1AQTA

Epsilon subunit of f1f0-atp synthase from escherichia coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE
publication title Crystal structure of the epsilon subunit of the proton-translocating ATP synthase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1aqtA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1aqtA01
2WSSH 1H8EH 2CK3H 1AQTA 2RQ7A 3OE7H 3FKSH 2XNDH 3OAAH 4QMAA 1JEKA 2QE7H 3USSA 4WVZA 2E5YA 1IFPA 5FL7H 2RQ6A 2XOKH 2E5TA 4DJGA 4YXWH 5DN6I 3OEHH 1E79H 2W6JH 4ASUH 3OFNH 1BSNA 3EFFK 4TLFA 1BSHA 2JDIH 2HLDH 2V7QH 1FS0E 3PJSK
chains in the Genus database with same CATH superfamily
2FFDA 1LTBC 1ZP0C 2KOGA 5KAIE 3VMXA 1SQPD 1KFMA 2K9YA 3P32A 5AVYB 1SQPJ 2WITA 3P7KA 1FOSF 2K88A 3T97A 3B5ND 1EQ7A 1JY3P 1KILA 2JJLA 5K5GB 1BCCE 2A45H 1NVOA 2C9LY 2R3CA 3UIAA 1FOSE 4UB6E 3FWLA 1JCDA 2WMMA 3WUTA 1LT9A 3KZIH 3L70G 3CCEP 2CPBA 3I55P 1G1JA 3Q5SA 3H1IG 5APVA 3RGUA 4N78D 4R4MA 2P10A 3CX5I 1N8RQ 3CC4P 1J1EB 3EQ2A 1YQ3C 3A5TA 5KLVK 1NTME 3K5BA 2AXCA 1HWTC 2O01N 5C39A 3CCSP 2WPQA 3VP9A 1BGYE 3CLQA 1SQVK 3GLMA 4D6TG 3PLNA 2YIUB 1EDIA 1NJIQ 5TJHA 1FBMA 4UB8E 3RK3D 1AVOA 2KK7A 3L70D 5AVTB 3CWBG 3H1ID 3BRTB 5APWA 1SQPK 1LP1A 1UIIA 3L70J 3L74E 1J1EC 3H1IJ 3PRJA 2GUVA 3WMM0 4DJGA 3AEBC 3CXHD 3EWKA 1VQ6P 1N7SD 4H0LD 1CI6B 2YIUC 3G6EP 5GTHH 1GL2B 4D6TD 4CPGA 1VQLP 4H44D 4I6MC 1RF1A 2WSEH 3HE5B 2XOKH 4D6TJ 1L0NE 3OW2O 3G71P 2YKOA 2R3SA 1GZLA 3CCVP 4WY4D 2P2UA 3OE7H 1T2KD 1KB9H 3FX0A 3PH0A 3CWBJ 3MTUE 5CCHD 2K1AA 5AW4B 3T97B 1YTZT 3IN6A 3D6YA 4C7RA 2QJYB 4XA4A 1KILB 2QIWA 1ZMEC 1GL2C 2I1KA 3GF7A 3M9QA 5KJ7C 3P8CD 5CBNA 1OW7A 2M8RA 2B89A 2XZRA 3CX5D 2FYNB 3AEGC 3G3ZA 1NAFA 2Y9YA 5AW3B 2R32A 1HJ0A 2WSFJ 1QL1A 2QJYC 1PPJG 1KILC 1OFCX 1FZBA 1SS1A 4EOTA 2JP3A 1NWQA 3I5CA 3AECC 1W2EA 3FGAD 2MKVA 3IR9A 2FYNC 1M1JB 2XNDH 3FXDA 5KAIH 1ZOYC 3NXSA 1Y9BA 2I8DA 2YMKA 1IJDB 1VQ7P 5TISH 3RL0D 2E43A 4ASUH 4BRYA 1HGVA 3TNUB 2O3JA 1EDKA 1SQXE 2QM8A 4OWFA 3V5BA 1JOCA 1P84H 2G8YA 3L72G 3SSUA 3L36A 3USSA 2E5YA 1PPJD 4PD4I 1GK4A 2LXCB 1URQD 3MUDA 4KJMA 1IFNA 4IFFA 1JY3O 3CCMP 3MD0A 4OGQB 3E1IA 1M1JC 1BSHA 4UB6H 1NTZE 1YJWP 5AW2B 2HPCB 1KD1Q 2WSCJ 3TGUD 1DEBA 2V4HA 4RO0A 3E1RA 3CMAP 3BRVB 3AEFC 2N9BA 5BU5A 4MN4C 3TGUJ 3I56P 3RBZA 3V4QA 1PGQA 1OWAA 1K05A 3H1HE 4H13D 1FJKA 5AVVB 3L72D 1NGMB 1IO4A 3PHLA 2B9BA 4OGQC 3L72J 4L74A 4AQRD 3KPEA 5KAFH 1AVYA 1NO4A 2QEXP 2FXOA 1A02J 3V2PA 3L71E 2N1TA 2ZT9B 2WQYC 1NHLA 3FWNA 2M3BA 3AEEC 2NPSD 2M5AA 2YO3A 3L73D 3KZIE 4ZNCA 1KYOI 1L4AB 2O1KA 1G2CA 2Q3IA 1YYCA 1VQ8P 3L73J 2AEFA 1S1CX 1RQVA 1MV8A 1DIPA 3BVHA 2KSEA 3H1JD 3EFFK 1NKNA 4IOIH 2BCCE 3Q1MA 2PRRA 1FZCA 2ZT9C 4HJGH 1JNMA 4JBZA 3H1JJ 1S5LH 2FYUE 4GIFA 1KV4A 1VQKP 1L4AC 1CSBA 1CW5A 1FAVA 1J2JB 2P1JA 2OARA 1QVGO 1L0LE 4AUWA 3V4WA 4M3LA 3H1KE 4WBAA 2XDJA 2XV5A 5BVZA 3OEHH 1VQOP 5E79E 1GL2D 1VL2A 