1E79H

Bovine f1-atpase inhibited by dccd (dicyclohexylcarbodiimide)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
publication title The Structure of the Central Stalk in Bovine F(1)-ATPase at 2.4 A Resolution.
pubmed doi rcsb
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2000-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1e79H02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1e79H01
4YXWH 4QMAA 2RQ6A 3OAAH 3FKSH 1IFPA 5DN6I 4WVZA 2QE7H 3OFNH 1FS0E 4TLFA 3EFFK 2E5TA 2XOKH 3OE7H 2HLDH 3OEHH 2XNDH 1AQTA 1E79H 1BSHA 1BSNA 1JEKA 2E5YA 2CK3H 2WSSH 4ASUH 1H8EH 4DJGA 2W6JH 3PJSK 2RQ7A 3USSA 2V7QH 2JDIH 5FL7H
chains in the Genus database with same CATH superfamily
1PP9D 3TK1A 4H0LC 3RGUA 3AE2C 3T97B 4MN4C 1S3JA 3AE6C 1R5LA 3G71P 2XOKH 1SQQK 1JTHA 5GTHH 1KYOD 2BEQD 4D6TE 3RK2C 3TNUB 1OFCX 4GKGA 2AEMA 3M9QA 1JCCA 3F5HA 4TLFA 3HUSC 2R3SA 1KILA 2ZT9C 1SQBD 3AEEC 2V7QJ 4WBAA 4GODA 1E79H 2C0WA 1SQBG 3LIEA 2P67A 2I1KA 1RF1C 1AA0A 3QH9A 4WY4B 1VF5D 1JB0J 1PPJD 2Q5UA 1NKZB 1X9VA 1CSBA 2NPSD 2QA4P 1PPJG 3PP5A 1SQBE 5CHXA 1T6AA 3N7NA 1EQ7A 5AVSB 4H0LD 3WU2H 1JY2N 1HGZA 4N78D 2YKQA 3BVHA 4PD4H 3H1JJ 3MTUE 3H32B 2CK3H 5TISE 1PPJE 3H1KD 1PZQA 2RQ7A 3RK2D 2C9LY 1ZOYC 5AW1B 3SFEC 2JKVA 5TJHA 2WQYC 2QE7H 1N7SA 2KIKA 2QJYB 1MV8A 1OVRA 2FXPA 1WT6A 5B5EE 5KKZB 2Y0CA 2AEFA 2E76B 2ZT9D 5CCHA 2PFXA 1GL2A 5KAIH 1VQ7P 1CI6B 1SQQG 4R4LA 1J1DC 2XV5A 5AVTB 1ZR4A 1YQ3C 1H8AA 4EDFA 3HD7D 2YIUB 1NAYA 2KZIA 4NPFX 2NZ2A 1VQPP 3TGUD 2FYZA 1AVYA 2WPQA 5EFWB 1FS0E 1BE3J 1SQQE 2GUVA 2FFDB 2P10A 3TGUG 3CPWO 1YQ4C 4GT1A 5AW7B 3H1LJ 2G8YA 1OWAA 3L73J 3IAOA 5AVQB 1NH4A 1FJKA 1WMKA 3FXDA 3A3YB 1PGJA 2OTKE 3TGUE 4WWIA 2B87B 2ZXXA 1FZCB 2KOGA 4K3AA 3FWLA 3FX0A 4PJ0H 1IFJA 1M7LA 3G3ZA 3PJSK 5KLVJ 2V7QH 1IFDA 2QRXA 3KPEA 1ZP0C 2OGUA 1M90Q 3L74D 2H43A 4TT3H 2DW3A 3L74G 1FBMA 1LWUA 3VP9A 1HUCA 1OX3A 2POHA 2FYUJ 3IR9A 1M1JA 1Q81Q 3V5BA 3CC4P 1S5LH 4LC1A 3HE5B 1OW7A 1M56D 2H89C 2K1AA 1NO4A 2WWWA 2OTJP 3L74E 2NPSA 3K5BA 3CCRP 3S1KA 2YXRB 4WY4C 1RH5B 5APVA 4JQ0D 1EDJA 1FZEA 2KP8A 4I6MC 1URQB 1USDA 3I5CA 3CX5E 3CXHI 3P8CD 5H2FH 3TF5A 3H25A 3CCQP 5E79H 3RBXA 2M3EA 2OARA 3FXEA 3GLMA 2HLDH 2QVAA 4NPDA 2QEXP 4KHXA 2RMZA 3HUSA 1JUNA 1VQNP 1GK4A 1L0NK 5B66H 3L72J 3EQ2A 1BCCD 3P8CE 1W5CE 3OA7A 1RF1A 1BCCG 1MFTA 3VMZA 4R4MA 3B8EB 1GD2E 2RH0A 1SQPK 3C1LA 2KSEA 2W6AA 4WY4D 3L71D 2BCCD 3CXHD 3H6PA 1X8YA 1BCCE 2OQQA 3PHLA 2WPVB 1JM0A 1NTKJ 3O6QB 3A0BH 1PIXA 3GHGB 2JR8A 3H1HJ 5AVZB 5KTBA 1L0LD 5APYA 5K5GB 4I7ZB 1RE3C 3JC22 4H44C 2ZYGA 3P7KA 3IN6A 2FYNC 2FXMA 2ZXEB 2E75C 4XFJA 1MZ9A 4U3FD 2KI7B 2HODA 5FL7H 1YJWP 1N7LA 1LT9B 4ZMDA 1S72P 1OVVA 4PV1C 3RL0C 3Q5SA 1L0ND 1YIJP 3OAKA 5APTA 1JNMA 5AW6B 5AW2B 1J2JB 1N73B 1KTMA 1L0NG 2GM4A 3WUVA 3L37A 3NXSA 3CD6P 1NJIQ 1UIXA 3CCMP 1SQXD 2JEEA 1RQUA 1D7MA 1NU1J 4H13C 1Q90D 1SFCB 