5FL7H

Structure of the f1c10 complex from yarrowia lipolytica atp synthase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
113
Chain Sequence
b'LTQSIYNQKEVTQVNIPSTAGELGILANHVPTIQQLKPGVVEVIETNGETKSYFISGGFATVQPDSELSVNSIEAFQAEDKSLTAEAQKNAQSADEAVAAEAEIELEVLEALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA
publication title Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
pubmed doi rcsb
molecule tags Hydrolase
total genus 11
structure length 113
sequence length 119
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 5fl7H01
2RQ6A 2WSSH 4ASUH 2XOKH 2RQ7A 1BSHA 4YXWH 5DN6I 1FS0E 2QE7H 1H8EH 1E79H 5FL7H 1BSNA 2V7QH 3OE7H 2E5YA 3OEHH 1AQTA 3FKSH 3OFNH 2XNDH 3OAAH 2HLDH
chains in the Genus database with same CATH superfamily
2RQ6A 2WSSH 4ASUH 2XOKH 2RQ7A 1BSHA 4YXWH 5DN6I 1FS0E 2QE7H 1H8EH 1E79H 5FL7H 1BSNA 2V7QH 3OE7H 2E5YA 3OEHH 1AQTA 3FKSH 3OFNH 2XNDH 3OAAH 2HLDH
chains in the Genus database with same CATH topology
2RQ6A 2WSSH 4ASUH 2XOKH 2RQ7A 1BSHA 4YXWH 5DN6I 1FS0E 2QE7H 1H8EH 1E79H 5FL7H 1BSNA 2V7QH 3OE7H 2E5YA 3OEHH 1AQTA 3FKSH 3OFNH 2XNDH 3OAAH 2HLDH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ6 A;  2WSS H;  4ASU H;  2XOK H;  2RQ7 A;  1BSH A;  4YXW H;  5DN6 I;  1FS0 E;  2QE7 H;  1H8E H;  1E79 H;  5FL7 H;  1BSN A;  2V7Q H;  3OE7 H;  2E5Y A;  3OEH H;  1AQT A;  3FKS H;  3OFN H;  2XND H;  3OAA H;  2HLD H; 
#chains in the Genus database with same CATH topology
 2RQ6 A;  2WSS H;  4ASU H;  2XOK H;  2RQ7 A;  1BSH A;  4YXW H;  5DN6 I;  1FS0 E;  2QE7 H;  1H8E H;  1E79 H;  5FL7 H;  1BSN A;  2V7Q H;  3OE7 H;  2E5Y A;  3OEH H;  1AQT A;  3FKS H;  3OFN H;  2XND H;  3OAA H;  2HLD H; 
#chains in the Genus database with same CATH homology
 2RQ6 A;  2WSS H;  4ASU H;  2XOK H;  2RQ7 A;  1BSH A;  4YXW H;  5DN6 I;  1FS0 E;  2QE7 H;  1H8E H;  1E79 H;  5FL7 H;  1BSN A;  2V7Q H;  3OE7 H;  2E5Y A;  3OEH H;  1AQT A;  3FKS H;  3OFN H;  2XND H;  3OAA H;  2HLD H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...