3V6IA 1IFDA 1EC5A 3G4SP 2FY8A 2RQ7A 2W6AA 1N73B 5AW9B 3Q5PA 3H1LG 2IDBA 2MJZA 2PP6A 5KLIB 1LTSC 2WT7A 3MUDC 1NTKE 2IZ1A 3B8EB 1KQFB 3ZDMA 1KB9E 1HUCA 4WB4A 1MKMA 5DJTB 2Z5IA 1K73Q 3E7KA 5AVRB 1BE3G 3GG2A 1KYOD 1ZW0A 1N73C 2RMZA 2AXTH 4IL6E 5AW0B 5KLIC 1N7LA 4U3FG 1W2BO 2D2CB 2SPZA 2M5AB 3OAKA 2GM4A 4I1LA 4ZKUA 2O01H 2POHA 5KTBA 1S9KD 3N4XA 3U59A 1Q82Q 1CI6A 2R5BA 3N7NA 4KHXA 3JSVC 5AVUB 3PTZA 5KJ7A 1SQQE 3HE5A 4EI2A 1FZCB 1KZUB 1QVFO 2BEQD 1BE3J 3II6A 3M9HA 2CK3H 3AE2C 2D2CC 1VQPP 1ZR4A 1IFPA 4U3FD 2KP8A 1SQBD 2JWDA 5TISE 1XTGB 2YKQA 3GW6A 4U3FJ 1Z56A 3BATA 2CPSA 1SQBJ 3A7OA 3HRNA 1P84E 5CHXA 4JF7A 1FZCC 3QH9A 1YTZI 1KC8Q 1H8AA 5B5EH 4Z1MH 1EZVI 3D70A 4BWNA 1SFCA 2Q6QA 4PD4H 4ASWA 2WT7B 1GMJA 1LTIC 1KQSO 3TF5A 3KHUA 5AW7B 1OXZA 4Y28J 1MUUA 2L5GB 3H1IE 1FZAA 1BCCD 1BGYG 3RK2B 1RQUA 1M1JA 2HODA 1VDFA 5KAFE 5APXA 1OX3A 1QEXA 4GKGA 3CXHE 1VF5B 2ZT9D 2V7QH 2WSSH 1G1IA 3TNUA 1OVRA 4ASVA 2BASA 2QE7H 4D6TE 1SLQA 3O6QB 2GUSA 1SQBK 2E75D 3QWOC 1OW8A 4I2LC 4GODA 1EZVG 4JYBA 1Y47A 3WU2H 1GW4A 2BEZF 3RK2C 5E79H 5APUA 3PJSK 1DD3A 3CWBE 1LT1A 1BGYD 2FXMA 1NU1K 1E5WA 2HPCA 4L75A 1VF5C 1BGYJ 1BDCA 4JQ0D 1Q86Q 1D7MA 1EDJA 1N86A 5GTIH 1S5LE 1OIPA 2XKMA 2YNYA 3L74D 3FKSH 5B66H 3CX5E 3A0BE 1FZFA 3L74J 1EZVD 3H32A 1IFIA 1SVFA 4TLFA 1JUNA 3Q3DA 2QVAA 4RKUJ 3NMDA 2E74B 2LKMA 4RJTA 4IL6H 3GMAA 1U7JA 1PGJA 3PP5A 5APYA 1IFJA 3V2RA 3IAOA 2W6BA 4XE5B 5CJ0A 1SFCB 2G3AA 3L4FA 4JYCA 1Q81Q 1IK7A 1L4AA 3WUVA 3CL3D 2C0XA 3H6PA 1JY2N 3M9BA 2FYZA 1L2PA 5AW5B 2C9NY 1NTMK 4YXWH 2FBWC 2JDIH 2E74C 3D6ZA 1YQ4C 2UWJE 1RF0C 1Y8AA 2A06G 2Y0DA 3LIEA 3LW5J 1PP9E 2HODB 1PZQA 1LWUA 2HG5D 3TGUG 1JY2P 2ITAA 4NPFX 2WVRA 1GU5A 2QM7A 1SFCC 2N1TD 4A7PA 3SFEC 1ZXGA 1SQXG 2AXTE 3AEAC 2D2CD 4PV1B 2QJKB 2A45I 1GU4A 5CCGC 1AJYA 2C0WA 4C46A 3A0HH 2IZ0A 3EFGA 1LTJA 4N6JA 1A02F 1OZHA 2P58A 2RN0A 4DCKA 1NTZG 2A06D 2IYOA 3B5NB 2OYHB 3HUSA 1N73A 1X8YA 1L0NK 1HTLC 1M56D 3CC2P 4PV1C 2QJKC 3OJAB 2Q5UA 1SQXD 2JO1A 1FDIA 3L73G 3H1HG 2H43A 4GT1A 3GHGB 1MFZA 2ZFCA 1BDDA 1SQXJ 2OTLP 1H89A 2YXRB 4PJ0E 3JCUE 2ZVNB 4RESB 2XNXA 3H32B 3H1JG 3ITKA 2Q3EA 3B5NC 2OYHC 3CXHH 1WRGA 1K8AQ 1NTZD 2L91A 2A45G 3L71G 1M8OB 4WVZA 1NTZJ 4HYTB 3VOPA 2K3RA 2ZYDA 5B5EE 3GHGC 1HF9A 3H1HD 1FS0E 1T3JA 3R4YA 3BCCG 3BASA 1VQNP 3RK3B 5AW1B 2B87B 2QA4P 1LJ2A 4PD4E 2Q1KA 3H1HJ 1FJPA 2Y9ZA 2YXQB 3KDPB 3CCQP 3S4RA 1FDMA 1VQMP 2BCCG 3CCUP 4EYYQ 2IFMA 3H25A 3C1LA 3L71D 2FYUG 1LTAC 1LWUB 2XU6A 1KB9I 1SP4A 1YJ9P 1N7SB 4H0LB 4NPEA 1IC2A 3L71J 3HTKA 2H89C 3CX5H 1T3UA 3A0BH 3CPWO 1M1KQ 4YPCA 1OW6A 5APTA 2KLUA 3TK1A 4H44B 1SQXK 3RL0g 3BCCD 1GW3A 2M0BA 2WSFH 3Q5RA 1ZRTE 3BCCJ 4WY4B 1LTJB 1EDLA 4EIJA 4O9BA 2BCCD 2W90A 3WU2E 1AQ5A 1LWUC 4NPDA 1FDOA 1NTZK 5KJ7D 1N7SC 4H0LC 2DW3A 2FYUD 2BCCJ 2N9YB 1R5SA 3HUSB 3L75E 1NAYA 4W7YA 4H44C 2FYUJ 4L73A 2FXPA 5GTIE 3RBXA 1ZN5A 