1L0NE 2IBZD 1SQPG 1GU5A 5KLIB 2IBZG 4JPZB 1BGYD 1NTZJ 2YO3A 2H7HA 3P32A 2QIWA 1SQVD 4H44D 1URQC 4D6TJ 1NTMD 1VDFA 3GF7A 3T97A 3VMXA 4HH2A 1U57A 1NTMG 1L4AB 1SQPE 3M9BA 2FXOA 4DT0A 1LTGC 5GTHE 3BCCD 1PP9J 1S9KE 2O3JA 3RL0D 2Z5IA 3D71A 3N4XA 3V2NA 1S1CX 1KV4A 1FDMA 1Q2NA 2D2CB 3CWBG 2OYIB 2C9NY 1OZHA 4IL6X 1FZBA 1JY3O 1VF5C 3VYIA 1ZLLA 4XE5B 2K3RA 3O8ZA 2Q3EA 2XU6A 4BWNA 4EYYQ 4WY4A 2JWDA 1P84H 2PGDA 4H13D 2RKLA 1K8AQ 2KLVA 3CWBE 3M06A 2B89A 4OGQB 1Q7YQ 2R32A 1LP1B 3FGAD 3G4SP 1URQD 4EOTA 1PL5A 1QEXA 5C39A 3H32A 2BASA 2NRGA 1HGVA 4HJGH 2KZJA 1T3UA 2IZ1A 3BRTB 1JO5A 3AEAC 1JY3P 1M57D 1LTAC 4L73A 2FKWB 3H1KJ 3B4SA 4LLHA 3RK3B 3SWFA 1MKMA 1KFNA 3I55P 3MP7B 3HTKA 4Z1MH 3BATA 1CI6A 1S4XA 1ZV8A 1ZR2A 3HD7C 2M5AB 5CJ0A 3EFGA 4JYCA 2R5DA 2KK7A 1LT9C 2B88A 3GF3A 5AW3B 3G9RA 4AYCA 3FWNA 1LJ2A 2HG5D 5AW0B 4RO0A 1K9MQ 1T2KC 3PRJA 1Y47A 2RN0A 1HBWA 4AQRD 4M3LA 2PAJA 2JJLA 4IFDK 4L75A 1VQ8P 3L75E 1X79B 1YTZI 3M9HA 4C7NA 1SFCC 1RE3A 1IJDB 2YNYA 2AXTE 3HRNA 1SQQD 3VMYA 2HPCB 2WPRA 3AE8C 3CCSP 3D70A 1EZVD 2KXPB 3FKSH 3E1RA 2KUBA 4GIFA 2XNXA 4YTPC 1KYOH 2JO1A 1H89A 2YKPA 1EZVG 3E1IA 1L4AC 1VQ6P 1R8EA 3H1ID 1IFMA 2B9BA 1GZLA 3H1IG 2K88A 5KJ7D 2A06D 5KLVK 3H1JD 3AEFC 1EZVE 1LTJB 4OH8B 1QX8A 1FDOA 2A06G 2R44A 3CC2P 2OYIC 2OYOA 1T2KD 3H1JG 2W90A 1DIPA 1OW8A 4EIJA 3ZDMA 5AW4B 1S5LE 5BVZA 3H1IE 1H0TA 3AE9C 2FYUK 3NMDA 5AVVB 2A06E 1M8OB 1PFIA 1SFCD 4CPGA 3H1JE 3U1CA 1LT1A 2OYHB 1N7SB 1URQA 4OGQC 1QGKB 1FE6A 1FOSF 3IFMA 1JY2P 2JWAA 4IFMA 1ZRTE 3HE4B 2ZVNB 3D6ZA 3GW6A 3VOPA 5H2FE 2E5YA 5E79E 2A45I 1L4AD 1AFOA 2IZ0A 5AVXB 3L4FA 3P8MC 1HWTC 3U1AA 1K05A 3BASA 2H8PD 3SFDC 1IK9A 3CX5D 2XKMA 1N2DC 2YXQB 3LIDA 3H1LG 4XA4A 2ITAA 3RK3C 3MIWA 1EXJA 2W6BA 1IZNB 2WT7A 1R5SA 2Y9ZA 4QMAA 1IFPA 4IL6H 2KB7P 3CL3D 1EC5A 2J5UA 2ZYAA 4YPCA 1Q82Q 2Q7CA 4NPEA 3H1LE 3MD0A 2E43A 3B5NB 3L73E 3A5TA 5KLVG 4OGQD 3JSVC 3OFNH 1KQSO 3O6QA 2I8DA 4GDOA 2N9YB 3L71J 4UB6H 2BCCJ 2W27A 3B71A 4JYBA 4Y99B 1IFIA 2FYUD 5KAFH 3A0HE 2QJYC 1FOSE 5KLVE 4YXWH 5APQA 2FYUG 5APWA 5KKZC 1NTKK 2E76C 2MKVA 1EXIA 2QM8A 2KSJA 5GTIH 1BSHA 1KD1Q 1KB9D 1L0LJ 3G6EP 3VN0A 1YITP 3HD7A 2ZAEB 1KQFB 3RK3D 1PGOA 2N9BA 2FYUE 4HKZH 3AE5C 3CCEP 2G3AA 1LT9A 3OJAB 2J58A 2Z4EA 2WMMA 2YIUC 4OVNF 2KNCB 1JCDA 1OXZA 2QJKB 2IDBA 3Q3DA 4U3FJ 4C7RA 2FFDC 1KB9E 3AEBC 4DCKA 1LTJC 2P7JA 4H0LB 2E42A 2WSFJ 3RK3E 4W7YA 5CCGC 2P2UA 3U59A 5AW9B 1QL2A 4OWFA 3AE3C 2IPPA 1RF0C 5APSA 3RK2B 1VQ9P 1SS1A 1SFCA 4RJTA 3GG2A 2FBWC 3L72G 2IBZI 3TYYA 1FZCC 3AECC 1SQXJ 2SPZA 2GA1A 3HUSB 3SWYA 3ABVC 2OYHC 2E76D 1FDIA 1N7SC 1YYCA 1NU1K 1YBKA 3RBZA 1NOHA 3R4YA 1L4AA 2WZ7A 2A45H 1QLED 2I1JA 3L72E 2IFNA 1QVGO 1RF1B 1BGYJ 2AXCA 2Y0DA 1ZW0A 2K9JA 4W80A 3AE4C 1NTZK 1LGHB 1SQVJ 1LTTC 2M3BA 4C46A 1NTMJ 2XDJA 1JOCA 2QSIA 1W2BO 1MFZA 1FAVA 2HR3A 1NTKG 2OYIA 1FZGA 4HB1A 3KZIE 1KILE 3H1HG 2KYVA 3LW5H 