2WSSH

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 18
structure length 131
sequence length 131
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2wssH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2wssH01
1E79H 2WSSH 2W6JH 4WVZA 2E5YA 1BSHA 1AQTA 5DN6I 3OAAH 1JEKA 3EFFK 3OE7H 2V7QH 2CK3H 3USSA 4TLFA 2XNDH 1IFPA 2JDIH 3PJSK 3OFNH 2QE7H 4DJGA 2HLDH 4ASUH 1BSNA 3OEHH 4QMAA 2E5TA 2RQ6A 1H8EH 2RQ7A 3FKSH 2XOKH 5FL7H 1FS0E 4YXWH
chains in the Genus database with same CATH superfamily
2WMMA 2WPSA 1J1EB 1NAYA 1IJDB 1JY3O 1HJBA 2ZVOB 4C7NA 3USSA 2LKMA 2AEFA 1VQ4P 1EZVE 1N7SC 4HH2A 3E1RA 1AV1A 2FYNB 2JWDA 1J1DB 5KJ7A 1KQLA 1CZQA 3FXDA 2W6AA 2G3AA 3BATA 3HTKB 1GTWA 5KLVD 3MD0A 2A45I 3G9RA 4O9BA 3S9OA 4IOIH 1VQ6P 1KFMA 1S3JA 1JCCA 3RBXA 5CBNA 3CCLP 3H1LJ 3TNUB 2P7JA 3CXHE 4N78D 2KS1B 2OTJP 3H6PA 3B5ND 1PPJG 1XTGB 4D6TE 2ZJSE 3K5BA 1FZAA 3L71D 4ASWA 1K04A 1SQVJ 3A3YB 2PP6A 3PRJA 5CCHD 3VOPA 1M1JC 2KZJA 1JY2N 1VQMP 2XU6A 3KZIH 5M1BA 4U3FG 1RF1A 2E42A 2I8DA 1FU1A 3H1LE 3A0HE 2FXOA 3L75E 1G2CA 2OYHB 4WY4D 4OGQB 1KV4A 1FE6A 2C0WA 4EI2A 2IZ1A 5B66E 2AXTE 3L35A 1OFCX 3H1ID 1H8EH 3AE1C 3U1AA 3Q1MA 2E76B 3EFGA 1BSHA 3RL0C 3HUSA 3CD6P 3WU2E 4GDOA 1EZVI 5E79E 1S5LH 1KB9I 2CK3H 3BCCD 1H8AA 4TLFA 3M91A 5KLVJ 1USEA 2H88C 2YKPA 3S1KA 3D6ZA 3GG2A 1GL2A 4GOEA 4HJGH 3I56P 3R2PA 2LXBA 4JPZB 5AVSB 5KJ7D 1PZQA 2R5BA 2KIKA 1KC8Q 3L70D 4DT0A 1K8AQ 1NJIQ 3MUDC 3D6YA 1URQD 3B8EB 1KILD 3BCCG 1KFNA 5AVYB 1RF0C 3HE5B 4OH8B 1GK4A 2R32A 3L71J 2BCCJ 3KHUA 2E75B 1G2CB 2Y9ZA 2YNYA 1NTKJ 2K37A 5AVUB 3HE4A 4N78E 5AVRB 3OAKA 1FZCB 1PFIA 3RK3D 1YIJP 3CL3D 2JR8A 1RHZB 4PV1C 1LP1A 3L71E 2QEXP 1Y8AA 3H1IJ 1NTZG 5APYA 1GZLA 1LWUA 3H1KD 1N7SD 2KLUA 4H13B 4AQRD 2I1JA 2ITAA 1ZV8A 1NYHA 2YIUC 2HG5D 1L0NJ 2HLOA 2WSEH 1ZXGA 3HD7B 4IL6X 3IAOA 3H1JG 4JYBA 2HODB 3L74J 3P7KA 3H1IE 2HPCA 3H1KG 3NXSA 3PHLA 5CJ4A 1VQ8P 5GTIH 2POHA 4DJGA 3BCCE 2QIWA 3F5HA 3N7NA 1LNQA 2W6JH 3L4FA 3V2QA 2O1JA 1EDIA 1Q7YQ 2V4HA 2BEZF 4HB1A 1JMBA 2N1TB 5TISH 1TU3F 1N2DC 1WT6A 3L70E 5AW4B 2ZT9C 3KZIE 2FFDC 1W2EA 2OGUA 4WWIA 2GUSA 3CC7P 1RE4C 1SFCC 4M3LA 2OYIA 3O6QB 1LTJB 3HRNA 2KXPB 1JY2O 1SQPG 1LTIC 1NTZE 5CBOA 2W83C 3R4YA 1PGOA 3RK3E 2OQQA 1BDDA 3RL0D 5DJUB 2JP3A 2KP8A 1S5LE 2W8ZA 2WSCJ 4GKGA 2HPCB 1N73A 1RY3A 2B87A 4W7YA 2E74C 5APXA 1Q86Q 3A7OA 3H1KE 1Q82Q 2A45G 3L73D 3OW2O 1ZR4A 3MIWA 3JSVC 2PGDA 1BGYD 1SQQD 3TK1A 1VQ9P 1BCCG 2KSJA 1KQFB 2E5YA 1SQXG 1J1EC 4NPEA 3VMAA 3GHGC 3N4XA 1L4AA 4OVNF 2IYPA 3SWYA 1NTZK 3NTNA 5AW1B 3H32A 1H0TB 1R5SA 1U7JA 3LIDA 1DX7A 1HBWA 2FYNC 1Q90D 5APVA 2QG4A 1NTMD 1SQPE 1J1DC 1M7LA 5L8RJ 2WSEJ 3L37A 1FOSE 3U1CA 4PV1D 1VQKP 4ZKUA 4IFFA 4RO0A 1D7MA 3M9BA 2J59M 3E1IA 1NWQA 3A0BE 3M0DA 1JUNA 2MKVA 1N73B 1JNMA 2B87B 1JCDA 1GDTA 1YBKA 5KTBA 1Y47A 4BXLA 5GTHH 1IO4A 2XKMA 5AW6B 5AW7B 2XOKH 