2WSSH

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
QMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
total genus 18
structure length 131
sequence length 131
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2wssH02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2wssH01
2HLDH 3OFNH 3OE7H 1BSHA 3OAAH 4QMAA 2XOKH 3USSA 2E5YA 1IFPA 3EFFK 4TLFA 5FL7H 3OEHH 1JEKA 2JDIH 4ASUH 2CK3H 5DN6I 4YXWH 1AQTA 2E5TA 2RQ6A 4DJGA 1E79H 4WVZA 3FKSH 1BSNA 2QE7H 2V7QH 2XNDH 2RQ7A 1H8EH 2W6JH 1FS0E 3PJSK 2WSSH
chains in the Genus database with same CATH superfamily
1UIXA 5CCGD 1QLED 1KB9I 2Y0CA 1SQXG 2Y0EA 2QSIA 2MJZA 3HD7D 5M1BA 2JEEA 2A06E 1URQB 3CWBG 3VMYA 2WMMA 1FJKA 2ZYGA 3VMAA 3H1KD 1MZ9A 3CL3D 1ZR2A 1WT6A 1IFIA 2IZ0A 2QRXA 1NTKD 4Y99C 4IL6E 1KYOE 1X0TA 1SP4A 2K9JB 1QEXA 1N7SB 1EDJA 3V2QA 1NTKJ 1FJPA 2FFDC 4ASWA 3OE7H 2CPSA 4QMAA 1DH3A 3M06A 1FDIA 1NTZK 3U59A 3H1KE 1X79B 1S1CX 2N9YB 2E5TA 1KQFB 2E74B 3HE5B 3H1JD 4NPFX 2KLUA 4GDOA 3W68A 1SQXK 1JEKA 2XU6A 2WQYC 3CCMP 3H1JJ 2AEFA 3AEDC 1PP9G 3HUSA 1T2KC 1EZVG 2I1KA 3USSA 3V2PA 1ZOYC 1JMBA 5AVWB 1GU4A 4U3FG 3HE4A 3Q1MA 3MP7B 2G3AA 5GTHH 1KZUB 3JCUH 1VQMP 3L75D 5CCGC 3SWYA 3H1ID 3RBZA 2HPCB 3H1LG 2QJYC 1HTLC 2IBZI 5FL7H 2HLOA 2JWDA 1M90Q 3RL0B 1OMIA 1BE3G 1JY3O 1KORA 1H8AA 5KAFH 3L75J 2OYHB 3AE1C 1K73Q 2WSEH 3W67A 2K37A 3H1IJ 1JNMA 1NVOA 1N73B 5E79H 3TF5A 1EQ7A 5KLVE 3T97B 4JBZA 1OW6A 2KUBA 4H13B 2M5AB 3S9OA 2JR8A 2FXMA 3H1IE 1A02J 2YKOA 3VP9A 3MHVA 1ZW0A 3H32B 1EDLA 1CW5A 4H13D 2FYNC 1NTKK 2M0BA 1G2CA 1DEBA 1K8AQ 1NJIQ 3GHGB 1IFJA 1E79H 1AJYA 1XTGB 1T3UA 1LTAC 3VTPC 2NZ2A 2MKVA 2M3EA 3F5HA 4XFJA 1Y9BA 3LW5J 2AXTH 2KYVA 2N1TA 1VDFA 4NPEA 3D70A 2G8YA 3FWNA 1FDMA 3RK3B 1SQPD 2WVRA 3V4WA 4EIJA 1NU1G 3M0AA 1FBMA 3C1LA 1PV3A 1VF5C 1T6AA 3L70G 5H2FE 2H43A 5DJUB 3RK3D 1SQPJ 3M9QA 1VL2A 2KIKA 1GL2A 3KYQA 3B5NB 1EC5A 1G1JA 2A45H 2YO3A 1QVFO 2Q3EA 1FZBA 1W2BO 3CD6P 2KNCA 4ASUH 2ZYDA 3TYYA 1BSNA 3A3YB 2GA1A 3U1AA 1YI2P 5APSA 3PLNA 3SWKA 3CPWO 1IO4A 3G3ZA 2KZJA 3G9RA 2FYUD 1ZXGA 1H0TB 5KKZB 4PD4E 1VQ9P 2AXCA 1JY3P 3WUVA 4AYCA 4IL6H 