 2JWDA 3T97A 1VQKP 3H6PA 1HH0A 2O1KA 1NTMK 4WBAA 2R5BA 5AVXB 4OVNF 1JCDA 1M1JC 1AA0A 2GM4A 4AQRD 2AEFA 2Q3IA 1VQOP 1M1JB 3AE8C 4LLHA 1LWUA 3U59A 3B5NA 2RMZA 3TNUA 1SS1A 4BRYA 2HODA 5DJUB 3CXHE 1FAVA 2HFED 2A45H 1LTIC 2JEEA 2B89A 1T6AA 1DEEG 3HD7C 2AXTE 3UIAA 2HPCB 2Z5HA 1MV8A 3HD7B 4HJGH 2FFDC 1S72P 3L72G 1L0LK 2WVRA 4GKGA 1S1CX 2KYVA 1T3JA 2FFDB 2B87B 1KD1Q 2N9BA 2I8DA 2C9LY 3P32A 3CLQA 1KYOH 2IFMA 1BE3E 3CCQP 1BSHA 3CCMP 2N1TA 5CMZA 3D71A 3BCCG 3PP5A 2ZYDA 3BVHA 2BCCE 1FJKA 1EZVG 1PPJE 3AE9C 4NPFX 1K73Q 1J2JB 2H8PD 2QM8A 1OFCX 1AVYA 3AE5C 3KZIH 3TDKA 3HE5A 3MP7B 1UIXA 1MKMA 2M5AA 3L75J 4UB6H 3AE3C 1N73C 1OVUA 4ZKPA 3MHVA 1RF1A 4EDFA 2Y0CA 3AEFC 3H1HD 4PV1C 1PGQA 1N73B 2RKLA 3HD7D 3H1KG 1NAFA 2CPSA 1HGVA 2KUBA 5GTHE 3NMDA 4XA4A 1JUNA 2IX7C 4PV1B 4DOJA 2OQQA 1QL1A 2V7QH 1EDKA 2W83C 2ZJSE 1FZCC 1PFIA 3N4XA 1NOHA 1BGYD 3Q5PA 4I1LA 5KAFH 2IZ1A 1YIJP 2WT7B 1FZCB 1ZRTD 1VL2A 4N78E 2KSJA 2K3RA 2P10A 3EWKA 4M3LA 4U3FD 1NTMG 1JY3O 1SQBJ 4IOIH 1Q86Q 3H1JJ 3G71P 4D6TE 1USEA 2M0BA 5KLVD 4C7NB 3H1IJ 4K3AA 2NPSA 5APXA 4XFJA 5CJ4A 4WVZA 3L73D 2MKVA 2Q1KA 1R8EA 3AECC 1NTZK 1R5LA 1SQXG 2WTYA 1LTTC 3H1LG 1EQ7A 4PV1D 2ZVOB 2D2CC 2Q6QA 2OYHA 3W68A 1SQVJ 1YQ4C 1GW4A 1BCCE 2ZYGA 2D2CB 4I6MC 1FDIA 3CX5I 1LT9C 1L0LG 1EZVI 3L71G 2KZIA 5EFWB 3AEGC 1LT9B 2OTJP 1H0TA 2KK7A 1JTHA 1KYOI 4DJGA 2W90A 2FYUJ 4GDOA 2BEZF 1ZR2A 1IFPA 5KLVK 2J58A 2JO1A 1P84I 1ZV8A 3WU2E 1VQNP 1FC2C 1NU1J 1DIPA 3V2QA 4PJ0H 3AE2C 1OIPA 5CCHA 2Q5UA 2FYNC 1N7LA 1ZW0A 2FYNB 5B5EE 1AVOA 2KP8A 2QJYC 1U7JA 2D2CD 1ZN5A 1FZGA 2QJYB 1N2DC 3RBZA 4B86A 2OYIA 2YO2A 1IJDB 3D70A 2YKPA 3B4SA 1VQPP 3L70J 1FU1A 4KJMA 1SQQD 3H32A 1H8AA 4ASVA 5CBOA 1EC5A 5AVZB 4Y28J 2IBZG 4HKZH 1HGZA 1GDTA 1NYHA 1L0NK 1OW8A 1X79B 3V4WA 3CX5E 1EDJA 4GOFA 1R5SA 1EZVE 1BE3J 1N7SA 2K37A 2KOGA 3BCCD 3N7NA 3F5HA 3L75E 5KKZC 5GTIE 3T97B 1NTZG 2O3JA 3L35A 3V6IA 1OWAA 2W8ZA 1KQFB 3MZWB 5APUA 2BCCJ 5KKZB 3H1HG 3HUSA 4YPCA 4KT0J 1P84E 3P8CD 1LWUC 2LR2A 3TYYA 3B5NC 2QRXA 3VP9A 1PZQA 1Y9BA 1LWUB 3CC4P 