3VMXA 3OAAH 1YJWP 1VPCA 2BEQD 4TT3H 1FJPA 1SQQJ 4H44D 3AE9C 1BE3J 3B5NA 3Q2YA 2KUBA 1LT1A 2ZYDA 3GHGA 2DW3A 1BDCA 1UIXA 1FZBA 3JC22 2AEJA 5BU8B 1N8RQ 1SQXE 1JB0J 2OYHC 4OGQC 1VL2A 3CLQA 3V2NA 5APWA 5CCHA 1ZW0A 1SQPK 1KTMA 4K35A 2A06G 3L73E 1FZFA 2YKOA 2VRSA 4GODA 1BGYE 4UB8H 5TISE 1IZNB 4WY4A 4D6TG 3Q5RA 2E76C 2IBZD 2ZT9D 4HKZH 3PTZA 4NPFX 1SFCD 2C0XA 1EC5A 2QJKC 2NPSB 1PIXA 1FS0E 3BRTB 3WUTA 3H1LG 1OVVA 2XDJA 3L75G 3Q3DA 2QJPB 1NVOA 2D2CB 1NTME 4JBZA 3AE6C 1KB9E 1FBMA 1GU4A 3Q5PA 1K05A 3T97B 1SQVG 2QSIA 3C8VA 3ITKA 5B5EH 4KJMA 4YXWH 1E79H 1SQXK 4KHXA 2Y9YA 1PP9J 3I55P 3G3ZA 1KORA 2E75C 3ABVC 1JOCA 2Z5IA 1L2PA 2K9JA 1A02F 2LR2A 2Q7CA 1URQA 3AE5C 1OVRA 1KILA 3TGUD 4R4MA 1IC2A 1WMKA 1FZCC 4Y99B 1EQ7A 1ZP0C 1SQBJ 2A06E 1OMIA 2QA4P 1AFOA 1IFJA 3GF7A 4XE5B 3V5BA 5AW2B 5KKZB 1JY3P 4H13C 4WVZA 1P84H 5KLVG 4EIJA 3RK2B 2BCCD 3EFFK 4DCKA 4C46A 4W80A 2K3RA 2R3CA 2FYZA 1ZMEC 1KD1Q 2FBWC 1NTKD 3CI9A 3HD7C 4C7NB 1N7SA 2KOGA 2FYUD 1YQ3C 1CSBA 1FZGA 1LTTC 1LT9C 1EDLA 2FY8A 1YYCA 3CMEP 1FAVA 4YPCA 2IBZE 3CCQP 2QJYB 5TJHA 3L36A 3G4SP 3A5TA 3L71G 1SQVE 4UB6H 1X0TA 3P8CD 5GTHE 2YXRB 3S4RA 2QM7A 2N1TC 1L0ND 3TGUJ 2RQ6A 3FKSH 2OYOA 1S5LX 3PH0A 1P84D 2QRXA 3L74D 3H1IG 1YQ4C 3Q5SA 1LTJC 4OGQD 3RK3B 2GA1A 1JM0A 1M1JA 2WSCH 2Z4EA 2RQ7A 3RL0g 4RKUJ 4U3FJ 1AVOA 5CCGC 5KLVE 1OIPA 2JO1A 1RF1B 3TGUE 2RKLA 1HGZA 1VF5B 2WT7A 1KMIZ 3IFMA 4ZMDA 2N9YB 1Q81Q 3CMAP 3AE2C 1SQVK 1LTAC 1IFMA 3IF4A 2FYUJ 3L70G 3GW6A 3AECC 3AE3C 4BWNA 1IK7A 1SS1A 2BCCE 2P67A 2JDIH 3HUSB 5KAIH 3D71A 2XNXA 1G1JA 1GD2E 1QLED 1NTKE 2E43A 1H88A 3BASA 4I1LA 2IBZI 1JEKA 1OXZA 2H8PD 2OTKE 2R44A 1GL2B 1MFZA 3CWBD 3EWKA 1OX3A 3MP7B 2Q3EA 2E75D 4L76A 1G1IA 1M8OB 2Q6QA 3P8CE 1XTCC 1USDA 5KLVK 2IYOA 3MUDA 1NAFA 2Y0DA 4IL6H 4YTPC 3M0AA 2B89A 1CW5A 1RF0A 1DD4A 3AEBC 3G71P 1EXIA 3OJAB 2Y0CA 4Y28J 1L0NE 1E5WA 1IFIA 3GMAA 2M5AA 1QGKB 2CPBA 2O1KA 3HE4B 3A2AA 4H0LB 5KLIB 1NU1D 4H13D 1P84E 3P8MC 3L74E 1W5CE 2L91A 1VQOP 2KNCA 4EDFA 1LP1B 3RL0B 1Z56A 1L0LD 4KT0J 2JKVA 4IFDK 1KILE 3HD7D 1QL2A 3FGAD 4WBAA 1LWUB 2YO3A 4HYTB 4PJ0H 1S9KD 3MTUE 1YTZI 3TDKA 4UB6E 4AUWA 3EQ2A 3H1JJ 1HVVA 1N7LA 4A7PA 5CHXA 3CWBJ 1KYOH 1ZRTD 5AVVB 5BU5A 5EFWB 4XFJA 1RQUA 2N1TD 4U7JA 3PLNA 1RQVA 3V2RA 1JTHA 2HFED 2H89C 4LLHA 1CI6A 5AVQB 3TYYA 3D70A 1VDFA 1KN7A 4I7ZC 1LGHB 1Y9BA 3CCUP 3KDPB 1BE3D 2NPSC 1PL5A 1FJKA 1LTBC 1LTSC 1JY2P 2FFDA 1NU1J 4WB4A 2QJPC 5CJ0A 1MZ9A 1RE3C 2D2CC 2PRRA 1RE4A 2HLDH 1SFCA 3CX5H 2BASA 3L73G 2OYIB 2ZFCA 2ZVNB 5APSA 1L0LJ 1BGYG 1SQQG 2YIUB 1KZUB 3CXHH 3I5CA 3B4SA 1P84I 3C1LA 1LTGC 2L5GB 4GT1A 3VN0A 2YMKA 2XNDH 1KYOD 3KYQA 5KAIE 4H44B 4XA4A 1IFNA 4Y99C 4ASVA 4RESB 3AEEC 5H2FH 1SP4A 2WQYC 4MN4C 3CCJP 1IFPA 3L72D 3OEHH 1NTMG 4DOJA 2B9BA 3AE4C 2IPPA 1WRGA 1S9KE 5KKZC 5B66H 2CPSA 1PGQA 4BRYA 2YKQA 1BCCJ 3LW5H 3RK2C 1PP9D 2M8RA 3PJSK 