1KYOH 4L76A 3BRVB 1EDIA 3BCCJ 2FYUJ 1SQVG 1KD1Q 1AQTA 5AW5B 2QIWA 1YITP 3Q5RA 1Q81Q 1FAVA 4WY4A 1M8OB 1LJ2A 3CXHI 4H44C 2OTKE 1VQ5P 1M1JA 2IBZG 1LNQA 1DX7A 1BCCD 2Q6QA 3H1HJ 1R5SA 4IFFA 2IZ1A 2N1TD 1KQSO 3I55P 5KAIE 1RE4C 3EQ2A 2OYIA 3D71A 3L72G 1BCCJ 1GZLA 3V5BA 3HUSC 4TLFA 3L37A 3BCCG 4GOEA 4OVNF 4DJGA 1NHLA 3GG2A 1N8RQ 1EXJA 2B88A 4LGDE 1SQPK 2R3SA 1VPCA 2V7QJ 1BCCE 3L36A 1JTHB 1GTWA 1GL2D 3MZWB 3AEFC 1OW8A 3FGAD 3CCEP 5AVRB 1IK9A 1VQ4P 1TU3F 1X9VA 3VMXA 3OW2O 1ZRTD 4JYBA 3H1HG 1USEA 1GK6A 4HH2A 3MIWA 2KZIA 2WITA 3HD7A 2JO1A 1H88A 4Y28J 3MD0A 4R4MA 1S9KE 3AEGC 2B87B 2RQ6A 1X22A 3PHLA 1LWUB 4EYYQ 3A7OA 2ZJSE 2E75B 1YBKA 1URQA 2N9BA 3E7KA 2OTJP 3NXSA 3UIAA 3WMM0 2ZXXA 1ZRTE 1K05A 5APXA 2KOGA 1KFNA 1RF0A 1ZN5A 2FYUK 1JB0J 4C7RA 2QE7H 3CXHD 2QG4A 2K9JA 4JF7A 1CZQA 5APYA 1N7SA 2WSFJ 3S1KA 1SQXD 2BCCG 2FY8A 3CWBD 3G4SP 1J1EB 1LTGC 1Q86Q 4IL6X 2HODB 2E42A 2WSSH 2FBWC 5K5GB 1OX3A 2H89C 2L5GB 2P67A 2V4HA 1W5CE 3HE5A 4JQ0D 1X8YA 1L0LG 3SSUA 1GL2C 2SPZA 2W6BA 1SQXE 5H2FH 3WUUA 1S5LE 3CWBE 1D7MA 2ZT9B 5APQA 3AE8C 1P84E 5KTBA 4PV1B 1JCDA 5B66E 1FZEA 2ZT9D 5CJ0A 2QJYB 3CX5I 1NYHA 1FOSF 1UIIA 4PV1D 3CCSP 3KDPB 3HRNA 2HPCA 1PGOA 2IX7C 4LC1A 5L8RJ 1PP9D 2D2CB 1EZVD 3E1IA 3CCRP 1Q7YQ 3AE4C 2OYHA 4PD4H 5BVZA 1N73A 3CMAP 5CMZA 1URQD 3Q3DA 4U3FD 1LTTC 3S4RA 2Y0DA 1KQLA 3T97A 1PP9J 3U1CA 2D2CD 2M5AA 1VQNP 4WY4C 3H1LD 1SFCB 2QJKC 4U3FJ 2VRSA 1BE3D 1N7SD 4YTPC 1BGYG 3H32A 3V4QA 5AVSB 2KS1B 2XNDH 1EZVE 3MGNA 1DD4A 2A06G 3H1LJ 1YTZI 1NTKE 3H6PA 3TK1A 3A0HE 1MKMA 3GHGA 2QVAA 2YKQA 2Z5IA 1QVGO 1BE3J 2E74D 5KAIH 4L74A 5EFWB 1AQ5A 5AVXB 4U7JA 4AQRD 3SFDC 3BATA 2WTYA 3FX0A 1VF5B 1T3JA 5CCHD 3NTNA 1GW3A 3E1RA 4C7NB 2WSCH 5BU8B 3O6QB 3H1JE 4OWFA 1IFMA 4BRYB 4EI2A 3L74J 4OH8B 1KB9D 3HD7C 3B5NA 3TGUG 3OEHH 2P58A 1PGPA 2IFMA 4OGQB 2OARA 3IR9A 4I6MC 4BXLA 2YNYA 2PFXA 3L4FA 1AV1A 1NU1D 2RH0A 4HB1A 1SQBG 3L70D 2QJPB 1URQC 1FZAA 3D6ZA 1PL5A 3RL0D 1FZGA 2Y9YA 3KHUA 1JY2O 3L75E 3CC4P 1RF0C 2IFNA 1NU1J 2Y9ZA 1KB9E 1OXZA 1GW4A 3BRTB 1OW7A 3L70J 1H0TA 2DW3A 5TJHA 3L74G 2K1AA 3M0DA 1AVOA 4UB8E 4R4LA 4W7YA 2CK3H 