1BDCA 4JYCA 4RKUJ 3B5NB 3H1KE 1BGYG 4ASWA 3TNUB 5B66E 3A7OA 2HYNA 4BRYB 4EYYQ 2HODB 3L74G 2A06D 5TJHA 2M8RA 1LJ2A 4HYTB 4L74A 1OVRA 4JBZA 1RF0A 3OAAH 4OH8B 3KXDA 3F89A 5KLVG 3PRJA 5CBNA 2OTLP 1JY3P 3NFQA 5APWA 3C1LA 1M7LA 2G8YA 3SFEC 1X0TA 3L73G 2N1TC 2AEJA 3AE1C 1KB9H 4EIJA 2ZT9C 1IFMA 2N1TB 2HLOA 3A0BH 2SPZA 5TISE 2ZT9B 1EXIA 4D6TJ 1OW6A 3BASA 3GF7A 4W80A 2K9JA 1SQXE 5CJ0A 3V4QA 1GW3A 3B5ND 4OGQC 2E43A 3H1LE 4H44C 3TGUG 2IBZI 1NTKJ 3HE5B 4R4LA 4OGQB 5KAIE 2E74C
chains in the Genus database with same CATH topology
2QE7H 1FS0E 2XNDH 2E5YA 1AQTA 2HLDH 3PJSK 2RQ6A 2V7QH 1BSNA 4WVZA 2JDIH 4ASUH 2WSSH 4TLFA 3OFNH 5FL7H 2XOKH 1JEKA 3OEHH 4QMAA 3FKSH 1E79H 3OAAH 4DJGA 1BSHA 1H8EH 3OE7H 2RQ7A 5DN6I 1IFPA 3EFFK 3USSA 2CK3H 2E5TA 2W6JH 4YXWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QE7 H;  1FS0 E;  2XND H;  2E5Y A;  1AQT A;  2HLD H;  3PJS K;  2RQ6 A;  2V7Q H;  1BSN A;  4WVZ A;  2JDI H;  4ASU H;  2WSS H;  4TLF A;  3OFN H;  5FL7 H;  2XOK H;  1JEK A;  3OEH H;  4QMA A;  3FKS H;  1E79 H;  3OAA H;  4DJG A;  1BSH A;  1H8E H;  3OE7 H;  2RQ7 A;  5DN6 I;  1IFP A;  3EFF K;  3USS A;  2CK3 H;  2E5T A;  2W6J H;  4YXW H; 
#chains in the Genus database with same CATH topology
 2M5A B;  4H44 B;  3RK3 E;  3G3Z A;  1AV1 A;  1S5L E;  2FXO A;  2OGU A;  4XE5 B;  2YNY A;  2E74 B;  2XKM A;  5AW2 B;  2XV5 A;  4HB1 A;  1USD A;  3QH9 A;  1BCC J;  5DJT B;  1S9K E;  4TT3 H;  1L0L D;  1AFO A;  1K9M Q;  1MUU A;  1YJN P;  1YJW P;  3O8Z A;  2QJP C;  1Q81 Q;  4IFM A;  5M1B A;  1L0N G;  3MGN A;  1JEK A;  4IFD K;  2Q3E A;  2QJP B;  2WPV B;  2N1T D;  3GHG A;  1SQB K;  3SSU A;  2C9N Y;  2ZT9 D;  1CI6 A;  1S4X A;  1HJ0 A;  1DD4 A;  5KTB A;  3CCE P;  2K88 A;  3JSV C;  2NPS C;  3FXD A;  4W7Z A;  3NXS A;  2NPS B;  2HG5 D;  4OGQ D;  2WSF J;  2POH A;  4H44 D;  3WUV A;  3KPE A;  3L70 E;  2E74 D;  1SQV K;  5E79 E;  1WRG A;  5AW6 B;  2OYH C;  1SQQ G;  3JCU H;  1PGJ A;  2W6B A;  4YTP C;  2O01 J;  2P7J A;  2E76 C;  3I5C A;  2KNC A;  2OYH B;  2XNX A;  