2H7HA 2YO2A 1NTKG 1H88A 2HLDH 2P67A 2WPRA 4WY4C 1PV3A 3MP7B 5APSA 1LTJC 5B66E 4IFMA 3H1LE 3KYQA 1KILD 5CCHC 1NH4A 3V2QA 3VMAA 2J58A 2OYIA 2ZYGA 2E74D 3KXDA 5KLVE 3HUSC 2IBZE 1RE3C 3AE3C 2K37A 2WSCH 1P84I 1S9KE 3A2AA 2ZVOB 1JY2O 4BXLA 1SQVE 1FE6A 1VQ9P 1SFCD 3O6QA 2WSEJ 1SQBG 1BE3E 4LLHA 1NTKD 3AE1C 5L8RJ 1KB9D 3RL0B 1AFOA 1NTKJ 1SQPE 4U3FE 1NU1G 1YI2P 2E76B 4XFJA 4TT3H 1U7MA 1XTCC 3B71A 4HKZH 1X0TA 1URQB 3A3YB 1JB0J 2KS1A 3M06A 2FYUK 3S9OA 1DX7A 1FZEA 4GDOA 3HTKB 1AA0A 1FU1A 2KLVA 1IZNB 4PJ0H 3JCUH 3OA7A 3IF4A 2ZYAA 4Y99B 1YBKA 4PV1D 3R2PA 3RL0C 2PFXA 2Y0EA 2Z5HA 3CCRP 1L0LK 2E76C 2W83C 3SFDC 2NZ2A 5AVXB 1BCCG 4W80A 1DEEG 1NU1D 2ZXXA 4H13B 4N78E 4OGQD 1URQC 5M1BA 1SQQD 3A0HE 1NYHA 1E79H 4IFDK 1NU1J 1RF0A 4OH8B 1S4XA 1SQQJ 2PGDA 2I1JA 4DZOA 3AE8C 4GOEA 5AW8B 2LR2A 2QSIA 4R4LA 4Y99C 1YHQP 5FL7H 2Q7CA 3ABVC 3MHVA 1S5LX 1WMKA 1VQ4P 1NTMG 2HR3A 3VMYA 1NTKK 3RK3E 3AE9C 5CCGA 1P84D 1YJNP 4GOFA 3L70E 4H13C 2NPSB 2FKWB 3OAAH 1RE4A 2OYIB 1EXIA 2OGUA 1BCCJ 3MZWB 2K9JB 3C8VA 1HVVA 5AVQB 2Y0CA 3VP8A 3CMEP 4C7NA 3U1AA 4YXDC 2LXBA 2B88A 3HD7A 2WPVB 2J59M 1IK9A 3L74G 1RH5B 3JC22 1PGPA 1L4AD 2AEMA 1QX8A 1NTMD 3MGNA 2NPSC 5CMZA 3AE7C 2OTKE 1WT6A 2Q9IA 1NTMJ 2OYIC 1K9MQ 1S2EA 1GD2E 3AE4C 5DJUB 1LNQA 3F5HA 1LTTC 1N2DC 1VPCA 3B5NA 5H2FE 2OYHA 1SQQK 2Z4EA 1J1DB 1L0NG 1EZVE 1Q90D 5AVSB 2KS1B 2IYPA 1KYOH 1QLED 3NTNA 3O8ZA 3VMZA 3P8CE 1HJBA 3GHGA 4N3YB 2KZJA 4KT0J 1W5CE 3SWKA 2QJPB 1CZQA 2WPSA 2FFDB 1LGHB 1QL2A 3CWBD 1JCCA 1KORA 2ZJSE 2HFED 2HLOA 4HH2A 4K3AA 1J1DC 3VN0A 3D71A 3TSIA 1USEA 2E5TA 1L0ND 1K04A 4B86A 2RH0A 1JTHA 2KNCA 3V2NA 1L0NJ 5AW6B 1DD4A 5EFWB 3GF3A 2QJPC 5KKZB 3AE6C 2KB7P 2B87A 2FFDC 1LT9B 1X79B 3WUUA 1KFNA 3L37A 3L35A 1TU3F 2R5DA 1R8EA 1H0TA 1PP9G 1EXJA 2NRGA 1PPJE 1KMIZ 1OMIA 1N7SA 3Q2YA 5KKZC 4C7NB 3CC7P 2ZAEB 1ZLLA 3HD7B 2GA1A 5AVZB 3MIWA 3TYYA 2A06E 1YIJP 2M3EA 2R44A 2QG4A 1ZR2A 2JWAA 1AV1A 1LT9C 3TGUE 5AVWB 2JEEA 4WY4A 1JO5A 2W6JH 3CI9A 1QGKB 1RE4C 1LP1B 5CCHA 2E76D 4YTPC 2AEJA 1PP9D 1S3JA 3L72E 2KI7B 2RKLA 2O1JA 2RQ6A 1PP9J 1RHZB 1KQGB 1RE3A 1JMBA 3HD7C 2KUBA 3F89A 1MFTA 1PL5A 1PIXA 3HE4A 1RF1B 1UIXA 4QMAA 1RY3A 1T8ZA 2YMYA 1HGZA 1Q2NA 1JMMA 1BSNA 2H88C 3L73E 1U57A 2O01J 4K35A 4JPZB 3SWYA 1NKZB 1FC2C 4DOJA 1JTHB 2KNCB 4HB1A 3H1JE 1ZV8A 4UB8H 1RF1C 3NFQA 4ZKPA 4U7JA 2KIKA 3P8MC 2OTJP 1IFMA 1X9VA 4LGDE 1GTWA 2E42A 3KQGA 3M0DA 4I7ZB 3CCJP 5H2FH 4LC1A 5BU8B 2W8ZA 4DT0A 2W27A 3RK2D 1H0TB 2E75B 3BCCE 1URQA 2VRSA 1AQTA 1T6AA 3FXEA 2H8PD 1VF5D 4WWIA 2WTYA 1M7LA 3VTPC 4IL6X 3CCLP 3VYIA 3RK3C 1FZGA 4EDFA 1PFIA 3SWFA 2IBZI 1VQ5P 2IPPA 1H8EH 4AYCA 1X22A 4PD4D 1USDA 5CJ4A 4I7ZC 1L0LG 3IFMA 1HBWA 3W68A 3H1KG 1MZ9A 1GDTA 4BRYB 2E75C 1OVVA 1Q7YQ 5CBOA 3TDKA 3LW5H 3C9IA 3L75G 4ZMDA 3G9RA 1PGOA 1M57D 2JR8A 1JM0A 1KILE 1YITP 5DN6I 1HH0A 1NOHA 1S72P 1KYOE 2HYNA 3HE4B 2V7QJ 5GTHE 