3PP5A 2RMZA 1YJNP 2C9LY 1NU1E 1L2PA 3AE7C 1DEEG 3TDKA 3L70E 2QM8A 2FXPA 3SFEC 4H44B 1FE6A 1LTJC 3GF7A 2CPBA 1YQ4C 1Y8AA 5KLVG 2XV5A 2E74C 2YMKA 1K9MQ 1L0NJ 2IPPA 1DD3A 3I5CA 1JO5A 2OQQA 1RF1B 2WSFH 4HYTB 2RN0A 1YHQP 5AW3B 1OIPA 1SQVD 4UB6E 3R4YA 3CMEP 5AVUB 2OYOA 2IDBA 3L73J 4WVZA 2ZAEB 2E43A 4GT1A 4M3LA 1DIPA 1U57A 1S5LH 2H7HA 1Z56A 1JY3N 1SQQJ 3M9HA 1SQVJ 2IBZD 4EDFA 1P84H 3AE3C 2YXQB 5KJ7D 4N78D 2O1JA 1ZMEC 4D6TG 1U7MA 1SQPE 1JTHA 5AW8B 3B5ND 1IZNB 2L91A 2YIUB 1L0NG 1J1DB 4W80A 3WU2E 5B66H 1H8EH 2C0WA 1NGMB 1AA0A 2C9NY 4I7ZB 3L72D 5APVA 1NH4A 5APUA 4H0LB 4N3YB 2I8DA 3RK3E 3BCCD 2OYHC 1QL2A 5AW0B 5AW2B 1N73C 3WUTA 2IBZE 3L72J 3L73G 1YJ9P 2NPSB 1JM0A 2B87A 1NU1K 4H13C 2R3CA 4H0LD 4N78E 1NO4A 5APWA 3V2NA 1SQQG 1LWUA 3HTKB 1L4AB 3H1HD 1FZCB 1HUCA 4GODA 3L72E 3LIEA 1KILB 1JY2P 2HLDH 1OWAA 3BCCE 2FYUE 1PGQA 2E5YA 2JKVA 3M9BA 1HWTC 3GHGC 3OA7A 5GTIE 3CI9A 1L4AD 2OTLP 1N86A 2ZXEB 3A0HH 2ZVNB 1KILD 2HR3A 1CI6B 1MV8A 2B89A 1LT9B 1U7JA 3RK2B 5AVZB 3PRJA 2HODA 3H1HE 2JDIH 1GU5A 3RK3C 2A45I 1FU1A 1RQUA 4YXDC 2YO2A 1CSBA 1BDDA 2PGDA 3MTUE 1A02F 3TNUB 3RK2D 4GOFA 5AVQB 1KFMA 3L71J 2BCCD 1PFIA 1SQVK 3P8MC 2W8ZA 2ZYAA 3BASA 2OGUA 1WRGA 2E76B 2BCCJ 3OAAH 4XA4A 1YIJP 3QWOC 3CC7P 3GLMA 1S72P 1KV4A 1NAYA 4YXWH 1S5LX 5AW1B 2C0XA 1HH0A 1KYOI 1L0LD 3PTZA 2J58A 2WT7B 2H8PD 2W27A 2LKMA 2XZRA 1HF9A 5KLIC 1FS0E 2E76D 2ZFCA 2BCCE 3AE9C 1YYCA 4YPCA 3EFFK 1OVVA 2Q7CA 1HJBA 5KKZC 2ZVOB 1L0LJ 2IYOA 4Y99B 1KB9H 3M0DC 2K3RA 3L71G 3BVHA 1NKNA 1SLQA 2KK7A 3Q5SA 4WB4A 2E75D 2P1JA 1KMIZ 4C46A 1OFCX 2FFDB 4UB8H 1H89A 2W90A 3N4XA 2J5UA 4N6JA 5AW4B 2N1TC 2BEZF 1SFCA 3QH9A 1NTMD 2IYPA 2WPVB 4HKZH 3P7KA 2KS1A 5B5EE 2WPRA 2KB7P 1NTMJ 3CXHE 3OAKA 1MFZA 2XNXA 3LW5H 4UB6H 5CCHA 5TISE 3II6A 1PPJG 2R44A 1VQ8P 1BGYD 4K35A 3H25A 2BEQD 1M57D 1K04A 2A06D 4JYCA 4I1LA 2R5BA 1LTBC 3IF4A 3ZDMA 1HBWA 1PIXA 1T2KD 1NTZG 1Q82Q 1WMKA 3O6QA 1BGYJ 4DOJA 1VQLP 3LIDA 2KSJA 4BWNA 4EOTA 3WU2H 1VQKP 1NTMG 2WPQA 3D6YA 4I2LC 2PRRA 2GUSA 3I56P 1BGYE 3EFGA 3CCVP 3P32A 2W83C 2A45G 1LWUC 3OJAB 4LLHA 1L0LK 2E75C 2J59M 2FYZA 1RE3A 2KP8A 1W2EA 3TGUD 