3M9QA 3VTPC 4RJTA 2ZT9B 1R8EA 1YJ9P 1ZRTE 3CX5D 3W68A 2AXCA 4DZOA 3IN6A 5GTIE 1L4AB 3TSIA 1SFCB 1YJNP 2IX7C 3CXHD 1KQSO 3H32B 1GMJA 1OZHA 1X9VA 3CCSP 4L75A 1SQBD 3GLMA 1BSNA 2MJZA 2QJYC 3H1HD 1U57A 1AA0A 1MV8A 3RGUA 2O01H 1SQQE 5KJ7C 1BE3E 1M1KQ 1UIIA 3HTKA 2C9LY 5AW8B 2B88A 2WZ7A 1HJ0A 2SPZA 1MFTA 4I2LC 4GIFA 1ZR2A 1DD3A 4PJ0E 2KLVA 2K88A 2YO2A 2IFNA 3TNUA 2WITA 1N86A 2IDBA 1GK6A 1S2EA 3CPWO 1ZOYC 3V4WA 3VMZA 1T3JA 3L72J 3AEDC 3CC4P 2IBZG 4PD4H 2UWJE 2P10A 4Z1MH 1KYOE 3KQGA 2LXCB 3SWFA 3B5NB 2FKWB 1R5LA 3GHGB 1RF1C 2N9BA 3OE7H 2RMZA 2E74D 1OW6A 2OYHA 1VF5C 1YITP 1EXJA 3L72E 3CCMP 1HUCA 3CCEP 1SQQK 3H25A 2ZXEB 1PPJD 4L73A 1S72P 2NPSD 4D6TJ 3SFEC 1FOSF 4WY4B 2YXQB 2QE7H 3H1HJ 3FWLA 2Q9IA 1PP9E 3HUSC 5KAFH 4EOTA 2D2CD 2O3JA 2KSEA 3CX5E 3O8ZA 4U3FD 3WUUA 2ZXXA 2PAJA 2KB7P 4C7RA 1IFDA 3TGUG 1KQGB 1X79B 3L75J 1VQLP 1GL2C 1NTMK 1OWAA 4QMAA 1SQBE 4PD4D 3H1HE 4L74A 2WSFJ 3LW5J 1PV3A 4R4LA 5AW3B 3HE5A 5H2FE 2BCCG 3AEGC 3CC2P 2GUVA 4NPDA 5AW9B 2K9JB 1NTKG 1URQB 1M90Q 1KILB 1FDOA 1M57D 1FZCA 1S4XA 2FYUG 4H0LC 5KLIC 2HR3A 3JCUH 1KYOI 3RK2D 3FXEA 2O01J 2WTYA 2G8YA 1W2BO 5AW5B 3WUVA 3KXDA 4GOFA 1NH4A 2M3EA 1AQTA 1OVUA 1GU5A 1M56D 1LWUC 4LC1A 2QJKB 4JYCA 1SQBK 1AJYA 1HTLC 1MKMA 1HGVA 1L0NG 1NKZB 4UB8E 3HD7A 3NMDA 2P58A 1N7SB 2V7QH 1PPJE 2H7HA 1SVFA 2HODA 1LT9A 4N6JA 2E76D 2KYVA 3L74G 4IFMA 3MZWB 4YXDC 3CX5I 1T6AA 2ZYAA 1FZEA 3VYIA 2QM8A 1DIPA 5DN6I 1NTZD 3CXHI 4U3FE 3QH9A 4W7ZA 3ZDMA 2ZYGA 2R5DA 1VQPP 1GW3A 2P1JA 2N1TA 2Q5UA 1T2KC 4PD4E 5K5GB 5AVZB 3VP9A 2WPVB 4AYCA 2FYUE 5B5EE 3H1JD 1NO4A 5APQA 2HYNA 3QWOC 1OW8A 3MGNA 3A0BH 3KPEA 1QL1A 1QX8A 3O6QA 1LTJA 1VF5D 2OYIC 2WWWA 3PP5A 2M3BA 1M1JB 2H43A 3BCCJ 5CCGA 2KZIA 2JEEA 2A45H 3U59A 3C9IA 2WT7B 1LT9B 3VMYA 1JMMA 2Y0EA 2WSSH 3CWBG 4H44C 5KAFE 2XV5A 2Z5HA 2RH0A 1N73C 3L70J 2NZ2A 3V6IA 1DEBA 2J5UA 1X22A 2WPQA 3AEAC 5FL7H 1QVFO 1GL2D 1SQPD 2P2UA 1FDIA 2W27A 1NTKK 1NTZJ 3CCVP 2GM4A 2QVAA 2FYUK 3WMM0 4I6MC 1VQ7P 3II6A 1J2JB 5AVWB 1NU1G 3V2PA 2I1KA 5CMZA 3SSUA 1L4AC 3IR9A 3OA7A 1JY3N 3AEFC 1H0TA 1GW4A 1T8ZA 1HF9A 1L0LG 2PFXA 3E7KA 1EDJA 2M0BA 3H1KJ 3AE8C 2Q3IA 3JCUE 4H0LD 4PD4I 1DH3A 1L0NK 1RH5B 1YTZT 2OTLP 1EDKA 2YMYA 2W6BA 1QEXA 1DEEG 1KB9H 2W90A 2V7QJ 1YI2P 2KI7B 2M5AB 1BCCD 3NFQA 2FXPA 3M9HA 3H1JE 5AVXB 3M0DC 2E5TA 1SQXD 2RN0A 1S1CX 3CWBE 1JO5A 2IZ0A 2K9YA 2O01N 4PV1B 4N3YB 2KNCB 1YHQP 5CCGD 1A02J 2WVRA 2K1AA 2XZRA 3G6EP 2KK7A 3CCRP 1SQPJ 1PGPA 3BVHA 2WPRA 4ZKPA 1X8YA 2ZAEB 3LIEA 4B86A 1BE3G 5AVTB 3B5NC 3M06A 1VQNP 3F89A 3OFNH 1AVYA 3GF3A 1NU1E 4CPGA 5CCHC 1NGMB 1HWTC 3TF5A 1QVGO 1EZVD 1KB9D 1L0LE 1T2KD 2C9NY 3A0HH 4WY4C 3SWKA 1JTHB 3B71A 1CI6B 5C39A 4K3AA 1H89A 1VQ5P 3MHVA 1PGJA 1MUUA 2NPSA 2AXTH 2WSFH 4IL6E 1HH0A 1SQXJ 2R3SA 1EZVG 1U7MA 2JWAA 2FFDB 5BVZA 2JJLA 2J58A 4JF7A 1RE3A 3WU2H 5E79H 3V4QA 2A06D 1FDMA 2NRGA 3L72G 3L73J 3T97A 1BGYJ 1Q2NA 1K73Q 3AE7C 4D6TD 2AEMA 3BRVB 4EYYQ 1BCCE 1NU1K 1NOHA 3RBZA 4ZNCA 1ZN5A 1PP9G 3FWNA 3P32A 1FC2C 2Q1KA 1K9MQ 1AQ5A 5APUA 1T3UA 2IFMA 1ZLLA 3SFDC 1NHLA 1L0LK 1URQC 1KILC 1NKNA 3H1LD 4ASUH 3UIAA 3L75D 4JQ0D 2E74B 2OARA 4OWFA 1SQBG 2KS1A 1NTMJ 1IK9A 3H1HG 5AW0B 1SQVD 4I7ZB 1SLQA 1L4AD 2FXMA 1OW7A 3RK3C 4BRYB 3FX0A 5DJTB 5APTA 3W67A 4LGDE 3VP8A 1LJ2A
chains in the Genus database with same CATH topology
1E79H 2WSSH 2W6JH 4WVZA 2E5YA 1BSHA 1AQTA 5DN6I 3OAAH 1JEKA 3EFFK 3OE7H 2V7QH 2CK3H 3USSA 4TLFA 2XNDH 1IFPA 2JDIH 3PJSK 3OFNH 2QE7H 4DJGA 2HLDH 4ASUH 1BSNA 3OEHH 4QMAA 2E5TA 2RQ6A 1H8EH 2RQ7A 3FKSH 2XOKH 5FL7H 1FS0E 4YXWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E79 H;  2WSS H;  2W6J H;  4WVZ A;  2E5Y A;  1BSH A;  1AQT A;  5DN6 I;  3OAA H;  1JEK A;  3EFF K;  3OE7 H;  2V7Q H;  2CK3 H;  3USS A;  4TLF A;  2XND H;  1IFP A;  2JDI H;  3PJS K;  3OFN H;  2QE7 H;  4DJG A;  2HLD H;  4ASU H;  1BSN A;  3OEH H;  4QMA A;  2E5T A;  2RQ6 A;  1H8E H;  2RQ7 A;  3FKS H;  2XOK H;  5FL7 H;  1FS0 E;  4YXW H; 
#chains in the Genus database with same CATH topology
 2WMM A;  2WPS A;  1J1E B;  1NAY A;  1IJD B;  1JY3 O;  1HJB A;  2ZVO B;  4C7N A;  3USS A;  2LKM A;  2AEF A;  1VQ4 P;  1EZV E;  1N7S C;  4HH2 A;  3E1R A;  1AV1 A;  2FYN B;  2JWD A;  1J1D B;  5KJ7 A;  1KQL A;  1CZQ A;  3FXD A;  2W6A A;  2G3A A;  3BAT A;  3HTK B;  1GTW A;  5KLV D;  3MD0 A;  2A45 I;  3G9R A;  4O9B A;  3S9O A;  4IOI H;  1VQ6 P;  1KFM A;  1S3J A;  1JCC A;  3RBX A;  5CBN A;  3CCL P;  3H1L J;  3TNU B;  2P7J A;  3CXH E;  4N78 D;  2KS1 B;  2OTJ P;  3H6P A;  3B5N D;  1PPJ G;  1XTG B;  4D6T E;  2ZJS E;  3K5B A;  1FZA A;  3L71 D;  4ASW A;  1K04 A;  1SQV J;  3A3Y B;  2PP6 A;  3PRJ A;  5CCH D;  3VOP A;  1M1J C;  2KZJ A;  1JY2 N;  1VQM P;  2XU6 A;  3KZI H;  5M1B A;  4U3F G;  1RF1 A;  2E42 A;  2I8D A;  1FU1 A;  3H1L E;  3A0H E;  2FXO A;  3L75 E;  1G2C A;  2OYH B;  4WY4 D;  4OGQ B;  1KV4 A;  1FE6 A;  2C0W A;  4EI2 A;  2IZ1 A;  5B66 E;  2AXT E;  3L35 A;  1OFC X;  3H1I D;  1H8E H;  3AE1 C;  3U1A A;  3Q1M A;  2E76 B;  3EFG A;  1BSH A;  3RL0 C;  3HUS A;  3CD6 P;  3WU2 E;  4GDO A;  1EZV I;  5E79 E;  1S5L H;  1KB9 I;  2CK3 H;  3BCC D;  1H8A A;  4TLF A;  3M91 A;  5KLV J;  1USE A;  2H88 C;  2YKP A;  3S1K A;  3D6Z A;  3GG2 A;  1GL2 A;  4GOE A;  4HJG H;  3I56 P;  3R2P A;  2LXB A;  4JPZ B;  5AVS B;  5KJ7 D;  1PZQ A;  2R5B A;  2KIK A;  1KC8 Q;  3L70 D;  4DT0 A;  1K8A Q;  1NJI Q;  3MUD C;  3D6Y A;  1URQ D;  3B8E B;  1KIL D;  3BCC G;  1KFN A;  5AVY B;  1RF0 C;  3HE5 B;  4OH8 B;  1GK4 A;  2R32 A;  3L71 J;  2BCC J;  3KHU A;  2E75 B;  1G2C B;  2Y9Z A;  2YNY A;  1NTK J;  2K37 A;  5AVU B;  3HE4 A;  4N78 E;  5AVR B;  3OAK A;  1FZC B;  1PFI A;  3RK3 D;  1YIJ P;  3CL3 D;  2JR8 A;  1RHZ B;  4PV1 C;  