1L0LD 1ZRTD 2KZIA 3H1KD 2KXPB 1T2KC 2NPSA 1L0LJ 1M90Q 1DH3A 2P7JA 5APQA 3H1KJ 3AEDC 3OFNH 5KLVG 2IBZG 3W67A 2K9JA 2WWWA 1GK6A 2QRXA 3L75D 2PAJA 3B4SA 3AE5C 1SQVG 3LIDA 1KQLA 3L75J 3M0AA 2IFNA 2OQQA 2WZ7A 2JKVA 2N1TB 3M91A 2ZXEB 1R5LA 3H1LD 2IX7C 3U1CA 1SQPG 5CCGD 4OVNF 1KTMA 3H1LJ 2OYOA 1SQBE 2YKPA 1SQQG 5KLVD 2IBZD 1G2CB 2J5UA 2KSJA 4W7ZA 1LTGC 5KLVJ 4L76A 2KYVA 1JEKA 1SQVD 1NU1E 1GL2A 3HD7D 1OVUA 1KN7A 1BE3D 1SQVJ 2N1TC 1JY3N 3S1KA 3CD6P 3CXHI 3M0DC
chains in the Genus database with same CATH topology
2WSSH 1H8EH 2CK3H 1AQTA 2RQ7A 3OE7H 3FKSH 2XNDH 3OAAH 4QMAA 1JEKA 2QE7H 3USSA 4WVZA 2E5YA 1IFPA 5FL7H 2RQ6A 2XOKH 2E5TA 4DJGA 4YXWH 5DN6I 3OEHH 1E79H 2W6JH 4ASUH 3OFNH 1BSNA 3EFFK 4TLFA 1BSHA 2JDIH 2HLDH 2V7QH 1FS0E 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS H;  1H8E H;  2CK3 H;  1AQT A;  2RQ7 A;  3OE7 H;  3FKS H;  2XND H;  3OAA H;  4QMA A;  1JEK A;  2QE7 H;  3USS A;  4WVZ A;  2E5Y A;  1IFP A;  5FL7 H;  2RQ6 A;  2XOK H;  2E5T A;  4DJG A;  4YXW H;  5DN6 I;  3OEH H;  1E79 H;  2W6J H;  4ASU H;  3OFN H;  1BSN A;  3EFF K;  4TLF A;  1BSH A;  2JDI H;  2HLD H;  2V7Q H;  1FS0 E;  3PJS K; 
#chains in the Genus database with same CATH topology
 2FFD A;  1LTB C;  1ZP0 C;  2KOG A;  5KAI E;  3VMX A;  1SQP D;  1KFM A;  2K9Y A;  3P32 A;  5AVY B;  1SQP J;  2WIT A;  3P7K A;  1FOS F;  2K88 A;  3T97 A;  3B5N D;  1EQ7 A;  1JY3 P;  1KIL A;  2JJL A;  5K5G B;  1BCC E;  2A45 H;  1NVO A;  2C9L Y;  2R3C A;  3UIA A;  1FOS E;  4UB6 E;  3FWL A;  1JCD A;  2WMM A;  3WUT A;  1LT9 A;  3KZI H;  3L70 G;  3CCE P;  2CPB A;  3I55 P;  1G1J A;  3Q5S A;  3H1I G;  5APV A;  3RGU A;  4N78 D;  4R4M A;  2P10 A;  3CX5 I;  1N8R Q;  3CC4 P;  1J1E B;  3EQ2 A;  1YQ3 C;  3A5T A;  5KLV K;  1NTM E;  3K5B A;  2AXC A;  1HWT C;  2O01 N;  5C39 A;  3CCS P;  2WPQ A;  3VP9 A;  1BGY E;  3CLQ A;  1SQV K;  3GLM A;  4D6T G;  3PLN A;  2YIU B;  1EDI A;  1NJI Q;  5TJH A;  1FBM A;  4UB8 E;  3RK3 D;  1AVO A;  2KK7 A;  3L70 D;  5AVT B;  3CWB G;  3H1I D;  3BRT B;  5APW A;  1SQP K;  1LP1 A;  1UII A;  3L70 J;  3L74 E;  1J1E C;  3H1I J;  3PRJ A;  2GUV A;  3WMM 0;  4DJG A;  3AEB C;  3CXH D;  3EWK A;  1VQ6 P;  1N7S D;  4H0L D;  1CI6 B;  2YIU C;  3G6E P;  5GTH H;  1GL2 B;  4D6T D;  4CPG A;  1VQL P;  4H44 D;  4I6M C;  1RF1 A;  2WSE H;  3HE5 B;  2XOK H;  4D6T J;  1L0N E;  3OW2 O;  3G71 P;  2YKO A;  2R3S A;  1GZL A;  3CCV P;  4WY4 D;  2P2U A;  3OE7 H;  1T2K D;  1KB9 H;  3FX0 A;  3PH0 A;  3CWB J;  3MTU E;  5CCH D;  2K1A A;  5AW4 B;  3T97 B;  1YTZ T;  3IN6 A;  3D6Y A;  4C7R A;  2QJY B;  4XA4 A;  1KIL B;  2QIW A;  1ZME C;  1GL2 C;  2I1K A;  3GF7 A;  3M9Q A;  5KJ7 C;  3P8C D;  5CBN A;  1OW7 A;  2M8R A;  2B89 A;  2XZR A;  3CX5 D;  2FYN B;  3AEG C;  3G3Z A;  1NAF A;  2Y9Y A;  5AW3 B;  2R32 A;  1HJ0 A;  2WSF J;  1QL1 A;  2QJY C;  1PPJ G;  1KIL C;  1OFC X;  1FZB A;  1SS1 A;  4EOT A;  2JP3 A;  1NWQ A;  3I5C A;  3AEC C;  1W2E A;  3FGA D;  2MKV A;  3IR9 A;  2FYN C;  1M1J B;  2XND H;  3FXD A;  5KAI H;  1ZOY C;  3NXS A;  1Y9B A;  2I8D A;  2YMK A;  1IJD B;  1VQ7 P;  5TIS H;  3RL0 D;  2E43 A;  4ASU H;  4BRY A;  1HGV A;  3TNU B;  2O3J A;  1EDK A;  1SQX E;  2QM8 A;  4OWF A;  3V5B A;  1JOC A;  1P84 H;  2G8Y A;  3L72 G;  3SSU A;  3L36 A;  3USS A;  2E5Y A;  1PPJ D;  4PD4 I;  1GK4 A;  2LXC B;  1URQ D;  3MUD A;  4KJM A;  1IFN A;  4IFF A;  1JY3 O;  3CCM P;  3MD0 A;  4OGQ B;  3E1I A;  1M1J C;  1BSH A;  4UB6 H;  1NTZ E;  1YJW P;  5AW2 B;  2HPC B;  1KD1 Q;  2WSC J;  3TGU D;  1DEB A;  2V4H A;  4RO0 A;  3E1R A;  3CMA P;  3BRV B;  3AEF C;  2N9B A;  5BU5 A;  4MN4 C;  3TGU J;  3I56 P;  3RBZ A;  3V4Q A;  1PGQ A;  1OWA A;  1K05 A;  3H1H E;  4H13 D;  1FJK A;  5AVV B;  3L72 D;  1NGM B;  1IO4 A;  3PHL A;  2B9B A;  4OGQ C;  3L72 J;  4L74 A;  4AQR D;  3KPE A;  5KAF H;  1AVY A;  1NO4 A;  2QEX P;  2FXO A;  1A02 J;  3V2P A;  3L71 E;  2N1T A;  2ZT9 B;  2WQY C;  1NHL A;  3FWN A;  2M3B A;  3AEE C;  2NPS D;  2M5A A;  2YO3 A;  3L73 D;  3KZI E;  4ZNC A;  1KYO I;  1L4A B;  2O1K A;  1G2C A;  2Q3I A;  1YYC A;  1VQ8 P;  3L73 J;  2AEF A;  1S1C X;  1RQV A;  1MV8 A;  1DIP A;  3BVH A;  2KSE A;  3H1J D;  3EFF K;  1NKN A;  4IOI H;  2BCC E;  3Q1M A;  2PRR A;  1FZC A;  2ZT9 C;  4HJG H;  1JNM A;  4JBZ A;  3H1J J;  1S5L H;  2FYU E;  4GIF A;  1KV4 A;  1VQK P;  1L4A C;  1CSB A;  1CW5 A;  1FAV A;  1J2J B;  2P1J A;  2OAR A;  1QVG O;  1L0L E;  4AUW A;  3V4W A;  4M3L A;  3H1K E;  4WBA A;  2XDJ A;  2XV5 A;  5BVZ A;  3OEH H;  1VQO P;  5E79 E;  1GL2 D;  1VL2 A;  3V6I A;  1IFD A;  1EC5 A;  3G4S P;  2FY8 A;  2RQ7 A;  2W6A A;  1N73 B;  5AW9 B;  3Q5P A;  3H1L G;  2IDB A;  2MJZ A;  2PP6 A;  5KLI B;  1LTS C;  2WT7 A;  3MUD C;  1NTK E;  2IZ1 A;  3B8E B;  1KQF B;  3ZDM A;  1KB9 E;  1HUC A;  4WB4 A;  1MKM A;  5DJT B;  2Z5I A;  1K73 Q;  3E7K A;  5AVR B;  1BE3 G;  3GG2 A;  1KYO D;  1ZW0 A;  1N73 C;  2RMZ A;  2AXT H;  4IL6 E;  5AW0 B;  5KLI C;  1N7L A;  4U3F G;  1W2B O;  2D2C B;  2SPZ A;  2M5A B;  3OAK A;  2GM4 A;  4I1L A;  4ZKU A;  2O01 H;  2POH A;  5KTB A;  1S9K D;  3N4X A;  3U59 A;  1Q82 Q;  1CI6 A;  2R5B A;  3N7N A;  4KHX A;  3JSV C;  5AVU B;  3PTZ A;  5KJ7 A;  1SQQ E;  3HE5 A;  4EI2 A;  1FZC B;  1KZU B;  1QVF O;  2BEQ D;  1BE3 J;  3II6 A;  3M9H A;  2CK3 H;  3AE2 C;  2D2C C;  1VQP P;  1ZR4 A;  1IFP A;  4U3F D;  2KP8 A;  1SQB D;  2JWD A;  5TIS E;  1XTG B;  2YKQ A;  3GW6 A;  4U3F J;  1Z56 A;  3BAT A;  2CPS A;  1SQB J;  3A7O A;  3HRN A;  1P84 E;  5CHX A;  4JF7 A;  1FZC C;  3QH9 A;  1YTZ I;  1KC8 Q;  1H8A A;  5B5E H;  4Z1M H;  1EZV I;  3D70 A;  4BWN A;  1SFC A;  2Q6Q A;  4PD4 H;  4ASW A;  2WT7 B;  1GMJ A;  1LTI C;  1KQS O;  3TF5 A;  3KHU A;  5AW7 B;  1OXZ A;  