4DCK A;  1J1D C;  2KI7 B;  2E76 B;  3SWF A;  2A45 G;  1OW7 A;  1X8Y A;  4GT1 A;  4QMA A;  3S1K A;  1J1D B;  2ITA A;  2NRG A;  2LKM A;  3L72 J;  3RL0 g;  3AEA C;  3USS A;  2FYU K;  1PP9 D;  1H0T B;  2IDB A;  3L36 A;  4IL6 H;  4DZO A;  2IBZ D;  5GTI H;  3CMA P;  1JTH B;  2WZ7 A;  1NU1 K;  1QX8 A;  2N9Y B;  2KS1 A;  2NPS D;  3C9I A;  1RHZ B;  1YI2 P;  2ZFC A;  3FX0 A;  3H1H E;  3VN0 A;  1KQL A;  1NTZ D;  1RQU A;  1EDL A;  2L5G B;  1Q7Y Q;  1URQ A;  1YTZ T;  2Z4E A;  1HTL C;  3M9H A;  1N8R Q;  1LTS C;  2A06 G;  4C7R A;  1BGY E;  1VQ8 P;  1NKN A;  4KHX A;  3GMA A;  4JPZ B;  2E76 D;  1PGO A;  2DW3 A;  1ZRT E;  1Z56 A;  3FKS H;  1IFD A;  5AW5 B;  2OYI C;  2XDJ A;  3A0H H;  2QEX P;  1A02 J;  3H1K J;  3M0A A;  4U3F E;  3MUD A;  2OYI B;  1AJY A;  3L74 D;  4L73 A;  3LIE A;  3M91 A;  3QWO C;  1FDM A;  1EDI A;  3H32 B;  1SQB G;  1M8O B;  2WPR A;  3TF5 A;  3AED C;  4PD4 H;  5AW3 B;  3L73 E;  1S3J A;  3CWB D;  3PLN A;  3U1A A;  3OA7 A;  4N78 D;  1BSN A;  3CC2 P;  3PHL A;  2V7Q J;  1N7S C;  1IK9 A;  1SQP D;  1NTK E;  2PGD A;  1N7S B;  1XTC C;  2Y9Y A;  4LGD E;  4MN4 C;  2A45 I;  2E75 C;  3RBX A;  5AVU B;  2P1J A;  1EXJ A;  3HUS C;  2JDI H;  2E75 B;  1SQX J;  3HUS B;  1NAY A;  1RH5 B;  2YKQ A;  3D6Y A;  4RO0 A;  3OE7 H;  1KB9 D;  3TGU D;  4EI2 A;  3H1L J;  2GUV A;  2WMM A;  1KV4 A;  3G4S P;  3PH0 A;  3VMY A;  3I55 P;  1ZME C;  4CPG A;  1JY2 O;  4UB8 E;  3SFD C;  3V2R A;  3LW5 H;  2XOK H;  1KQS O;  1Q82 Q;  2C0X A;  4W7Y A;  4Z1M H;  3OAK A;  5KLI C;  1SFC A;  1ZXG A;  1RF0 C;  1VQ6 P;  3Q2Y A;  1AQT A;  5KLI B;  1S2E A;  3PTZ A;  1RE3 A;  1L0N D;  1NU1 G;  2I1J A;  2Z5I A;  3CCS P;  1SQP K;  1FOS F;  2L91 A;  1N7S D;  3CXH H;  2H43 A;  4ASU H;  2E75 D;  2AXT H;  3C8V A;  2QVA A;  2WSC J;  4HH2 A;  1Y47 A;  3WMM 0;  3MTU E;  1QLE D;  2K9J B;  1YYC A;  3BRV B;  1SQQ E;  4TLF A;  5BVZ A;  5AW7 B;  1PGP A;  3L72 E;  1X22 A;  3K5B A;  3CCV P;  2KLV A;  4RES B;  1E5W A;  1PP9 G;  2KZJ A;  1CZQ A;  1JO5 A;  1L4A A;  1OXZ A;  1JY3 