1LP1 A;  3L71 E;  2QEX P;  1Y8A A;  3H1I J;  1NTZ G;  5APY A;  1GZL A;  1LWU A;  3H1K D;  1N7S D;  2KLU A;  4H13 B;  4AQR D;  2I1J A;  2ITA A;  1ZV8 A;  1NYH A;  2YIU C;  2HG5 D;  1L0N J;  2HLO A;  2WSE H;  1ZXG A;  3HD7 B;  4IL6 X;  3IAO A;  3H1J G;  4JYB A;  2HOD B;  3L74 J;  3P7K A;  3H1I E;  2HPC A;  3H1K G;  3NXS A;  3PHL A;  5CJ4 A;  1VQ8 P;  5GTI H;  2POH A;  4DJG A;  3BCC E;  2QIW A;  3F5H A;  3N7N A;  1LNQ A;  2W6J H;  3L4F A;  3V2Q A;  2O1J A;  1EDI A;  1Q7Y Q;  2V4H A;  2BEZ F;  4HB1 A;  1JMB A;  2N1T B;  5TIS H;  1TU3 F;  1N2D C;  1WT6 A;  3L70 E;  5AW4 B;  2ZT9 C;  3KZI E;  2FFD C;  1W2E A;  2OGU A;  4WWI A;  2GUS A;  3CC7 P;  1RE4 C;  1SFC C;  4M3L A;  2OYI A;  3O6Q B;  1LTJ B;  3HRN A;  2KXP B;  1JY2 O;  1SQP G;  1LTI C;  1NTZ E;  5CBO A;  2W83 C;  3R4Y A;  1PGO A;  3RK3 E;  2OQQ A;  1BDD A;  3RL0 D;  5DJU B;  2JP3 A;  2KP8 A;  1S5L E;  2W8Z A;  2WSC J;  4GKG A;  2HPC B;  1N73 A;  1RY3 A;  2B87 A;  4W7Y A;  2E74 C;  5APX A;  1Q86 Q;  3A7O A;  3H1K E;  1Q82 Q;  2A45 G;  3L73 D;  3OW2 O;  1ZR4 A;  3MIW A;  3JSV C;  2PGD A;  1BGY D;  1SQQ D;  3TK1 A;  1VQ9 P;  1BCC G;  2KSJ A;  1KQF B;  2E5Y A;  1SQX G;  1J1E C;  4NPE A;  3VMA A;  3GHG C;  3N4X A;  1L4A A;  4OVN F;  2IYP A;  3SWY A;  1NTZ K;  3NTN A;  5AW1 B;  3H32 A;  1H0T B;  1R5S A;  1U7J A;  3LID A;  1DX7 A;  1HBW A;  2FYN C;  1Q90 D;  5APV A;  2QG4 A;  1NTM D;  1SQP E;  1J1D C;  1M7L A;  5L8R J;  2WSE J;  3L37 A;  1FOS E;  3U1C A;  4PV1 D;  1VQK P;  4ZKU A;  4IFF A;  4RO0 A;  1D7M A;  3M9B A;  2J59 M;  3E1I A;  1NWQ A;  3A0B E;  3M0D A;  1JUN A;  2MKV A;  1N73 B;  1JNM A;  2B87 B;  1JCD A;  1GDT A;  1YBK A;  5KTB A;  1Y47 A;  4BXL A;  5GTH H;  1IO4 A;  2XKM A;  5AW6 B;  5AW7 B;  2XOK H;  3VMX A;  3OAA H;  1YJW P;  1VPC A;  2BEQ D;  4TT3 H;  1FJP A;  1SQQ J;  4H44 D;  3AE9 C;  1BE3 J;  3B5N A;  3Q2Y A;  2KUB A;  1LT1 A;  2ZYD A;  3GHG A;  2DW3 A;  1BDC A;  1UIX A;  1FZB A;  3JC2 2;  2AEJ A;  5BU8 B;  1N8R Q;  1SQX E;  1JB0 J;  2OYH C;  4OGQ C;  1VL2 A;  3CLQ A;  3V2N A;  5APW A;  5CCH A;  1ZW0 A;  1SQP K;  1KTM A;  4K35 A;  2A06 G;  3L73 E;  1FZF A;  2YKO A;  2VRS A;  4GOD A;  1BGY E;  4UB8 H;  5TIS E;  1IZN B;  4WY4 A;  4D6T G;  3Q5R A;  2E76 C;  2IBZ D;  2ZT9 D;  4HKZ H;  3PTZ A;  4NPF X;  1SFC D;  2C0X A;  1EC5 A;  2QJK C;  2NPS B;  1PIX A;  1FS0 E;  3BRT B;  3WUT A;  3H1L G;  1OVV A;  2XDJ A;  3L75 G;  3Q3D A;  2QJP B;  1NVO A;  2D2C B;  1NTM E;  4JBZ A;  3AE6 C;  1KB9 E;  1FBM A;  1GU4 A;  3Q5P A;  1K05 A;  3T97 B;  1SQV G;  2QSI A;  3C8V A;  3ITK A;  5B5E H;  4KJM A;  4YXW H;  1E79 H;  1SQX K;  4KHX A;  2Y9Y A;  1PP9 J;  3I55 P;  3G3Z A;  1KOR A;  2E75 C;  3ABV C;  1JOC A;  2Z5I A;  1L2P A;  2K9J A;  1A02 F;  2LR2 A;  2Q7C A;  1URQ A;  3AE5 C;  1OVR A;  1KIL A;  3TGU D;  