4Y28 J;  1MUU A;  2L5G B;  3H1I E;  1FZA A;  1BCC D;  1BGY G;  3RK2 B;  1RQU A;  1M1J A;  2HOD A;  1VDF A;  5KAF E;  5APX A;  1OX3 A;  1QEX A;  4GKG A;  3CXH E;  1VF5 B;  2ZT9 D;  2V7Q H;  2WSS H;  1G1I A;  3TNU A;  1OVR A;  4ASV A;  2BAS A;  2QE7 H;  4D6T E;  1SLQ A;  3O6Q B;  2GUS A;  1SQB K;  2E75 D;  3QWO C;  1OW8 A;  4I2L C;  4GOD A;  1EZV G;  4JYB A;  1Y47 A;  3WU2 H;  1GW4 A;  2BEZ F;  3RK2 C;  5E79 H;  5APU A;  3PJS K;  1DD3 A;  3CWB E;  1LT1 A;  1BGY D;  2FXM A;  1NU1 K;  1E5W A;  2HPC A;  4L75 A;  1VF5 C;  1BGY J;  1BDC A;  4JQ0 D;  1Q86 Q;  1D7M A;  1EDJ A;  1N86 A;  5GTI H;  1S5L E;  1OIP A;  2XKM A;  2YNY A;  3L74 D;  3FKS H;  5B66 H;  3CX5 E;  3A0B E;  1FZF A;  3L74 J;  1EZV D;  3H32 A;  1IFI A;  1SVF A;  4TLF A;  1JUN A;  3Q3D A;  2QVA A;  4RKU J;  3NMD A;  2E74 B;  2LKM A;  4RJT A;  4IL6 H;  3GMA A;  1U7J A;  1PGJ A;  3PP5 A;  5APY A;  1IFJ A;  3V2R A;  3IAO A;  2W6B A;  4XE5 B;  5CJ0 A;  1SFC B;  2G3A A;  3L4F A;  4JYC A;  1Q81 Q;  1IK7 A;  1L4A A;  3WUV A;  3CL3 D;  2C0X A;  3H6P A;  1JY2 N;  3M9B A;  2FYZ A;  1L2P A;  5AW5 B;  2C9N Y;  1NTM K;  4YXW H;  2FBW C;  2JDI H;  2E74 C;  3D6Z A;  1YQ4 C;  2UWJ E;  1RF0 C;  1Y8A A;  2A06 G;  2Y0D A;  3LIE A;  3LW5 J;  1PP9 E;  2HOD B;  1PZQ A;  1LWU A;  2HG5 D;  3TGU G;  1JY2 P;  2ITA A;  4NPF X;  2WVR A;  1GU5 A;  2QM7 A;  1SFC C;  2N1T D;  4A7P A;  3SFE C;  1ZXG A;  1SQX G;  2AXT E;  3AEA C;  2D2C D;  4PV1 B;  2QJK B;  2A45 I;  1GU4 A;  5CCG C;  1AJY A;  2C0W A;  4C46 A;  3A0H H;  2IZ0 A;  3EFG A;  1LTJ A;  4N6J A;  1A02 F;  1OZH A;  2P58 A;  2RN0 A;  4DCK A;  1NTZ G;  2A06 D;  2IYO A;  3B5N B;  2OYH B;  3HUS A;  1N73 A;  1X8Y A;  1L0N K;  1HTL C;  1M56 D;  3CC2 P;  4PV1 C;  2QJK C;  3OJA B;  2Q5U A;  1SQX D;  2JO1 A;  1FDI A;  3L73 G;  3H1H G;  2H43 A;  4GT1 A;  3GHG B;  1MFZ A;  2ZFC A;  1BDD A;  1SQX J;  2OTL P;  1H89 A;  2YXR B;  4PJ0 E;  3JCU E;  2ZVN B;  4RES B;  2XNX A;  3H32 B;  3H1J G;  3ITK A;  2Q3E A;  3B5N C;  2OYH C;  3CXH H;  1WRG A;  1K8A Q;  1NTZ D;  2L91 A;  2A45 G;  3L71 G;  1M8O B;  4WVZ A;  1NTZ J;  4HYT B;  3VOP A;  2K3R A;  2ZYD A;  5B5E E;  3GHG C;  1HF9 A;  3H1H D;  1FS0 E;  1T3J A;  3R4Y A;  3BCC G;  3BAS A;  1VQN P;  3RK3 B;  5AW1 B;  2B87 B;  2QA4 P;  1LJ2 A;  4PD4 E;  2Q1K A;  3H1H J;  1FJP A;  2Y9Z A;  2YXQ B;  3KDP B;  3CCQ P;  3S4R A;  1FDM A;  1VQM P;  2BCC G;  3CCU P;  4EYY Q;  2IFM A;  3H25 A;  3C1L A;  3L71 D;  2FYU G;  1LTA C;  1LWU B;  2XU6 A;  1KB9 I;  1SP4 A;  1YJ9 P;  1N7S B;  4H0L B;  4NPE A;  1IC2 A;  3L71 J;  3HTK A;  2H89 C;  3CX5 H;  1T3U A;  3A0B H;  3CPW O;  1M1K Q;  4YPC A;  1OW6 A;  5APT A;  2KLU A;  3TK1 A;  4H44 B;  1SQX K;  3RL0 g;  3BCC D;  1GW3 A;  2M0B A;  2WSF H;  3Q5R A;  1ZRT E;  3BCC J;  4WY4 B;  1LTJ B;  1EDL A;  4EIJ A;  4O9B A;  2BCC D;  