1M56D 1M1JC 1MUUA 2FYNB 3H1KJ 1HVVA 3RGUA 1PP9E 2RQ7A 1BDCA 1SFCD 1IK7A 2BASA 3TGUJ 5GTIH 1SQBD 1USDA 2OYIC 4U3FE 4IFMA 1J1EC 3JSVC 2Q5UA 3A0BE 1NOHA 1LTJB 3FKSH 3AECC 3H1LE 2WPSA 1NTMK 1SQBJ 3M91A 1S3JA 3TGUE 1VQ7P 1LGHB 3L74D 1BE3E 1GD2E 1RF1A 1ZP0C 1GMJA 3GF3A 2PAJA 1RE4A 1S4XA 1PZQA 3H1KG 3B71A 3Q2YA 1KQGB 2YXRB 3AEBC 1SQBE 3VMZA 5AVVB 2K9YA 4KHXA 3OFNH 2ZT9C 5KJ7A 1NTKG 4PJ0E 1LP1B 4L73A 1IC2A 3CX5D 1VF5D 5KLVD 4PV1C 1ZV8A 4RJTA 2FKWB 2V7QH 4DT0A 1JOCA 5CBNA 4K3AA 3L74E 4PD4I 3KZIE 1Q90D 5KLVJ 3EWKA 3KXDA 4HJGH 1FC2C 2XKMA 1NKZB 4OGQD 2LXBA 4KT0J 1ZLLA 1KC8Q 2D2CC 2QA4P 2P10A 2PP6A 3CX5E 3H1JG 3CCLP 4NPDA 1N7SC 4D6TD 2NPSA 1LTIC 2K88A 3IN6A 2POHA 1L0ND 1QL1A 2P2UA 1SFCC 4RKUJ 3CLQA 1EXIA 1RH5B 2JWAA 3HTKA 4CPGA 2AEJA 5AW9B 1L4AA 3MUDA 1FZCA 4D6TJ 3C8VA 1N2DC 1NAFA 1HGZA 4L75A 2I1JA 2AEMA 1KILA 5DN6I 2O3JA 5AVYB 4TT3H 2Z4EA 3L73D 3L75G 5B5EH 2YKPA 2O01J 2ITAA 3H1IG 4H44D 2B9BA 4D6TE 1M7LA 1SS1A 1SQQD 1SQBK 2M3BA 3CXHH 3ITKA 5CCHC 1L0NE 3HUSB 1CI6A 2KLVA 1LT9A 2KI7B 1N7LA 3FXDA 4GKGA 1YTZT 2M8RA 1S2EA 2LXCB 5TISH 3G6EP 3HE4B 1OVUA 3ABVC 4DCKA 1IFPA 1T8ZA 2JP3A 3TNUA 3L73E 1EDKA 2NRGA 1VQ6P 1AFOA 4PD4D 1IFDA 1HGVA 1SQQE 3O8ZA 1JY2N 1SQVE 1HJ0A 1R5LA 4OGQC 5C39A 3Q5PA 1IJDB 3GMAA 3L35A 3RL0C 3AE6C 3IAOA 5KLVK 1RY3A 1KN7A 4JPZB 5CJ4A 2QJPC 5KLIB 3RBXA 1RE3C 2WT7A 4IFDK 2Q9IA 3CCUP 4RESB 1G2CB 3A2AA 2NPSD 3PJSK 1SQPG 3RL0g 1G1IA 1SVFA 2R5DA 2XOKH 2HFED 2P7JA 1RQVA 4ZKUA 2FFDA 1IFNA 2HG5D 2N1TB 1L0NK 3CCJP 3KQGA 4W7ZA 1KTMA 3AEAC 3VP8A 3JC22 1OZHA 5CBOA 4XE5B 3A0BH 2W6AA 3TSIA 2O1KA 3NFQA 1RF1C 3L71D 1NWQA 1GK4A 4GIFA 2WSCJ 1P84I 2Q1KA 1E5WA 2WWWA 1GL2B 1FOSE 5KJ7C 1SQQK 2FXOA 2FYUG 2GUVA 3GW6A 1KILE 1YQ3C 3B5NC 1YJWP 2KSEA 1S9KD 3CC2P 4RO0A 2KNCB 1JUNA 1RHZB 3F89A 4PJ0H 1PGJA 5GTHE 3JCUE 2WSEJ 2WZ7A 1GDTA 3CCQP 4ASVA 3L71E 1XTCC 4A7PA 2YIUC 5CHXA 1J1DC 5BU5A 2KXPB 3AE5C 3AEEC 3V2RA 5CCGA 5APTA 4I7ZC 4DZOA 3KZIH 2RKLA 5KAFE 2Q3IA 5DJTB 4H0LC 1JCCA 1BSHA 2QM7A 5E79E 4IOIH 2HYNA 1PPJD 2R32A 5AVTB 1BCCG 2Z5HA 2LR2A 3B8EB 1FDOA 3A5TA 3G71P 1QX8A 3CX5H 2NPSC 3P8CD 3C9IA 3PH0A 