4R4M A;  1IC2 A;  1WMK A;  1FZC C;  4Y99 B;  1EQ7 A;  1ZP0 C;  1SQB J;  2A06 E;  1OMI A;  2QA4 P;  1AFO A;  1IFJ A;  3GF7 A;  4XE5 B;  3V5B A;  5AW2 B;  5KKZ B;  1JY3 P;  4H13 C;  4WVZ A;  1P84 H;  5KLV G;  4EIJ A;  3RK2 B;  2BCC D;  3EFF K;  4DCK A;  4C46 A;  4W80 A;  2K3R A;  2R3C A;  2FYZ A;  1ZME C;  1KD1 Q;  2FBW C;  1NTK D;  3CI9 A;  3HD7 C;  4C7N B;  1N7S A;  2KOG A;  2FYU D;  1YQ3 C;  1CSB A;  1FZG A;  1LTT C;  1LT9 C;  1EDL A;  2FY8 A;  1YYC A;  3CME P;  1FAV A;  4YPC A;  2IBZ E;  3CCQ P;  2QJY B;  5TJH A;  3L36 A;  3G4S P;  3A5T A;  3L71 G;  1SQV E;  4UB6 H;  1X0T A;  3P8C D;  5GTH E;  2YXR B;  3S4R A;  2QM7 A;  2N1T C;  1L0N D;  3TGU J;  2RQ6 A;  3FKS H;  2OYO A;  1S5L X;  3PH0 A;  1P84 D;  2QRX A;  3L74 D;  3H1I G;  1YQ4 C;  3Q5S A;  1LTJ C;  4OGQ D;  3RK3 B;  2GA1 A;  1JM0 A;  1M1J A;  2WSC H;  2Z4E A;  2RQ7 A;  3RL0 g;  4RKU J;  4U3F J;  1AVO A;  5CCG C;  5KLV E;  1OIP A;  2JO1 A;  1RF1 B;  3TGU E;  2RKL A;  1HGZ A;  1VF5 B;  2WT7 A;  1KMI Z;  3IFM A;  4ZMD A;  2N9Y B;  1Q81 Q;  3CMA P;  3AE2 C;  1SQV K;  1LTA C;  1IFM A;  3IF4 A;  2FYU J;  3L70 G;  3GW6 A;  3AEC C;  3AE3 C;  4BWN A;  1IK7 A;  1SS1 A;  2BCC E;  2P67 A;  2JDI H;  3HUS B;  5KAI H;  3D71 A;  2XNX A;  1G1J A;  1GD2 E;  1QLE D;  1NTK E;  2E43 A;  1H88 A;  3BAS A;  4I1L A;  2IBZ I;  1JEK A;  1OXZ A;  2H8P D;  2OTK E;  2R44 A;  1GL2 B;  1MFZ A;  3CWB D;  3EWK A;  1OX3 A;  3MP7 B;  2Q3E A;  2E75 D;  4L76 A;  1G1I A;  1M8O B;  2Q6Q A;  3P8C E;  1XTC C;  1USD A;  5KLV K;  2IYO A;  3MUD A;  1NAF A;  2Y0D A;  4IL6 H;  4YTP C;  3M0A A;  2B89 A;  1CW5 A;  1RF0 A;  1DD4 A;  3AEB C;  3G71 P;  1EXI A;  3OJA B;  2Y0C A;  4Y28 J;  1L0N E;  1E5W A;  1IFI A;  3GMA A;  2M5A A;  1QGK B;  2CPB A;  2O1K A;  3HE4 B;  3A2A A;  4H0L B;  5KLI B;  1NU1 D;  4H13 D;  1P84 E;  3P8M C;  3L74 E;  1W5C E;  2L91 A;  1VQO P;  2KNC A;  4EDF A;  1LP1 B;  3RL0 B;  1Z56 A;  1L0L D;  4KT0 J;  2JKV A;  4IFD K;  1KIL E;  3HD7 D;  1QL2 A;  3FGA D;  4WBA A;  1LWU B;  2YO3 A;  4HYT B;  4PJ0 H;  1S9K D;  3MTU E;  1YTZ I;  3TDK A;  4UB6 E;  4AUW A;  3EQ2 A;  3H1J J;  1HVV A;  1N7L A;  4A7P A;  5CHX A;  3CWB J;  1KYO H;  1ZRT D;  5AVV B;  5BU5 A;  5EFW B;  4XFJ A;  1RQU A;  2N1T D;  4U7J A;  3PLN A;  1RQV A;  3V2R A;  1JTH A;  2HFE D;  2H89 C;  4LLH A;  1CI6 A;  5AVQ B;  3TYY A;  3D70 A;  1VDF A;  1KN7 A;  4I7Z C;  1LGH B;  1Y9B A;  3CCU P;  3KDP B;  1BE3 D;  2NPS C;  1PL5 A;  1FJK A;  1LTB C;  1LTS C;  1JY2 P;  2FFD A;  1NU1 J;  4WB4 A;  2QJP C;  5CJ0 A;  1MZ9 A;  1RE3 C;  2D2C C;  2PRR A;  1RE4 A;  2HLD H;  1SFC A;  3CX5 H;  2BAS A;  3L73 G;  2OYI B;  2ZFC A;  2ZVN B;  5APS A;  1L0L J;  1BGY G;  1SQQ G;  2YIU B;  1KZU B;  3CXH H;  3I5C A;  3B4S A;  1P84 I;  3C1L A;  1LTG C;  2L5G B;  4GT1 A;  3VN0 A;  2YMK A;  2XND