N;  2E5Y A;  2XND H;  2YO3 A;  1T8Z A;  2R3C A;  3S9O A;  4WY4 A;  1Y8A A;  1M57 D;  3CCU P;  3BCC E;  1MZ9 A;  2P58 A;  2R3S A;  2YKO A;  1RE4 A;  1G2C A;  4R4M A;  2YMY A;  1HBW A;  1D7M A;  3MIW A;  1LTA C;  3OW2 O;  3GHG C;  2FBW C;  3WUT A;  4A7P A;  5FL7 H;  2QSI A;  2OYO A;  3GHG B;  3P8C E;  2BCC G;  1KYO E;  4WWI A;  1H8E H;  2AXC A;  1CI6 B;  3IAO A;  2ZAE B;  3O6Q A;  2H88 C;  5GTH H;  1T2K C;  3AE4 C;  5AVW B;  4O9B A;  3CL3 D;  1YTZ I;  3E7K A;  2YIU C;  3L75 D;  3H1H J;  1KOR A;  3HTK A;  4N3Y B;  3KZI E;  2A06 E;  4JF7 A;  2YIU B;  1DD3 A;  2Y0D A;  1FBM A;  1GL2 A;  2ZVN B;  4ZMD A;  1HF9 A;  3IFM A;  1QL2 A;  1GU4 A;  1JNM A;  3CD6 P;  4UB6 E;  1BGY J;  3OEH H;  2FYZ A;  1WT6 A;  3L37 A;  2H7H A;  2WSE J;  1DX7 A;  2KNC B;  1JM0 A;  3CWB G;  2CPB A;  2QE7 H;  2HLD H;  4U3F J;  3JC2 2;  1NTM E;  2IFN A;  2WPS A;  1SQP G;  5KAF E;  1N86 A;  5KLV J;  2IZ0 A;  1SQB D;  3M9Q A;  3H1J D;  1FZE A;  5DN6 I;  3CXH I;  1KFN A;  4L76 A;  1IK7 A;  3EQ2 A;  3H1I D;  3I56 P;  3L73 J;  1L2P A;  1CSB A;  1LP1 A;  1IFI A;  1HVV A;  3OJA B;  3AE6 C;  1KN7 A;  1T2K D;  2GUS A;  2KB7 P;  1LTG C;  3HE4 A;  2KS1 B;  4AYC A;  5CCG A;  3HRN A;  1RF1 C;  4EOT A;  3R4Y A;  4PD4 D;  1KIL E;  1YQ3 C;  1M1K Q;  2R5D A;  1URQ C;  1K8A Q;  1RF1 B;  1SQV D;  1L0L E;  1JY2 P;  2I1K A;  3L71 E;  1URQ B;  2JKV A;  1BCC G;  1YBK A;  3SWY A;  3VMX A;  3WU2 H;  1VQ7 P;  2Q9I A;  3MUD C;  4IFF A;  1SLQ A;  1FZF A;  5C39 A;  1NWQ A;  1G1I A;  5KJ7 A;  2FYU D;  4BXL A;  3CC7 P;  1LGH B;  1W2E A;  3NTN A;  2UWJ E;  2ZYA A;  3P8M C;  5B5E H;  1Q2N A;  5AVS B;  2WPQ A;  2QM7 A;  5AVV B;  3OFN H;  1NU1 D;  5BU5 A;  2O01 H;  3CI9 A;  4ZKU A;  2W27 A;  3GW6 A;  2FXP A;  4Y99 C;  1W5C E;  2O1J A;  3PJS K;  1AQ5 A;  3KHU A;  5L8R J;  4Y99 B;  3AE7 C;  4PJ0 E;  3VYI A;  1FZA A;  1KZU B;  5APT A;  3VMZ A;  1URQ D;  1SQX K;  1MFT A;  2YMK A;  4NPE A;  1GU5 A;  5H2F E;  1ZP0 C;  4C46 A;  3CXH D;  1VQM P;  1SQQ J;  1E79 H;  1PP9 E;  1KIL