3VN0A 1QGKB 4O9BA 3N7NA 1EZVI 1NTZD 1J2JB 3B4SA 4WY4B 3FXEA 4KJMA 2QJKB 2O01N 1L4AC 1L0LE 3MUDC 1FZCC 3IFMA 1M1JB 3NMDA 3R2PA 1KILC 1FZFA 4ZNCA 2W6JH 1M1KQ 4B86A 4Z1MH 4ZMDA 1PPJE 1NTZJ 1Y47A 1LTSC 4ZKPA 1ZR4A 4WY4D 1LT1A 4WWIA 4MN4C 3KPEA 3VYIA 2OYIB 3P8CE 1VQPP 2UWJE 2AXTE 1OVRA 1P84D 1LT9C 1Q2NA 1NTZE 3RK2C 3VOPA 2YMYA 1SQXJ 1LTJA 3V6IA 3CWBJ 2GM4A 2XDJA 5AW7B 3FWLA 1NTME 2O01H 1MFTA 3SWFA 2QEXP 4WBAA 3AE2C 3K5BA 1JMMA 4C7NA 2H88C 1VQOP 4BRYA 1R8EA 3HD7B 1KYOD 5AW6B 4AUWA 1AVYA 1LP1A 2E76C 2JJLA
chains in the Genus database with same CATH topology
2HLDH 3OFNH 3OE7H 1BSHA 3OAAH 4QMAA 2XOKH 3USSA 2E5YA 1IFPA 3EFFK 4TLFA 5FL7H 3OEHH 1JEKA 2JDIH 4ASUH 2CK3H 5DN6I 4YXWH 1AQTA 2E5TA 2RQ6A 4DJGA 1E79H 4WVZA 3FKSH 1BSNA 2QE7H 2V7QH 2XNDH 2RQ7A 1H8EH 2W6JH 1FS0E 3PJSK 2WSSH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLD H;  3OFN H;  3OE7 H;  1BSH A;  3OAA H;  4QMA A;  2XOK H;  3USS A;  2E5Y A;  1IFP A;  3EFF K;  4TLF A;  5FL7 H;  3OEH H;  1JEK A;  2JDI H;  4ASU H;  2CK3 H;  5DN6 I;  4YXW H;  1AQT A;  2E5T A;  2RQ6 A;  4DJG A;  1E79 H;  4WVZ A;  3FKS H;  1BSN A;  2QE7 H;  2V7Q H;  2XND H;  2RQ7 A;  1H8E H;  2W6J H;  1FS0 E;  3PJS K;  2WSS H; 
#chains in the Genus database with same CATH topology
 1UIX A;  5CCG D;  1QLE D;  1KB9 I;  2Y0C A;  1SQX G;  2Y0E A;  2QSI A;  2MJZ A;  3HD7 D;  5M1B A;  2JEE A;  2A06 E;  1URQ B;  3CWB G;  3VMY A;  2WMM A;  1FJK A;  2ZYG A;  3VMA A;  3H1K D;  1MZ9 A;  3CL3 D;  1ZR2 A;  1WT6 A;  1IFI A;  2IZ0 A;  2QRX A;  1NTK D;  4Y99 C;  4IL6 E;  1KYO E;  1X0T A;  1SP4 A;  2K9J B;  1QEX A;  1N7S B;  1EDJ A;  3V2Q A;  1NTK J;  1FJP A;  2FFD C;  4ASW A;  3OE7 H;  2CPS A;  4QMA A;  1DH3 A;  3M06 A;  1FDI A;  1NTZ K;  3U59 A;  3H1K E;  1X79 B;  1S1C X;  2N9Y B;  2E5T A;  1KQF B;  2E74 B;  3HE5 B;  3H1J D;  4NPF X;  2KLU A;  4GDO A;  3W68 A;  1SQX K;  1JEK A;  2XU6 A;  2WQY C;  3CCM P;  3H1J J;  2AEF A;  3AED C;  1PP9 G;  3HUS A;  1T2K C;  1EZV G;  2I1K A;  3USS A;  3V2P A;  1ZOY C;  1JMB A;  5AVW B;  1GU4 A;  4U3F G;  3HE4 A;  3Q1M A;  3MP7 B;  2G3A