3BCCJ 1SQPD 3AE7C 2Y9YA 3V2PA 1LNQA 5CCGD 1CW5A 2KS1A 3SSUA 3D6YA 4UB8H 1S9KD 4DZOA 1NTKE 4WVZA 1W2EA 1P84E 3CXHH 3H1HE 3E7KA 5AW5B 2LXCB 3B5NC 1HJBA 4RKUJ 1N7SD 1RQVA 1FJPA 1GW4A 3TNUA 5AVYB 2CPBA 4W7ZA 1SP4A 1J1DB 3MZWB 1GU4A 3CWBD 3Q1MA 1G2CB 3CLQA 5DJTB 2L91A 1U7JA 1JMMA 1S5LX 2J59M 1HVVA 1BDCA 3RL0g 1AJYA 1KORA 1SQBJ 1ZN5A 2WSSH 3V4WA 4ASUH 4PD4D 2W6JH 1KQGB 2WSFH 3PH0A 4N6JA 2O01H 1OMIA 1NTZG 1VQ5P 1RY3A 4JBZA 3S9OA 2O1JA 2C0XA 3JCUH 2QJKC 4I2LC 1BSNA 3B5ND 1XTCC 4ZKUA 3A7OA 1FZAA 1GDTA 2Q1KA 3GHGC 3WU2E 2P1JA 4PD4E 1NTZE 2BEZF 3PTZA 1PP9G 1EDLA 1AQ5A 3W68A 4K35A 4Y28J 3TDKA 1DEBA 4I7ZC 5CMZA 3L70D 2RQ6A 2HPCA 2K37A 1PGQA 3L70G 2GUSA 2HYNA 3L35A 1EZVI 1PP9E 1FZFA 4KT0J 1L2PA 2QM7A 1K73Q 2N1TB 1JEKA 5KAIE 3L75D 1VQKP 4YXDC 2VRSA 2Z5HA 1KYOE 1IC2A 2FY8A 5KJ7C 3A2AA 1SQQJ 3L75G 3KYQA 2O01N 3UIAA 5CBNA 1RE4C 3KXDA 4LGDE 1GMJA 4ASVA 1YJ9P 3L70E 3TSIA 1JMBA 1N73C 2FFDA 4BRYB 3VTPC 1LTJA 3CMEP 1EDKA 3H1IJ 5CCGA 1KN7A 1YJNP 3V4QA 1PGPA 1RF0A 3M91A 3TGUJ 1NYHA 2KLUA 1JTHB 3QWOC 4WB4A 2B87A 3V2RA 3PLNA 1FZCA 5KLIC 4DJGA 2PRRA 1DX7A 1KQLA 2OYHA 1KILB 3H1KG 1PV3A 2E74B 4PJ0E 1NAFA 4A7PA 1SVFA 4BXLA 1X22A 1UIIA 3HE4A 3S4RA 1YHQP 4JF7A 1DH3A 3C9IA 4N78E 1JY2O 2W8ZA 5AVWB 1S2EA 3V6IA 3HTKB 5CBOA 2WVRA 3H1KE 2M8RA 3II6A 1LTIC 1HJ0A 2D2CC 2YKOA 3L74J 3CX5I 1NWQA 3HE5A 3AE1C 2LXBA 1VQMP 1NHLA 1ZRTD 3OAAH 5TISH 1KMIZ 3OE7H 1AQTA 4ZKPA 3GMAA 5B5EH 4IL6E 1DD4A 1M1KQ 1VL2A 3W67A 3B5NA 5APUA 4C7NB 2AXTH 1NVOA 4H44B 4DOJA 2E5TA 1Q86Q 2XNDH 2WSCJ 2FYNB 1IFNA 2MJZA 2IYPA 1GL2B 2E75B 1HF9A 3M0DC 1BE3D 2QJPB 4UB6E 3H1LD 1BE3G 5KAFE 4PV1B 3RL0B 2YMYA 3L73D 5B66E 2YMKA 2H88C 4L76A 2D2CD 1J1EB 3USSA 3L73G 3MUDC 1ZMEC 2O1KA 1KB9I 5GTIE 1LTSC 1IO4A 1KZUB 2IX7C 3KQGA 3CMAP 3CCLP 1BE3E 2W83C 2N1TC 3Q5PA 1BCCJ 3VP8A 5KLVD 3CI9A 4H13B 2WPSA 1H8EH 2KNCA 1H0TB 1CZQA 3LW5J 1IK7A 1KFMA 2K9YA 1U7MA 1L0LK 4N3YB 3OW2O 2R5BA 2L5GB 2UWJE 1QL1A 3SWKA 3GHGA 2WSEJ 2PP6A 1DEEG 3A0BE 1FU1A 1Y8AA 2CPSA 1GK6A 3KHUA 3I56P 1RHZB 1VQOP 3V2QA 2A45G 1LWUB 1KILC 4RESB 1M1JB 2P58A 1SLQA 2E74C 2Q9IA 2HFED 5AVUB 1T3JA 1VF5B 3EFFK 5BU8B 5KJ7A 1Z56A 2N1TD 1KC8Q 1H88A 1VQLP 2NPSB 1RE4A 1SQXK 2WT7B 1OVUA 3M0AA 1N73A 1G1IA 3F89A 3IF4A 1K04A 3CX5H 2QG4A 2R3CA 1P84I 2HLOA 2ZYDA 1FC2C 2WTYA 1L0NJ 2O01J 2IFMA 3L71G 2BCCG 1GTWA 3L72D 3C8VA 3MGNA 3MHVA 1SQVK 2IYOA 3CC7P 1NTMK 2WSCH 3NTNA 3AEGC 3A0HH 2V4HA 1X0TA 3AEDC 5AW8B 1N8RQ 1VPCA 4ASWA 3OEHH 2XZRA 4UB8E 2ZT9B 4I1LA 3ITKA 1SQPJ 3L71E 2BCCE 1L0LG 3CCVP 3CXHE 1KILD 5CJ4A 5CCHC 1G1JA 2E74D 3NFQA 1N86A 1GL2C 3EWKA 1DD3A 1T8ZA 3HD7B 5M1BA 1QVFO 4KJMA 1NTKD 4U7JA 3L36A 1L0LE 4EI2A 1MUUA 1P84D 1G2CA 1A02J 4AUWA 2QJPC 1NKNA 1A02F 1YI2P 2LR2A 1TU3F 3H1HD 4U3FG 1AVOA 1LTBC 3CCJP 3KDPB 1KB9H 1BDDA 1VQ4P 1J1EC 1NGMB 3CWBJ 3Q2YA 4GOEA 3WUTA 1HTLC 5L8RJ 2ZJSE 1EDIA 2JDIH 2Q6QA 5APXA 2WSEH 2OTLP 