A;  3CX5 H;  2JP3 A;  1LTB C;  3L70 D;  2IBZ E;  1H88 A;  3G6E P;  2R32 A;  4N6J A;  3ABV C;  1ZR4 A;  1U7M A;  1GK4 A;  2QA4 P;  1SFC C;  1LTJ A;  2FY8 A;  2WIT A;  1KB9 I;  1JB0 J;  2Y0E A;  2KSE A;  2ZXX A;  1GMJ A;  1SFC B;  2P2U A;  1RE3 C;  2LXB A;  3V2N A;  1NO4 A;  3BCC J;  3EFF K;  1NTZ E;  1P84 H;  3P7K A;  1BE3 D;  5CCH C;  2BEQ D;  4H0L C;  2IYP A;  1PIX A;  1GZL A;  3V2P A;  1HWT C;  1FE6 A;  3L75 G;  3EFG A;  2OTK E;  2BCC D;  4H0L B;  1PPJ D;  5B66 H;  3CCJ P;  1M56 D;  2Y9Z A;  1QVG O;  1YHQ P;  1UII A;  2PAJ A;  1FJP A;  5APV A;  4RJT A;  2QJK C;  2IPP A;  1VQ4 P;  3L74 E;  1JCC A;  3CME P;  3G9R A;  1M90 Q;  2JR8 A;  4GIF A;  2QJK B;  3M0D A;  1NKZ B;  4BWN A;  1G1J A;  5KLV E;  3GLM A;  3FWL A;  3IR9 A;  5AW4 B;  3CWB E;  2XZR A;  1L4A C;  2J5U A;  1SFC D;  3H1J G;  5AVY B;  3BRT B;  5TIS H;  2CK3 H;  4WY4 C;  1L4A B;  3H1I G;  1SQP E;  1RE4 C;  4WY4 B;  1TU3 F;  1NTM J;  2C0W A;  1LNQ A;  1M1J A;  3W67 A;  1IC2 A;  5CCH D;  4GOD A;  2ZXE B;  1G2C B;  1NVO A;  4H0L D;  1IO4 A;  4I2L C;  1H89 A;  4YXW H;  1VF5 C;  2V4H A;  5KAI H;  1FDO A;  4D6T D;  1RQV A;  2K9Y A;  5AVQ B;  1OX3 A;  1S5L H;  1VF5 B;  1KB9 E;  1SQV G;  3TGU E;  1K05 A;  1W2B O;  2WWW A;  2HPC A;  3A0B E;  3O6Q B;  2OAR A;  1NTK D;  3HD7 A;  2KLU A;  1SVF A;  1MFZ A;  3E1I A;  5APQ A;  3HTK B;  2FFD A;  1GL2 C;  1K04 A;  2B87 A;  2QIW A;  3Q3D A;  1L0L J;  1BCC D;  1GL2 B;  2FYU G;  3L71 J;  1L0N E;  3CCR P;  1L4A D;  3KQG A;  2RQ6 A;  3SWK A;  1PV3 A;  4WY4 D;  2WSC H;  4ZNC A;  1CW5 A;  1WMK A;  4JYB A;  3IF4 A;  2LXC B;  4WB4 A;  3A3Y B;  4JQ0 D;  2AEM A;  1ZLL A;  2PRR A;  1GK6 A;  1VQL P;  1IZN B;  3AEE C;  1FOS E;  2B88 A;  1VF5 D;  1XTG B;  3TSI A;  3LW5 J;  5E79 H;  4DT0 A;  1N73 A;  1LP1 B;  2QG4 A;  2J59 M;  1U57 A;  1VPC A;  1NTK K;  3L4F A;  3TK1 A;  1FS0 E;  2JJL A;  5H2F H;  5CCG C;  1NH4 A;  2HR3 A;  3HE4 B;  2WQY C;  3B8E B;  2M3B A;  2KXP B;  3M9B A;  4OWF A;  3BAT A;  3L70 G;  1GL2 D;  1JOC A;  3Q1M