A;  5GTH H;  1KZU B;  3JCU H;  1VQM P;  3L75 D;  5CCG C;  3SWY A;  3H1I D;  3RBZ A;  2HPC B;  3H1L G;  2QJY C;  1HTL C;  2IBZ I;  5FL7 H;  2HLO A;  2JWD A;  1M90 Q;  3RL0 B;  1OMI A;  1BE3 G;  1JY3 O;  1KOR A;  1H8A A;  5KAF H;  3L75 J;  2OYH B;  3AE1 C;  1K73 Q;  2WSE H;  3W67 A;  2K37 A;  3H1I J;  1JNM A;  1NVO A;  1N73 B;  5E79 H;  3TF5 A;  1EQ7 A;  5KLV E;  3T97 B;  4JBZ A;  1OW6 A;  2KUB A;  4H13 B;  2M5A B;  3S9O A;  2JR8 A;  2FXM A;  3H1I E;  1A02 J;  2YKO A;  3VP9 A;  3MHV A;  1ZW0 A;  3H32 B;  1EDL A;  1CW5 A;  4H13 D;  2FYN C;  1NTK K;  2M0B A;  1G2C A;  1DEB A;  1K8A Q;  1NJI Q;  3GHG B;  1IFJ A;  1E79 H;  1AJY A;  1XTG B;  1T3U A;  1LTA C;  3VTP C;  2NZ2 A;  2MKV A;  2M3E A;  3F5H A;  4XFJ A;  1Y9B A;  3LW5 J;  2AXT H;  2KYV A;  2N1T A;  1VDF A;  4NPE A;  3D70 A;  2G8Y A;  3FWN A;  1FDM A;  3RK3 B;  1SQP D;  2WVR A;  3V4W A;  4EIJ A;  1NU1 G;  3M0A A;  1FBM A;  3C1L A;  1PV3 A;  1VF5 C;  1T6A A;  3L70 G;  5H2F E;  2H43 A;  5DJU B;  3RK3 D;  1SQP J;  3M9Q A;  1VL2 A;  2KIK A;  1GL2 A;  3KYQ A;  3B5N B;  1EC5 A;  1G1J A;  2A45 H;  2YO3 A;  1QVF O;  2Q3E A;  1FZB A;  1W2B O;  3CD6 P;  2KNC A;  4ASU H;  2ZYD A;  3TYY A;  1BSN A;  3A3Y B;  2GA1 A;  3U1A A;  1YI2 P;  5APS A;  3PLN A;  3SWK A;  3CPW O;  1IO4 A;  3G3Z A;  2KZJ A;  3G9R A;  2FYU D;  1ZXG A;  1H0T B;  5KKZ B;  4PD4 E;  1VQ9 P;  2AXC A;  1JY3 P;  3WUV A;  4AYC A;  4IL6 H;  1KYO H;  4L76 A;  3BRV B;  1EDI A;  3BCC J;  2FYU J;  1SQV G;  1KD1 Q;  1AQT A;  5AW5 B;  2QIW A;  1YIT P;  3Q5R A;  1Q81 Q;  1FAV A;  4WY4 A;  1M8O B;  1LJ2 A;  3CXH I;  4H44 C;  2OTK E;  1VQ5 P;  1M1J A;  2IBZ G;  1LNQ A;  1DX7 A;  1BCC D;  2Q6Q A;  3H1H J;  1R5S A;  4IFF A;  2IZ1 A;  2N1T D;  1KQS O;  3I55 P;  5KAI E;  1RE4 C;  3EQ2 A;  2OYI A;  3D71 A;  3L72 G;  1BCC J;  1GZL A;  3V5B A;  3HUS C;  4TLF A;  3L37 A;  3BCC G;  4GOE A;  4OVN F;  4DJG A;  1NHL A;  3GG2 A;  1N8R Q;  1EXJ A;  2B88 A;  4LGD E;  1SQP K;  2R3S A;  1VPC A;  2V7Q J;  1BCC E;  3L36 A;  1JTH B;  1GTW A;  1GL2 D;  3MZW B;  3AEF C;  1OW8 A;  3FGA D;  3CCE P;  5AVR