4U3FE 2ZVOB 1XTGB 4PD4I 3VMAA 1GW3A 4B86A 3Q5RA 1SQXG 2ZFCA 5BU5A 4IOIH 3WMM0 2LKMA 1JY3N 1HH0A 1LP1A 3CCUP 1YTZT 3BRVB 2Y0EA 1SQBK 4ZNCA 5AVRB 2JP3A 3JCUE 1Y9BA 5CCHD 1BGYG 3M0DA 4Y99C 1SQXE 1SQVG 1GL2D 2HODB 2E75D 2YO2A 4O9BA 1KYOI 1WRGA 2IBZE 2K9JB 2WITA 1NU1D 2M0BA 4PV1D 1LWUC 1BGYE 3MUDA 3KZIH 3BCCG 1NU1G 1M1JC 1SQVE 2M5AA 1NTME 2N1TA 2AEJA 1NTZD 3WUUA 5DN6I 3R2PA 1OW6A 1AV1A 4D6TD 3L70J 4IFFA 2Q3IA 2NPSC 4L74A 4D6TG 2KS1B 3BCCE 1USEA 1OIPA 1NU1E 4GOFA 4HYTB 5DJUB 4BRYA 1ZXGA 3L75J 1E5WA
chains in the Genus database with same CATH topology
4YXWH 4QMAA 2RQ6A 3OAAH 3FKSH 1IFPA 5DN6I 4WVZA 2QE7H 3OFNH 1FS0E 4TLFA 3EFFK 2E5TA 2XOKH 3OE7H 2HLDH 3OEHH 2XNDH 1AQTA 1E79H 1BSHA 1BSNA 1JEKA 2E5YA 2CK3H 2WSSH 4ASUH 1H8EH 4DJGA 2W6JH 3PJSK 2RQ7A 3USSA 2V7QH 2JDIH 5FL7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXW H;  4QMA A;  2RQ6 A;  3OAA H;  3FKS H;  1IFP A;  5DN6 I;  4WVZ A;  2QE7 H;  3OFN H;  1FS0 E;  4TLF A;  3EFF K;  2E5T A;  2XOK H;  3OE7 H;  2HLD H;  3OEH H;  2XND H;  1AQT A;  1E79 H;  1BSH A;  1BSN A;  1JEK A;  2E5Y A;  2CK3 H;  2WSS H;  4ASU H;  1H8E H;  4DJG A;  2W6J H;  3PJS K;  2RQ7 A;  3USS A;  2V7Q H;  2JDI H;  5FL7 H; 
#chains in the Genus database with same CATH topology
 1PP9 D;  3TK1 A;  4H0L C;  3RGU A;  3AE2 C;  3T97 B;  4MN4 C;  1S3J A;  3AE6 C;  1R5L A;  3G71 P;  2XOK H;  1SQQ K;  1JTH A;  5GTH H;  1KYO D;  2BEQ D;  4D6T E;  3RK2 C;  3TNU B;  1OFC X;  4GKG A;  2AEM A;  3M9Q A;  1JCC A;  3F5H A;  4TLF A;  3HUS C;  2R3S A;  1KIL A;  2ZT9 C;  1SQB D;  3AEE C;  2V7Q J;  4WBA A;  4GOD A;  1E79 H;  2C0W A;  1SQB G;  3LIE A;  2P67 A;  2I1K A;  1RF1 C;  1AA0 A;  3QH9 A;  4WY4 B;  1VF5 D;  1JB0 J;  1PPJ D;  2Q5U A;  1NKZ B;  1X9V A;  1CSB A;  2NPS D;  2QA4 P;  1PPJ G;  3PP5 A;  1SQB E;  5CHX A;  1T6A A;  3N7N A;  1EQ7 A;  5AVS B;  4H0L D;  3WU2 H;  1JY2 N;  1HGZ A;  4N78 D;  2YKQ A;  3BVH A;  4PD4 H;  3H1J J;  3MTU E;  3H32 B;  2CK3 H;  5TIS E;  1PPJ E;  3H1K D;  1PZQ A;  2RQ7 A;  3RK2 D;  2C9L Y;  1ZOY C;  5AW1 B;  3SFE C;  2JKV A;  5TJH A;  2WQY C;  2QE7 H;  1N7S A;  2KIK A;  2QJY B;  1MV8 A;  1OVR A;  2FXP A;  1WT6 A;  5B5E E;  5KKZ B;  2Y0C A;  2AEF A;  2E76 B;  2ZT9 D;  5CCH A;  2PFX A;  1GL2 A;  5KAI H;  1VQ7 P;  1CI6 B;  1SQQ G;  4R4L A;  1J1D C;  2XV5 A;  5AVT B;  1ZR4 A;  1YQ3 C;  1H8A A;  4EDF A;  3HD7 D;  2YIU B;  1NAY A;  2KZI A;  4NPF X;  2NZ2 A;  1VQP P;  3TGU D;  2FYZ A;  1AVY A;  2WPQ A;  5EFW B;  1FS0 E;  1BE3 J;  1SQQ E;  2GUV A;  2FFD B;  2P10 A;  3TGU G;  3CPW O;  1YQ4 C;  4GT1 A;  5AW7 B;  3H1L J;  2G8Y A;  1OWA A;  3L73 J;  3IAO A;  5AVQ B;  1NH4 A;  1FJK A;  1WMK A;  3FXD A;  3A3Y B;  1PGJ A;  2OTK E;  3TGU E;  4WWI A;  2B87 B;  2ZXX A;  1FZC B;  2KOG A;  4K3A A;  3FWL A;  3FX0 A;  4PJ0 H;  1IFJ A;  1M7L A;  3G3Z A;  3PJS K;  5KLV