2W90 A;  3WU2 E;  1AQ5 A;  1LWU C;  4NPD A;  1FDO A;  1NTZ K;  5KJ7 D;  1N7S C;  4H0L C;  2DW3 A;  2FYU D;  2BCC J;  2N9Y B;  1R5S A;  3HUS B;  3L75 E;  1NAY A;  4W7Y A;  4H44 C;  2FYU J;  4L73 A;  2FXP A;  5GTI E;  3RBX A;  1ZN5 A;  2H7H A;  2YO2 A;  1NTK G;  1H88 A;  2HLD H;  2P67 A;  2WPR A;  4WY4 C;  1PV3 A;  3MP7 B;  5APS A;  1LTJ C;  5B66 E;  4IFM A;  3H1L E;  3KYQ A;  1KIL D;  5CCH C;  1NH4 A;  3V2Q A;  3VMA A;  2J58 A;  2OYI A;  2ZYG A;  2E74 D;  3KXD A;  5KLV E;  3HUS C;  2IBZ E;  1RE3 C;  3AE3 C;  2K37 A;  2WSC H;  1P84 I;  1S9K E;  3A2A A;  2ZVO B;  1JY2 O;  4BXL A;  1SQV E;  1FE6 A;  1VQ9 P;  1SFC D;  3O6Q A;  2WSE J;  1SQB G;  1BE3 E;  4LLH A;  1NTK D;  3AE1 C;  5L8R J;  1KB9 D;  3RL0 B;  1AFO A;  1NTK J;  1SQP E;  4U3F E;  1NU1 G;  1YI2 P;  2E76 B;  4XFJ A;  4TT3 H;  1U7M A;  1XTC C;  3B71 A;  4HKZ H;  1X0T A;  1URQ B;  3A3Y B;  1JB0 J;  2KS1 A;  3M06 A;  2FYU K;  3S9O A;  1DX7 A;  1FZE A;  4GDO A;  3HTK B;  1AA0 A;  1FU1 A;  2KLV A;  1IZN B;  4PJ0 H;  3JCU H;  3OA7 A;  3IF4 A;  2ZYA A;  4Y99 B;  1YBK A;  4PV1 D;  3R2P A;  3RL0 C;  2PFX A;  2Y0E A;  2Z5H A;  3CCR P;  1L0L K;  2E76 C;  2W83 C;  3SFD C;  2NZ2 A;  5AVX B;  1BCC G;  4W80 A;  1DEE G;  1NU1 D;  2ZXX A;  4H13 B;  4N78 E;  4OGQ D;  1URQ C;  5M1B A;  1SQQ D;  3A0H E;  1NYH A;  1E79 H;  4IFD K;  1NU1 J;  1RF0 A;  4OH8 B;  1S4X A;  1SQQ J;  2PGD A;  2I1J A;  4DZO A;  3AE8 C;  4GOE A;  5AW8 B;  2LR2 A;  2QSI A;  4R4L A;  4Y99 C;  1YHQ P;  5FL7 H;  2Q7C A;  3ABV C;  3MHV A;  1S5L X;  1WMK A;  1VQ4 P;  1NTM G;  2HR3 A;  3VMY A;  1NTK K;  3RK3 E;  3AE9 C;  5CCG A;  1P84 D;  1YJN P;  4GOF A;  3L70 E;  4H13 C;  2NPS B;  2FKW B;  3OAA H;  1RE4 A;  2OYI B;  1EXI A;  2OGU A;  1BCC J;  3MZW B;  2K9J B;  3C8V A;  1HVV A;  5AVQ B;  2Y0C A;  3VP8 A;  3CME P;  4C7N A;  3U1A A;  4YXD C;  2LXB A;  2B88 A;  3HD7 A;  2WPV B;  2J59 M;  1IK9 A;  3L74 G;  1RH5 B;  3JC2 2;  1PGP A;  1L4A D;  2AEM A;  1QX8 A;  1NTM D;  3MGN A;  2NPS C;  5CMZ A;  3AE7 C;  2OTK E;  1WT6 A;  2Q9I A;  1NTM J;  2OYI C;  1K9M Q;  1S2E A;  1GD2 E;  3AE4 C;  5DJU B;  1LNQ A;  3F5H A;  1LTT C;  1N2D C;  1VPC A;  3B5N A;  5H2F E;  2OYH A;  1SQQ K;  2Z4E A;  1J1D B;  1L0N G;  1EZV E;  1Q90 D;  5AVS B;  2KS1 B;  2IYP A;  1KYO H;  1QLE D;  3NTN A;  3O8Z A;  3VMZ A;  3P8C E;  1HJB A;  3GHG A;  4N3Y B;  2KZJ A;  4KT0 J;  1W5C E;  3SWK A;  2QJP B;  1CZQ A;  2WPS A;  2FFD B;  1LGH B;  1QL2 A;  3CWB D;  1JCC A;  1KOR A;  2ZJS E;  2HFE D;  2HLO A;  4HH2 A;  4K3A A;  1J1D C;  3VN0 A;  3D71 A;  3TSI A;  1USE A;  2E5T A;  1L0N D;  1K04 A;  4B86 A;  2RH0 A;  1JTH A;  2KNC A;  3V2N A;  1L0N J;  5AW6 B;  1DD4 A;  5EFW B;  3GF3 A;  2QJP C;  5KKZ B;  3AE6 C;  2KB7 P;  2B87 A;  2FFD C;  1LT9 B;  1X79 B;  3WUU A;  1KFN A;  3L37 A;  3L35 A;  1TU3 F;  2R5D