B;  1IK9 A;  1VQ4 P;  1TU3 F;  1X9V A;  3VMX A;  3OW2 O;  1ZRT D;  4JYB A;  3H1H G;  1USE A;  1GK6 A;  4HH2 A;  3MIW A;  2KZI A;  2WIT A;  3HD7 A;  2JO1 A;  1H88 A;  4Y28 J;  3MD0 A;  4R4M A;  1S9K E;  3AEG C;  2B87 B;  2RQ6 A;  1X22 A;  3PHL A;  1LWU B;  4EYY Q;  3A7O A;  2ZJS E;  2E75 B;  1YBK A;  1URQ A;  2N9B A;  3E7K A;  2OTJ P;  3NXS A;  3UIA A;  3WMM 0;  2ZXX A;  1ZRT E;  1K05 A;  5APX A;  2KOG A;  1KFN A;  1RF0 A;  1ZN5 A;  2FYU K;  1JB0 J;  4C7R A;  2QE7 H;  3CXH D;  2QG4 A;  2K9J A;  4JF7 A;  1CZQ A;  5APY A;  1N7S A;  2WSF J;  3S1K A;  1SQX D;  2BCC G;  2FY8 A;  3CWB D;  3G4S P;  1J1E B;  1LTG C;  1Q86 Q;  4IL6 X;  2HOD B;  2E42 A;  2WSS H;  2FBW C;  5K5G B;  1OX3 A;  2H89 C;  2L5G B;  2P67 A;  2V4H A;  1W5C E;  3HE5 A;  4JQ0 D;  1X8Y A;  1L0L G;  3SSU A;  1GL2 C;  2SPZ A;  2W6B A;  1SQX E;  5H2F H;  3WUU A;  1S5L E;  3CWB E;  1D7M A;  2ZT9 B;  5APQ A;  3AE8 C;  1P84 E;  5KTB A;  4PV1 B;  1JCD A;  5B66 E;  1FZE A;  2ZT9 D;  5CJ0 A;  2QJY B;  3CX5 I;  1NYH A;  1FOS F;  1UII A;  4PV1 D;  3CCS P;  3KDP B;  3HRN A;  2HPC A;  1PGO A;  2IX7 C;  4LC1 A;  5L8R J;  1PP9 D;  2D2C B;  1EZV D;  3E1I A;  3CCR P;  1Q7Y Q;  3AE4 C;  2OYH A;  4PD4 H;  5BVZ A;  1N73 A;  3CMA P;  5CMZ A;  1URQ D;  3Q3D A;  4U3F D;  1LTT C;  3S4R A;  2Y0D A;  1KQL A;  3T97 A;  1PP9 J;  3U1C A;  2D2C D;  2M5A A;  1VQN P;  4WY4 C;  3H1L D;  1SFC B;  2QJK C;  4U3F J;  2VRS A;  1BE3 D;  1N7S D;  4YTP C;  1BGY G;  3H32 A;  3V4Q A;  5AVS B;  2KS1 B;  2XND H;  1EZV E;  3MGN A;  1DD4 A;  2A06 G;  3H1L J;  1YTZ I;  1NTK E;  3H6P A;  3TK1 A;  3A0H E;  1MKM A;  3GHG A;  2QVA A;  2YKQ A;  2Z5I A;  1QVG O;  1BE3 J;  2E74 D;  5KAI H;  4L74 A;  5EFW B;  1AQ5 A;  5AVX B;  4U7J A;  4AQR D;  3SFD C;  3BAT A;  2WTY A;  3FX0 A;  1VF5 B;  1T3J A;  5CCH D;  3NTN A;  1GW3 A;  3E1R A;  4C7N B;  2WSC H;  5BU8 B;  3O6Q B;  3H1J E;  4OWF A;  1IFM A;  4BRY B;  4EI2 A;  3L74 J;  4OH8 B;  1KB9 D;  3HD7 C;  3B5N A;  3TGU G;  3OEH H;  2P58 A;  1PGP A;  2IFM A;  4OGQ B;  2OAR A;  3IR9 A;  4I6M C;  4BXL A;  2YNY A;  2PFX A;  