A;  1KFM A;  1NJI Q;  2WT7 A;  1FZC A;  3II6 A;  5BU8 B;  3GG2 A;  4I7Z C;  5AW0 B;  1QGK B;  2BAS A;  3JCU E;  3RGU A;  3V5B A;  4PD4 I;  4AUW A;  3MD0 A;  5AW8 B;  2YXQ B;  5APY A;  4I7Z B;  3AEB C;  3ZDM A;  1PP9 J;  2PP6 A;  1T3U A;  3L72 D;  4C7N A;  3M06 A;  4H13 C;  1BE3 G;  4IL6 X;  4YXD C;  5KJ7 C;  1J1E C;  1FZB A;  4K35 A;  3Q5R A;  4H13 B;  1J1E B;  3VTP C;  1YIT P;  1PPJ G;  1VQ5 P;  3RL0 C;  2P67 A;  2RQ7 A;  2E5T A;  2RN0 A;  3WUU A;  3CX5 D;  1NHL A;  3D6Z A;  4IL6 E;  1SP4 A;  3RL0 B;  1NTZ J;  5APS A;  1EZV D;  2W6A A;  3FXE A;  3Q5S A;  2K1A A;  2XU6 A;  2WSE H;  1GTW A;  2B9B A;  4LC1 A;  5CCG D;  1KC8 Q;  1JY2 N;  4U7J A;  3R2P A;  2O01 N;  1IFN A;  1KYO D;  1A02 F;  1VDF A;  1HUC A;  1PL5 A;  1IFJ A;  1LT9 A;  1JMM A;  1P84 D;  2VRS A;  1KMI Z;  5AW1 B;  2R44 A;  3GF3 A;  1JMB A;  1SQQ K;  3U1C A;  3H1K D;  2Q7C A;  1Q90 D;  3L74 J;  3FGA D;  1KIL C;  3RK3 C;  1RY3 A;  3KYQ A;  4U3F G;  1SQB E;  3KDP B;  2WSS H;  2PFX A;  3E1R A;  5AW9 B;  3H1J E;  3VP8 A;  1KIL B;  4H13 D;  3RK3 B;  3VOP A;  1OVV A;  3A0H E;  1YJ9 P;  5KJ7 D;  3H1I E;  2NZ2 A;  3RK2 C;  3CWB J;  1LTJ C;  5K5G B;  3A5T A;  2H89 C;  1KQG B;  2FKW B;  5AVR B;  1DEB A;  1GD2 E;  2MJZ A;  4D6T G;  3RK2 B;  1NGM B;  1LTJ B;  3RL0 D;  4GOE A;  1ZOY C;  1SQP J;  5AVT B;  1NTM D;  1OMI A;  4PD4 E;  3IN6 A;  2RH0 A;  1BDD A;  1NTK G;  4L75 A;  1SQV E;  3S4R A;  2IYO A;  4UB8 H;  1S5L X;  2JWA A;  3CPW O;  3TGU J;  1SQX D;  4NPD A;  1QVF O;  2FXM A;  3H1L D;  3B71 A;  1KTM A;  1VQ9 P;  1HJB A;  2YXR B;  2FYU E;  2G3A A;  1KIL D;  3RK3 D;  2E42 A;  3H25 A;  3M0D C;  1OZH A;  3ITK A;  3A2A A;  1QEX A;  3VMA A;  2WSF H;  1LT1 A;  3L71 D;  2W6J H;  1X9V A;  1DH3 A;  1NU1 E;  3CCL P;  2M3E A;  2GA1 A;  1S9K D;  3RK2 D;  2KIK A;  1L0N J;  3LID A;  3FWN A;  5CHX A;  2JWD A;  3T97 A;  1VQK P;  3H6P A;  1HH0 A;  2O1K A;  1NTM K;  4WBA A;  2R5B A;  5AVX B;  4OVN F;  1JCD A;  1M1J C;  1AA0 A;  2GM4 A;  4AQR D;  2AEF A;  2Q3I A;  1VQO