A;  1R8E A;  1H0T A;  1PP9 G;  1EXJ A;  2NRG A;  1PPJ E;  1KMI Z;  1OMI A;  1N7S A;  3Q2Y A;  5KKZ C;  4C7N B;  3CC7 P;  2ZAE B;  1ZLL A;  3HD7 B;  2GA1 A;  5AVZ B;  3MIW A;  3TYY A;  2A06 E;  1YIJ P;  2M3E A;  2R44 A;  2QG4 A;  1ZR2 A;  2JWA A;  1AV1 A;  1LT9 C;  3TGU E;  5AVW B;  2JEE A;  4WY4 A;  1JO5 A;  2W6J H;  3CI9 A;  1QGK B;  1RE4 C;  1LP1 B;  5CCH A;  2E76 D;  4YTP C;  2AEJ A;  1PP9 D;  1S3J A;  3L72 E;  2KI7 B;  2RKL A;  2O1J A;  2RQ6 A;  1PP9 J;  1RHZ B;  1KQG B;  1RE3 A;  1JMB A;  3HD7 C;  2KUB A;  3F89 A;  1MFT A;  1PL5 A;  1PIX A;  3HE4 A;  1RF1 B;  1UIX A;  4QMA A;  1RY3 A;  1T8Z A;  2YMY A;  1HGZ A;  1Q2N A;  1JMM A;  1BSN A;  2H88 C;  3L73 E;  1U57 A;  2O01 J;  4K35 A;  4JPZ B;  3SWY A;  1NKZ B;  1FC2 C;  4DOJ A;  1JTH B;  2KNC B;  4HB1 A;  3H1J E;  1ZV8 A;  4UB8 H;  1RF1 C;  3NFQ A;  4ZKP A;  4U7J A;  2KIK A;  3P8M C;  2OTJ P;  1IFM A;  1X9V A;  4LGD E;  1GTW A;  2E42 A;  3KQG A;  3M0D A;  4I7Z B;  3CCJ P;  5H2F H;  4LC1 A;  5BU8 B;  2W8Z A;  4DT0 A;  2W27 A;  3RK2 D;  1H0T B;  2E75 B;  3BCC E;  1URQ A;  2VRS A;  1AQT A;  1T6A A;  3FXE A;  2H8P D;  1VF5 D;  4WWI A;  2WTY A;  1M7L A;  3VTP C;  4IL6 X;  3CCL P;  3VYI A;  3RK3 C;  1FZG A;  4EDF A;  1PFI A;  3SWF A;  2IBZ I;  1VQ5 P;  2IPP A;  1H8E H;  4AYC A;  1X22 A;  4PD4 D;  1USD A;  5CJ4 A;  4I7Z C;  1L0L G;  3IFM A;  1HBW A;  3W68 A;  3H1K G;  1MZ9 A;  1GDT A;  4BRY B;  2E75 C;  1OVV A;  1Q7Y Q;  5CBO A;  3TDK A;  3LW5 H;  3C9I A;  3L75 G;  4ZMD A;  3G9R A;  1PGO A;  1M57 D;  2JR8 A;  1JM0 A;  1KIL E;  1YIT P;  5DN6 I;  1HH0 A;  1NOH A;  1S72 P;  1KYO E;  2HYN A;  3HE4 B;  2V7Q J;  5GTH E;  1L0L D;  1ZRT D;  2KZI A;  3H1K D;  2KXP B;  1T2K C;  2NPS A;  1L0L J;  1M90 Q;  1DH3 A;  2P7J A;  5APQ A;  3H1K J;  3AED C;  3OFN H;  5KLV G;  2IBZ G;  3W67 A;  2K9J A;  2WWW A;  1GK6 A;  2QRX A;  3L75 D;  2PAJ A;  3B4S A;  3AE5 C;  1SQV G;  3LID A;  1KQL A;  3L75 J;  3M0A A;  2IFN A;  2OQQ A;  2WZ7 A;  2JKV A;  2N1T B;  3M91 A;  2ZXE B;  1R5L A;  3H1L D;  2IX7 C;  3U1C A;  1SQP G;  5CCG D;  4OVN F;  1KTM A;  3H1L J;  2OYO A;  1SQB E;  2YKP A;  1SQQ G;  5KLV D;  2IBZ D;  1G2C B;  2J5U A;  2KSJ A;  4W7Z A;  1LTG C;  5KLV J;  4L76 A;  2KYV A;  1JEK A;  1SQV D;  1NU1 E;  1GL2 A;  3HD7 D;  1OVU A;  1KN7 A;  1BE3 D;  1SQV J;  2N1T C;  1JY3 N;  3S1K A;  3CD6 P;  3CXH I;  3M0D C; 
#chains in the Genus database with same CATH homology
 2WSS H;  1H8E H;  2CK3 H;  1AQT A;  2RQ7 A;  3OE7 H;  3FKS H;  2XND H;  3OAA H;  4QMA A;  1JEK A;  2QE7 H;  3USS A;  4WVZ A;  2E5Y A;  1IFP A;  5FL7 H;  2RQ6 A;  2XOK H;  2E5T A;  4DJG A;  4YXW H;  5DN6 I;  3OEH H;  1E79 H;  2W6J H;  4ASU H;  3OFN H;  1BSN A;  3EFF K;  4TLF A;  1BSH A;  2JDI H;  2HLD H;  2V7Q H;  1FS0 E;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...