J;  2V7Q H;  1IFD A;  2QRX A;  3KPE A;  1ZP0 C;  2OGU A;  1M90 Q;  3L74 D;  2H43 A;  4TT3 H;  2DW3 A;  3L74 G;  1FBM A;  1LWU A;  3VP9 A;  1HUC A;  1OX3 A;  2POH A;  2FYU J;  3IR9 A;  1M1J A;  1Q81 Q;  3V5B A;  3CC4 P;  1S5L H;  4LC1 A;  3HE5 B;  1OW7 A;  1M56 D;  2H89 C;  2K1A A;  1NO4 A;  2WWW A;  2OTJ P;  3L74 E;  2NPS A;  3K5B A;  3CCR P;  3S1K A;  2YXR B;  4WY4 C;  1RH5 B;  5APV A;  4JQ0 D;  1EDJ A;  1FZE A;  2KP8 A;  4I6M C;  1URQ B;  1USD A;  3I5C A;  3CX5 E;  3CXH I;  3P8C D;  5H2F H;  3TF5 A;  3H25 A;  3CCQ P;  5E79 H;  3RBX A;  2M3E A;  2OAR A;  3FXE A;  3GLM A;  2HLD H;  2QVA A;  4NPD A;  2QEX P;  4KHX A;  2RMZ A;  3HUS A;  1JUN A;  1VQN P;  1GK4 A;  1L0N K;  5B66 H;  3L72 J;  3EQ2 A;  1BCC D;  3P8C E;  1W5C E;  3OA7 A;  1RF1 A;  1BCC G;  1MFT A;  3VMZ A;  4R4M A;  3B8E B;  1GD2 E;  2RH0 A;  1SQP K;  3C1L A;  2KSE A;  2W6A A;  4WY4 D;  3L71 D;  2BCC D;  3CXH D;  3H6P A;  1X8Y A;  1BCC E;  2OQQ A;  3PHL A;  2WPV B;  1JM0 A;  1NTK J;  3O6Q B;  3A0B H;  1PIX A;  3GHG B;  2JR8 A;  3H1H J;  5AVZ B;  5KTB A;  1L0L D;  5APY A;  5K5G B;  4I7Z B;  1RE3 C;  3JC2 2;  4H44 C;  2ZYG A;  3P7K A;  3IN6 A;  2FYN C;  2FXM A;  2ZXE B;  2E75 C;  4XFJ A;  1MZ9 A;  4U3F D;  2KI7 B;  2HOD A;  5FL7 H;  1YJW P;  1N7L A;  1LT9 B;  4ZMD A;  1S72 P;  1OVV A;  4PV1 C;  3RL0 C;  3Q5S A;  1L0N D;  1YIJ P;  3OAK A;  5APT A;  1JNM A;  5AW6 B;  5AW2 B;  1J2J B;  1N73 B;  1KTM A;  1L0N G;  2GM4 A;  3WUV A;  3L37 A;  3NXS A;  3CD6 P;  1NJI Q;  1UIX A;  3CCM P;  1SQX D;  2JEE A;  1RQU A;  1D7M A;  1NU1 J;  4H13 C;  1Q90 D;  1SFC B;  1L0N E;  2IBZ D;  1SQP G;  1GU5 A;  5KLI B;  2IBZ G;  4JPZ B;  1BGY D;  1NTZ J;  2YO3 A;  2H7H A;  3P32 A;  2QIW A;  1SQV D;  4H44 D;  1URQ C;  4D6T J;  1NTM D;  1VDF A;  3GF7 A;  3T97 A;  3VMX A;  4HH2 A;  1U57 A;  1NTM G;  1L4A B;  1SQP E;  3M9B A;  2FXO A;  4DT0 A;  1LTG C;  5GTH E;  3BCC D;  1PP9 J;  1S9K E;  2O3J A;  3RL0 D;  2Z5I A;  3D71 A;  3N4X A;  3V2N A;  1S1C X;  1KV4 A;  1FDM A;  1Q2N A;  2D2C B;  3CWB G;  2OYI B;  2C9N Y;  1OZH A;  4IL6 X;  1FZB A;  1JY3 O;  1VF5 C;  3VYI A;  1ZLL A;  4XE5 B;  2K3R A;  3O8Z A;  2Q3E A;  2XU6 A;  4BWN A;  4EYY Q;  4WY4 A;  2JWD A;  1P84 H;  2PGD A;  4H13 D;  2RKL A;  1K8A Q;  2KLV A;  3CWB E;  3M06 A;  2B89 A;  4OGQ B;  1Q7Y Q;  2R32 A;  1LP1 B;  3FGA D;  3G4S P;  1URQ D;  4EOT A;  1PL5 A;  1QEX A;  5C39 A;  3H32 A;  2BAS A;  2NRG A;  1HGV A;  4HJG H;  2KZJ A;  1T3U A;  2IZ1 A;  3BRT B;  1JO5 A;  3AEA C;  1JY3 P;  1M57 D;  1LTA C;  4L73 A;  2FKW B;  3H1K J;  3B4S A;  4LLH A;  3RK3 B;  3SWF A;  1MKM A;  1KFN A;  3I55 P;  3MP7 B;  3HTK A;  4Z1M H;  3BAT A;  1CI6 A;  1S4X A;  1ZV8 A;  1ZR2 A;  3HD7 C;  2M5A B;  5CJ0 A;  3EFG A;  4JYC A;  2R5D A;  2KK7 A;  1LT9 C;  2B88 A;  3GF3 A;  5AW3 B;  3G9R A;  4AYC A;  3FWN A;  