H;  1KYO D;  3KYQ A;  5KAI E;  4H44 B;  4XA4 A;  1IFN A;  4Y99 C;  4ASV A;  4RES B;  3AEE C;  5H2F H;  1SP4 A;  2WQY C;  4MN4 C;  3CCJ P;  1IFP A;  3L72 D;  3OEH H;  1NTM G;  4DOJ A;  2B9B A;  3AE4 C;  2IPP A;  1WRG A;  1S9K E;  5KKZ C;  5B66 H;  2CPS A;  1PGQ A;  4BRY A;  2YKQ A;  1BCC J;  3LW5 H;  3RK2 C;  1PP9 D;  2M8R A;  3PJS K;  3M9Q A;  3VTP C;  4RJT A;  2ZT9 B;  1R8E A;  1YJ9 P;  1ZRT E;  3CX5 D;  3W68 A;  2AXC A;  4DZO A;  3IN6 A;  5GTI E;  1L4A B;  3TSI A;  1SFC B;  1YJN P;  2IX7 C;  3CXH D;  1KQS O;  3H32 B;  1GMJ A;  1OZH A;  1X9V A;  3CCS P;  4L75 A;  1SQB D;  3GLM A;  1BSN A;  2MJZ A;  2QJY C;  3H1H D;  1U57 A;  1AA0 A;  1MV8 A;  3RGU A;  2O01 H;  1SQQ E;  5KJ7 C;  1BE3 E;  1M1K Q;  1UII A;  3HTK A;  2C9L Y;  5AW8 B;  2B88 A;  2WZ7 A;  1HJ0 A;  2SPZ A;  1MFT A;  4I2L C;  4GIF A;  1ZR2 A;  1DD3 A;  4PJ0 E;  2KLV A;  2K88 A;  2YO2 A;  2IFN A;  3TNU A;  2WIT A;  1N86 A;  2IDB A;  1GK6 A;  1S2E A;  3CPW O;  1ZOY C;  3V4W A;  3VMZ A;  1T3J A;  3L72 J;  3AED C;  3CC4 P;  2IBZ G;  4PD4 H;  2UWJ E;  2P10 A;  4Z1M H;  1KYO E;  3KQG A;  2LXC B;  3SWF A;  3B5N B;  2FKW B;  1R5L A;  3GHG B;  1RF1 C;  2N9B A;  3OE7 H;  2RMZ A;  2E74 D;  1OW6 A;  2OYH A;  1VF5 C;  1YIT P;  1EXJ A;  3L72 E;  3CCM P;  1HUC A;  3CCE P;  1SQQ K;  3H25 A;  2ZXE B;  1PPJ D;  4L73 A;  1S72 P;  2NPS D;  4D6T J;  3SFE C;  1FOS F;  4WY4 B;  2YXQ B;  2QE7 H;  3H1H J;  3FWL A;  2Q9I A;  1PP9 E;  3HUS C;  5KAF H;  4EOT A;  2D2C D;  2O3J A;  2KSE A;  3CX5 E;  3O8Z A;  4U3F D;  3WUU A;  2ZXX A;  2PAJ A;  2KB7 P;  4C7R A;  1IFD A;  3TGU G;  1KQG B;  1X79 B;  3L75 J;  1VQL P;  1GL2 C;  1NTM K;  1OWA A;  4QMA A;  1SQB E;  4PD4 D;  3H1H E;  4L74 A;  2WSF J;  3LW5 J;  1PV3 A;  4R4L A;  5AW3 B;  3HE5 A;  5H2F E;  2BCC G;  3AEG C;  3CC2 P;  2GUV A;  4NPD A;  5AW9 B;  2K9J B;  1NTK G;  1URQ B;  1M90 Q;  1KIL B;  1FDO A;  1M57 D;  1FZC A;  1S4X A;  2FYU G;  4H0L C;  5KLI C;  2HR3 A;  3JCU H;  1KYO I;  3RK2 D;  3FXE A;  2O01 J;  2WTY A;  2G8Y A;  1W2B O;  5AW5 B;  3WUV A;  3KXD A;  4GOF A;  1NH4 A;  2M3E A;  1AQT A;  1OVU A;  1GU5 A;  1M56 D;  1LWU C;  4LC1 A;  2QJK B;  4JYC A;  1SQB K;  1AJY A;  1HTL C;  1MKM A;  1HGV A;  1L0N G;  1NKZ B;  4UB8 E;  3HD7 A;  3NMD A;  2P58 A;  1N7S B;  2V7Q H;  1PPJ E;  2H7H A;  1SVF A;  2HOD A;  1LT9 A;  4N6J A;  2E76 D;  2KYV A;  3L74 G;  4IFM A;  3MZW B;  4YXD C;  3CX5 I;  1T6A A;  2ZYA A;  1FZE A;  3VYI A;  2QM8 A;  1DIP A;  5DN6 I;  1NTZ D;  3CXH I;  4U3F E;  3QH9 A;  4W7Z A;  3ZDM A;  2ZYG A;  2R5D A;  1VQP P;  1GW3 A;  2P1J A;  2N1T A;  2Q5U A;  1T2K C;  4PD4 E;  5K5G B;  5AVZ B;  3VP9 A;  2WPV B;  4AYC A;  2FYU E;  5B5E E;  3H1J D;  1NO4 A;  5APQ A;  2HYN A;  3QWO C;  1OW8 A;  3MGN A;  3A0B H;  3KPE A;  1QL1 A;  1QX8 A;  3O6Q A;  1LTJ A;  1VF5 