P;  1M1J B;  3AE8 C;  4LLH A;  1LWU A;  3U59 A;  3B5N A;  2RMZ A;  3TNU A;  1SS1 A;  4BRY A;  2HOD A;  5DJU B;  3CXH E;  1FAV A;  2HFE D;  2A45 H;  1LTI C;  2JEE A;  2B89 A;  1T6A A;  1DEE G;  3HD7 C;  2AXT E;  3UIA A;  2HPC B;  2Z5H A;  1MV8 A;  3HD7 B;  4HJG H;  2FFD C;  1S72 P;  3L72 G;  1L0L K;  2WVR A;  4GKG A;  1S1C X;  2KYV A;  1T3J A;  2FFD B;  2B87 B;  1KD1 Q;  2N9B A;  2I8D A;  2C9L Y;  3P32 A;  3CLQ A;  1KYO H;  2IFM A;  1BE3 E;  3CCQ P;  1BSH A;  3CCM P;  2N1T A;  5CMZ A;  3D71 A;  3BCC G;  3PP5 A;  2ZYD A;  3BVH A;  2BCC E;  1FJK A;  1EZV G;  1PPJ E;  3AE9 C;  4NPF X;  1K73 Q;  1J2J B;  2H8P D;  2QM8 A;  1OFC X;  1AVY A;  3AE5 C;  3KZI H;  3TDK A;  3HE5 A;  3MP7 B;  1UIX A;  1MKM A;  2M5A A;  3L75 J;  4UB6 H;  3AE3 C;  1N73 C;  1OVU A;  4ZKP A;  3MHV A;  1RF1 A;  4EDF A;  2Y0C A;  3AEF C;  3H1H D;  4PV1 C;  1PGQ A;  1N73 B;  2RKL A;  3HD7 D;  3H1K G;  1NAF A;  2CPS A;  1HGV A;  2KUB A;  5GTH E;  3NMD A;  4XA4 A;  1JUN A;  2IX7 C;  4PV1 B;  4DOJ A;  2OQQ A;  1QL1 A;  2V7Q H;  1EDK A;  2W83 C;  2ZJS E;  1FZC C;  1PFI A;  3N4X A;  1NOH A;  1BGY D;  3Q5P A;  4I1L A;  5KAF H;  2IZ1 A;  1YIJ P;  2WT7 B;  1FZC B;  1ZRT D;  1VL2 A;  4N78 E;  2KSJ A;  2K3R A;  2P10 A;  3EWK A;  4M3L A;  4U3F D;  1NTM G;  1JY3 O;  1SQB J;  4IOI H;  1Q86 Q;  3H1J J;  3G71 P;  4D6T E;  1USE A;  2M0B A;  5KLV D;  4C7N B;  3H1I J;  4K3A A;  2NPS A;  5APX A;  4XFJ A;  5CJ4 A;  4WVZ A;  3L73 D;  2MKV A;  2Q1K A;  1R8E A;  3AEC C;  1NTZ K;  1R5L A;  1SQX G;  2WTY A;  1LTT C;  3H1L G;  1EQ7 A;  4PV1 D;  2ZVO B;  2D2C C;  2Q6Q A;  2OYH A;  3W68 A;  1SQV J;  1YQ4 C;  1GW4 A;  1BCC E;  2ZYG A;  2D2C B;  4I6M C;  1FDI A;  3CX5 I;  1LT9 C;  1L0L G;  1EZV I;  3L71 G;  2KZI A;  5EFW B;  3AEG C;  1LT9 B;  2OTJ P;  1H0T A;  2KK7 A;  1JTH A;  1KYO I;  4DJG A;  2W90 A;  2FYU J;  4GDO A;  2BEZ F;  1ZR2 A;  1IFP A;  5KLV K;  2J58 A;  2JO1 A;  1P84 I;  1ZV8 A;  3WU2 E;  1VQN P;  1FC2 C;  1NU1 J;  1DIP A;  3V2Q A;  4PJ0 H;  3AE2 C;  1OIP