1LJ2 A;  2HG5 D;  5AW0 B;  4RO0 A;  1K9M Q;  1T2K C;  3PRJ A;  1Y47 A;  2RN0 A;  1HBW A;  4AQR D;  4M3L A;  2PAJ A;  2JJL A;  4IFD K;  4L75 A;  1VQ8 P;  3L75 E;  1X79 B;  1YTZ I;  3M9H A;  4C7N A;  1SFC C;  1RE3 A;  1IJD B;  2YNY A;  2AXT E;  3HRN A;  1SQQ D;  3VMY A;  2HPC B;  2WPR A;  3AE8 C;  3CCS P;  3D70 A;  1EZV D;  2KXP B;  3FKS H;  3E1R A;  2KUB A;  4GIF A;  2XNX A;  4YTP C;  1KYO H;  2JO1 A;  1H89 A;  2YKP A;  1EZV G;  3E1I A;  1L4A C;  1VQ6 P;  1R8E A;  3H1I D;  1IFM A;  2B9B A;  1GZL A;  3H1I G;  2K88 A;  5KJ7 D;  2A06 D;  5KLV K;  3H1J D;  3AEF C;  1EZV E;  1LTJ B;  4OH8 B;  1QX8 A;  1FDO A;  2A06 G;  2R44 A;  3CC2 P;  2OYI C;  2OYO A;  1T2K D;  3H1J G;  2W90 A;  1DIP A;  1OW8 A;  4EIJ A;  3ZDM A;  5AW4 B;  1S5L E;  5BVZ A;  3H1I E;  1H0T A;  3AE9 C;  2FYU K;  3NMD A;  5AVV B;  2A06 E;  1M8O B;  1PFI A;  1SFC D;  4CPG A;  3H1J E;  3U1C A;  1LT1 A;  2OYH B;  1N7S B;  1URQ A;  4OGQ C;  1QGK B;  1FE6 A;  1FOS F;  3IFM A;  1JY2 P;  2JWA A;  4IFM A;  1ZRT E;  3HE4 B;  2ZVN B;  3D6Z A;  3GW6 A;  3VOP A;  5H2F E;  2E5Y A;  5E79 E;  2A45 I;  1L4A D;  1AFO A;  2IZ0 A;  5AVX B;  3L4F A;  3P8M C;  1HWT C;  3U1A A;  1K05 A;  3BAS A;  2H8P D;  3SFD C;  1IK9 A;  3CX5 D;  2XKM A;  1N2D C;  2YXQ B;  3LID A;  3H1L G;  4XA4 A;  2ITA A;  3RK3 C;  3MIW A;  1EXJ A;  2W6B A;  1IZN B;  2WT7 A;  1R5S A;  2Y9Z A;  4QMA A;  1IFP A;  4IL6 H;  2KB7 P;  3CL3 D;  1EC5 A;  2J5U A;  2ZYA A;  4YPC A;  1Q82 Q;  2Q7C A;  4NPE A;  3H1L E;  3MD0 A;  2E43 A;  3B5N B;  3L73 E;  3A5T A;  5KLV G;  4OGQ D;  3JSV C;  3OFN H;  1KQS O;  3O6Q A;  2I8D A;  4GDO A;  2N9Y B;  3L71 J;  4UB6 H;  2BCC J;  2W27 A;  3B71 A;  4JYB A;  4Y99 B;  1IFI A;  2FYU D;  5KAF H;  3A0H E;  2QJY C;  1FOS E;  5KLV E;  4YXW H;  5APQ A;  2FYU G;  5APW A;  5KKZ C;  1NTK K;  2E76 C;  2MKV A;  1EXI A;  2QM8 A;  2KSJ A;  5GTI H;  1BSH A;  1KD1 Q;  1KB9 D;  1L0L J;  3G6E P;  3VN0 A;  1YIT P;  3HD7 A;  2ZAE B;  1KQF B;  3RK3 D;  1PGO A;  2N9B A;  2FYU E;  4HKZ H;  3AE5 C;  3CCE P;  2G3A A;  1LT9 A;  3OJA B;  2J58 A;  2Z4E A;  2WMM A;  2YIU C;  4OVN F;  2KNC B;  1JCD A;  1OXZ A;  2QJK B;  2IDB A;  3Q3D A;  4U3F J;  4C7R A;  2FFD C;  1KB9 E;  3AEB C;  4DCK A;  1LTJ C;  2P7J A;  4H0L B;  2E42 A;  2WSF J;  3RK3 E;  4W7Y A;  5CCG C;  2P2U A;  3U59 A;  5AW9 B;  1QL2 A;  4OWF A;  3AE3 C;  2IPP A;  1RF0 C;  5APS A;  3RK2 B;  1VQ9 P;  1SS1 A;  1SFC A;  4RJT A;  3GG2 A;  2FBW C;  3L72 G;  2IBZ I;  3TYY A;  1FZC C;  3AEC C;  1SQX J;  2SPZ A;  2GA1 A;  3HUS B;  3SWY A;  3ABV C;  2OYH C;  2E76 D;  1FDI A;  1N7S C;  1YYC A;  1NU1 K;  1YBK A;  3RBZ A;  1NOH A;  3R4Y A;  1L4A A;  2WZ7 A;  2A45 H;  1QLE D;  2I1J A;  3L72 E;  2IFN A;  1QVG O;  1RF1 B;  1BGY J;  2AXC A;  2Y0D A;  1ZW0 A;  2K9J A;  4W80 A;  3AE4 C;  1NTZ K;  1LGH B;  1SQV J;  1LTT C;  