D;  2OYI C;  2WWW A;  3PP5 A;  2M3B A;  1M1J B;  2H43 A;  3BCC J;  5CCG A;  2KZI A;  2JEE A;  2A45 H;  3U59 A;  3C9I A;  2WT7 B;  1LT9 B;  3VMY A;  1JMM A;  2Y0E A;  2WSS H;  3CWB G;  4H44 C;  5KAF E;  2XV5 A;  2Z5H A;  2RH0 A;  1N73 C;  3L70 J;  2NZ2 A;  3V6I A;  1DEB A;  2J5U A;  1X22 A;  2WPQ A;  3AEA C;  5FL7 H;  1QVF O;  1GL2 D;  1SQP D;  2P2U A;  1FDI A;  2W27 A;  1NTK K;  1NTZ J;  3CCV P;  2GM4 A;  2QVA A;  2FYU K;  3WMM 0;  4I6M C;  1VQ7 P;  3II6 A;  1J2J B;  5AVW B;  1NU1 G;  3V2P A;  2I1K A;  5CMZ A;  3SSU A;  1L4A C;  3IR9 A;  3OA7 A;  1JY3 N;  3AEF C;  1H0T A;  1GW4 A;  1T8Z A;  1HF9 A;  1L0L G;  2PFX A;  3E7K A;  1EDJ A;  2M0B A;  3H1K J;  3AE8 C;  2Q3I A;  3JCU E;  4H0L D;  4PD4 I;  1DH3 A;  1L0N K;  1RH5 B;  1YTZ T;  2OTL P;  1EDK A;  2YMY A;  2W6B A;  1QEX A;  1DEE G;  1KB9 H;  2W90 A;  2V7Q J;  1YI2 P;  2KI7 B;  2M5A B;  1BCC D;  3NFQ A;  2FXP A;  3M9H A;  3H1J E;  5AVX B;  3M0D C;  2E5T A;  1SQX D;  2RN0 A;  1S1C X;  3CWB E;  1JO5 A;  2IZ0 A;  2K9Y A;  2O01 N;  4PV1 B;  4N3Y B;  2KNC B;  1YHQ P;  5CCG D;  1A02 J;  2WVR A;  2K1A A;  2XZR A;  3G6E P;  2KK7 A;  3CCR P;  1SQP J;  1PGP A;  3BVH A;  2WPR A;  4ZKP A;  1X8Y A;  2ZAE B;  3LIE A;  4B86 A;  1BE3 G;  5AVT B;  3B5N C;  3M06 A;  1VQN P;  3F89 A;  3OFN H;  1AVY A;  3GF3 A;  1NU1 E;  4CPG A;  5CCH C;  1NGM B;  1HWT C;  3TF5 A;  1QVG O;  1EZV D;  1KB9 D;  1L0L E;  1T2K D;  2C9N Y;  3A0H H;  4WY4 C;  3SWK A;  1JTH B;  3B71 A;  1CI6 B;  5C39 A;  4K3A A;  1H89 A;  1VQ5 P;  3MHV A;  1PGJ A;  1MUU A;  2NPS A;  2AXT H;  2WSF H;  4IL6 E;  1HH0 A;  1SQX J;  2R3S A;  1EZV G;  1U7M A;  2JWA A;  2FFD B;  5BVZ A;  2JJL A;  2J58 A;  4JF7 A;  1RE3 A;  3WU2 H;  5E79 H;  3V4Q A;  2A06 D;  1FDM A;  2NRG A;  3L72 G;  3L73 J;  3T97 A;  1BGY J;  1Q2N A;  1K73 Q;  3AE7 C;  4D6T D;  2AEM A;  3BRV B;  4EYY Q;  1BCC E;  1NU1 K;  1NOH A;  3RBZ A;  4ZNC A;  1ZN5 A;  1PP9 G;  3FWN A;  3P32 A;  1FC2 C;  2Q1K A;  1K9M Q;  1AQ5 A;  5APU A;  1T3U A;  2IFM A;  1ZLL A;  3SFD C;  1NHL A;  1L0L K;  1URQ C;  1KIL C;  1NKN A;  3H1L D;  4ASU H;  3UIA A;  3L75 D;  4JQ0 D;  2E74 B;  2OAR A;  4OWF A;  1SQB G;  2KS1 A;  1NTM J;  1IK9 A;  3H1H G;  5AW0 B;  1SQV D;  4I7Z B;  1SLQ A;  1L4A D;  2FXM A;  1OW7 A;  3RK3 C;  4BRY B;  3FX0 A;  5DJT B;  5APT A;  3W67 A;  4LGD E;  3VP8 A;  1LJ2 A; 
#chains in the Genus database with same CATH homology
 1E79 H;  2WSS H;  2W6J H;  4WVZ A;  2E5Y A;  1BSH A;  1AQT A;  5DN6 I;  3OAA H;  1JEK A;  3EFF K;  3OE7 H;  2V7Q H;  2CK3 H;  3USS A;  4TLF A;  2XND H;  1IFP A;  2JDI H;  3PJS K;  3OFN H;  2QE7 H;  4DJG A;  2HLD H;  4ASU H;  1BSN A;  3OEH H;  4QMA A;  2E5T A;  2RQ6 A;  1H8E H;  2RQ7 A;  3FKS H;  2XOK H;  5FL7 H;  1FS0 E;  4YXW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...