A;  5CCH A;  2Q5U A;  2FYN C;  1N7L A;  1ZW0 A;  2FYN B;  5B5E E;  1AVO A;  2KP8 A;  2QJY C;  1U7J A;  2D2C D;  1ZN5 A;  1FZG A;  2QJY B;  1N2D C;  3RBZ A;  4B86 A;  2OYI A;  2YO2 A;  1IJD B;  3D70 A;  2YKP A;  3B4S A;  1VQP P;  3L70 J;  1FU1 A;  4KJM A;  1SQQ D;  3H32 A;  1H8A A;  4ASV A;  5CBO A;  1EC5 A;  5AVZ B;  4Y28 J;  2IBZ G;  4HKZ H;  1HGZ A;  1GDT A;  1NYH A;  1L0N K;  1OW8 A;  1X79 B;  3V4W A;  3CX5 E;  1EDJ A;  4GOF A;  1R5S A;  1EZV E;  1BE3 J;  1N7S A;  2K37 A;  2KOG A;  3BCC D;  3N7N A;  3F5H A;  3L75 E;  5KKZ C;  5GTI E;  3T97 B;  1NTZ G;  2O3J A;  3L35 A;  3V6I A;  1OWA A;  2W8Z A;  1KQF B;  3MZW B;  5APU A;  2BCC J;  5KKZ B;  3H1H G;  3HUS A;  4YPC A;  4KT0 J;  1P84 E;  3P8C D;  1LWU C;  2LR2 A;  3TYY A;  3B5N C;  2QRX A;  3VP9 A;  1PZQ A;  1Y9B A;  1LWU B;  3CC4 P;  1BDC A;  4JYC A;  4RKU J;  3B5N B;  3H1K E;  1BGY G;  4ASW A;  3TNU B;  5B66 E;  3A7O A;  2HYN A;  4BRY B;  4EYY Q;  2HOD B;  3L74 G;  2A06 D;  5TJH A;  2M8R A;  1LJ2 A;  4HYT B;  4L74 A;  1OVR A;  4JBZ A;  1RF0 A;  3OAA H;  4OH8 B;  3KXD A;  3F89 A;  5KLV G;  3PRJ A;  5CBN A;  2OTL P;  1JY3 P;  3NFQ A;  5APW A;  3C1L A;  1M7L A;  2G8Y A;  3SFE C;  1X0T A;  3L73 G;  2N1T C;  2AEJ A;  3AE1 C;  1KB9 H;  4EIJ A;  2ZT9 C;  1IFM A;  2N1T B;  2HLO A;  3A0B H;  2SPZ A;  5TIS E;  2ZT9 B;  1EXI A;  4D6T J;  1OW6 A;  3BAS A;  3GF7 A;  4W80 A;  2K9J A;  1SQX E;  5CJ0 A;  3V4Q A;  1GW3 A;  3B5N D;  4OGQ C;  2E43 A;  3H1L E;  4H44 C;  3TGU G;  2IBZ I;  1NTK J;  3HE5 B;  4R4L A;  4OGQ B;  5KAI E;  2E74 C; 
#chains in the Genus database with same CATH homology
 2QE7 H;  1FS0 E;  2XND H;  2E5Y A;  1AQT A;  2HLD H;  3PJS K;  2RQ6 A;  2V7Q H;  1BSN A;  4WVZ A;  2JDI H;  4ASU H;  2WSS H;  4TLF A;  3OFN H;  5FL7 H;  2XOK H;  1JEK A;  3OEH H;  4QMA A;  3FKS H;  1E79 H;  3OAA H;  4DJG A;  1BSH A;  1H8E H;  3OE7 H;  2RQ7 A;  5DN6 I;  1IFP A;  3EFF K;  3USS A;  2CK3 H;  2E5T A;  2W6J H;  4YXW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...