2M3B A;  4C46 A;  1NTM J;  2XDJ A;  1JOC A;  2QSI A;  1W2B O;  1MFZ A;  1FAV A;  2HR3 A;  1NTK G;  2OYI A;  1FZG A;  4HB1 A;  3KZI E;  1KIL E;  3H1H G;  2KYV A;  3LW5 H;  3BCC J;  1SQP D;  3AE7 C;  2Y9Y A;  3V2P A;  1LNQ A;  5CCG D;  1CW5 A;  2KS1 A;  3SSU A;  3D6Y A;  4UB8 H;  1S9K D;  4DZO A;  1NTK E;  4WVZ A;  1W2E A;  1P84 E;  3CXH H;  3H1H E;  3E7K A;  5AW5 B;  2LXC B;  3B5N C;  1HJB A;  4RKU J;  1N7S D;  1RQV A;  1FJP A;  1GW4 A;  3TNU A;  5AVY B;  2CPB A;  4W7Z A;  1SP4 A;  1J1D B;  3MZW B;  1GU4 A;  3CWB D;  3Q1M A;  1G2C B;  3CLQ A;  5DJT B;  2L91 A;  1U7J A;  1JMM A;  1S5L X;  2J59 M;  1HVV A;  1BDC A;  3RL0 g;  1AJY A;  1KOR A;  1SQB J;  1ZN5 A;  2WSS H;  3V4W A;  4ASU H;  4PD4 D;  2W6J H;  1KQG B;  2WSF H;  3PH0 A;  4N6J A;  2O01 H;  1OMI A;  1NTZ G;  1VQ5 P;  1RY3 A;  4JBZ A;  3S9O A;  2O1J A;  2C0X A;  3JCU H;  2QJK C;  4I2L C;  1BSN A;  3B5N D;  1XTC C;  4ZKU A;  3A7O A;  1FZA A;  1GDT A;  2Q1K A;  3GHG C;  3WU2 E;  2P1J A;  4PD4 E;  1NTZ E;  2BEZ F;  3PTZ A;  1PP9 G;  1EDL A;  1AQ5 A;  3W68 A;  4K35 A;  4Y28 J;  3TDK A;  1DEB A;  4I7Z C;  5CMZ A;  3L70 D;  2RQ6 A;  2HPC A;  2K37 A;  1PGQ A;  3L70 G;  2GUS A;  2HYN A;  3L35 A;  1EZV I;  1PP9 E;  1FZF A;  4KT0 J;  1L2P A;  2QM7 A;  1K73 Q;  2N1T B;  1JEK A;  5KAI E;  3L75 D;  1VQK P;  4YXD C;  2VRS A;  2Z5H A;  1KYO E;  1IC2 A;  2FY8 A;  5KJ7 C;  3A2A A;  1SQQ J;  3L75 G;  3KYQ A;  2O01 N;  3UIA A;  5CBN A;  1RE4 C;  3KXD A;  4LGD E;  1GMJ A;  4ASV A;  1YJ9 P;  3L70 E;  3TSI A;  1JMB A;  1N73 C;  2FFD A;  4BRY B;  3VTP C;  1LTJ A;  3CME P;  1EDK A;  3H1I J;  5CCG A;  1KN7 A;  1YJN P;  3V4Q A;  1PGP A;  1RF0 A;  3M91 A;  3TGU J;  1NYH A;  2KLU A;  1JTH B;  3QWO C;  4WB4 A;  2B87 A;  3V2R A;  3PLN A;  1FZC A;  5KLI C;  4DJG A;  2PRR A;  1DX7 A;  1KQL A;  2OYH A;  1KIL B;  3H1K G;  1PV3 A;  2E74 B;  4PJ0 E;  1NAF A;  4A7P A;  1SVF A;  4BXL A;  1X22 A;  1UII A;  3HE4 A;  3S4R A;  1YHQ P;  4JF7 A;  1DH3 A;  3C9I A;  4N78 E;  1JY2 O;  2W8Z A;  5AVW B;  1S2E A;  3V6I A;  3HTK B;  5CBO A;  2WVR A;  3H1K E;  2M8R A;  3II6 A;  1LTI C;  1HJ0 A;  2D2C C;  2YKO A;  3L74 J;  3CX5 I;  1NWQ A;  3HE5 A;  3AE1 C;  2LXB A;  1VQM P;  1NHL A;  1ZRT D;  3OAA H;  5TIS H;  1KMI Z;  3OE7 H;  1AQT A;  4ZKP A;  3GMA A;  5B5E H;  4IL6 E;  1DD4 A;  1M1K Q;  1VL2 A;  3W67 A;  3B5N A;  5APU A;  4C7N B;  2AXT H;  1NVO A;  4H44 B;  4DOJ A;  2E5T A;  1Q86 Q;  2XND H;  2WSC J;  2FYN B;  1IFN A;  2MJZ A;  2IYP A;  1GL2 B;  2E75 B;  1HF9 A;  3M0D C;  1BE3 D;  2QJP B;  4UB6 E;  3H1L D;  1BE3 G;  5KAF E;  4PV1 B;  3RL0 B;  2YMY A;  3L73 D;  5B66 E;  2YMK A;  2H88 C;  4L76 A;  2D2C D;  1J1E B;  3USS A;  3L73 G;  3MUD C;  1ZME C;  2O1K A;  1KB9 I;  5GTI E;  1LTS C;  1IO4 A;  1KZU B;  2IX7 C;  3KQG A;  3CMA P;  3CCL P;  1BE3 E;  2W83 C;  2N1T C;  3Q5P A;  1BCC J;  3VP8 A;  5KLV D;  3CI9 A;  4H13 B;  2WPS A;  1H8E H;  2KNC A;  1H0T B;  1CZQ A;  3LW5 J;  1IK7 A;  1KFM A;  2K9Y A;  1U7M A;  1L0L K;  4N3Y B;  3OW2 O;  2R5B A;  2L5G B;  2UWJ E;  1QL1 A;  3SWK A;  3GHG A;  2WSE J;  2PP6 A;  1DEE G;  3A0B E;  1FU1 A;  1Y8A A;  2CPS A;  1GK6 A;  3KHU A;  3I56 P;  1RHZ B;  1VQO P;  3V2Q A;  2A45 G;  1LWU B;  1KIL C;  4RES B;  1M1J B;  2P58 A;  1SLQ A;  2E74 C;  2Q9I A;  2HFE D;  5AVU B;  1T3J A;  1VF5 B;  3EFF K;  5BU8 B;  5KJ7 A;  1Z56 A;  2N1T D;  1KC8 Q;  1H88 A;  1VQL P;  2NPS B;  1RE4 A;  1SQX K;  2WT7 B;  1OVU A;  3M0A A;  1N73 A;  1G1I A;  3F89 A;  3IF4 A;  1K04 A;  3CX5 H;  2QG4 A;  2R3C A;  1P84 I;  2HLO A;  2ZYD A;  1FC2 C;  2WTY A;  1L0N J;  2O01 J;  2IFM A;  3L71 G;  2BCC G;  1GTW A;  3L72 D;  3C8V A;  3MGN A;  3MHV A;  1SQV K;  2IYO A;  3CC7 P;  1NTM K;  2WSC H;  3NTN A;  3AEG C;  3A0H H;  2V4H A;  1X0T A;  3AED C;  5AW8 B;  1N8R Q;  1VPC A;  4ASW A;  3OEH H;  2XZR A;  4UB8 E;  2ZT9 B;  4I1L A;  3ITK A;  1SQP J;  3L71 E;  2BCC E;  1L0L G;  3CCV P;  3CXH E;  1KIL D;  5CJ4 A;  5CCH C;  1G1J A;  2E74 D;  3NFQ A;  1N86 A;  1GL2 C;  3EWK A;  1DD3 A;  1T8Z A;  3HD7 B;  5M1B A;  1QVF O;  4KJM A;  1NTK D;  4U7J A;  3L36 A;  1L0L E;  4EI2 A;  1MUU A;  1P84 D;  1G2C A;  1A02 J;  4AUW A;  2QJP C;  1NKN A;  1A02 F;  1YI2 P;  2LR2 A;  1TU3 F;  3H1H D;  4U3F G;  1AVO A;  1LTB C;  3CCJ P;  3KDP B;  1KB9 H;  1BDD A;  1VQ4 P;  1J1E C;  1NGM B;  3CWB J;  3Q2Y A;  4GOE A;  3WUT A;  1HTL C;  5L8R J;  2ZJS E;  1EDI A;  2JDI H;  2Q6Q A;  5APX A;  2WSE H;  2OTL P;  4U3F E;  2ZVO B;  1XTG B;  4PD4 I;  3VMA A;  1GW3 A;  4B86 A;  3Q5R A;  1SQX G;  2ZFC A;  5BU5 A;  4IOI H;  3WMM 0;  2LKM A;  1JY3 N;  1HH0 A;  1LP1 A;  3CCU P;  1YTZ T;  3BRV B;  2Y0E A;  1SQB K;  4ZNC A;  5AVR B;  2JP3 A;  3JCU E;  1Y9B A;  5CCH D;  1BGY G;  3M0D A;  4Y99 C;  1SQX E;  1SQV G;  1GL2 D;  2HOD B;  2E75 D;  2YO2 A;  4O9B A;  1KYO I;  1WRG A;  2IBZ E;  2K9J B;  2WIT A;  1NU1 D;  2M0B A;  4PV1 D;  1LWU C;  1BGY E;  3MUD A;  3KZI H;  3BCC G;  1NU1 G;  1M1J C;  1SQV E;  2M5A A;  1NTM E;  2N1T A;  2AEJ A;  1NTZ D;  3WUU A;  5DN6 I;  3R2P A;  1OW6 A;  1AV1 A;  4D6T D;  3L70 J;  4IFF A;  2Q3I A;  2NPS C;  4L74 A;  4D6T G;  2KS1 B;  3BCC E;  1USE A;  1OIP A;  1NU1 E;  4GOF A;  4HYT B;  5DJU B;  4BRY A;  1ZXG A;  3L75 J;  1E5W A; 
#chains in the Genus database with same CATH homology
 4YXW H;  4QMA A;  2RQ6 A;  3OAA H;  3FKS H;  1IFP A;  5DN6 I;  4WVZ A;  2QE7 H;  3OFN H;  1FS0 E;  4TLF A;  3EFF K;  2E5T A;  2XOK H;  3OE7 H;  2HLD H;  3OEH H;  2XND H;  1AQT A;  1E79 H;  1BSH A;  1BSN A;  1JEK A;  2E5Y A;  2CK3 H;  2WSS H;  4ASU H;  1H8E H;  4DJG A;  2W6J H;  3PJS K;  2RQ7 A;  3USS A;  2V7Q H;  2JDI H;  5FL7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...