3L4F A;  1AV1 A;  1NU1 D;  2RH0 A;  4HB1 A;  1SQB G;  3L70 D;  2QJP B;  1URQ C;  1FZA A;  3D6Z A;  1PL5 A;  3RL0 D;  1FZG A;  2Y9Y A;  3KHU A;  1JY2 O;  3L75 E;  3CC4 P;  1RF0 C;  2IFN A;  1NU1 J;  2Y9Z A;  1KB9 E;  1OXZ A;  1GW4 A;  3BRT B;  1OW7 A;  3L70 J;  1H0T A;  2DW3 A;  5TJH A;  3L74 G;  2K1A A;  3M0D A;  1AVO A;  4UB8 E;  4R4L A;  4W7Y A;  2CK3 H;  3PP5 A;  2RMZ A;  1YJN P;  2C9L Y;  1NU1 E;  1L2P A;  3AE7 C;  1DEE G;  3TDK A;  3L70 E;  2QM8 A;  2FXP A;  3SFE C;  4H44 B;  1FE6 A;  1LTJ C;  3GF7 A;  2CPB A;  1YQ4 C;  1Y8A A;  5KLV G;  2XV5 A;  2E74 C;  2YMK A;  1K9M Q;  1L0N J;  2IPP A;  1DD3 A;  3I5C A;  1JO5 A;  2OQQ A;  1RF1 B;  2WSF H;  4HYT B;  2RN0 A;  1YHQ P;  5AW3 B;  1OIP A;  1SQV D;  4UB6 E;  3R4Y A;  3CME P;  5AVU B;  2OYO A;  2IDB A;  3L73 J;  4WVZ A;  2ZAE B;  2E43 A;  4GT1 A;  4M3L A;  1DIP A;  1U57 A;  1S5L H;  2H7H A;  1Z56 A;  1JY3 N;  1SQQ J;  3M9H A;  1SQV J;  2IBZ D;  4EDF A;  1P84 H;  3AE3 C;  2YXQ B;  5KJ7 D;  4N78 D;  2O1J A;  1ZME C;  4D6T G;  1U7M A;  1SQP E;  1JTH A;  5AW8 B;  3B5N D;  1IZN B;  2L91 A;  2YIU B;  1L0N G;  1J1D B;  4W80 A;  3WU2 E;  5B66 H;  1H8E H;  2C0W A;  1NGM B;  1AA0 A;  2C9N Y;  4I7Z B;  3L72 D;  5APV A;  1NH4 A;  5APU A;  4H0L B;  4N3Y B;  2I8D A;  3RK3 E;  3BCC D;  2OYH C;  1QL2 A;  5AW0 B;  5AW2 B;  1N73 C;  3WUT A;  2IBZ E;  3L72 J;  3L73 G;  1YJ9 P;  2NPS B;  1JM0 A;  2B87 A;  1NU1 K;  4H13 C;  2R3C A;  4H0L D;  4N78 E;  1NO4 A;  5APW A;  3V2N A;  1SQQ G;  1LWU A;  3HTK B;  1L4A B;  3H1H D;  1FZC B;  1HUC A;  4GOD A;  3L72 E;  3LIE A;  1KIL B;  1JY2 P;  2HLD H;  1OWA A;  3BCC E;  2FYU E;  1PGQ A;  2E5Y A;  2JKV A;  3M9B A;  1HWT C;  3GHG C;  3OA7 A;  5GTI E;  3CI9 A;  1L4A D;  2OTL P;  1N86 A;  2ZXE B;  3A0H H;  2ZVN B;  1KIL D;  2HR3 A;  1CI6 B;  1MV8 A;  2B89 A;  1LT9 B;  1U7J A;  3RK2 B;  5AVZ B;  3PRJ A;  2HOD A;  3H1H E;  2JDI H;  1GU5 A;  3RK3 C;  2A45 I;  1FU1 A;  1RQU A;  4YXD C;  2YO2 A;  1CSB A;  1BDD A;  2PGD A;  3MTU E;  1A02 F;  3TNU B;  3RK2 D;  4GOF A;  5AVQ B;  1KFM A;  3L71 J;  2BCC D;  1PFI A;  1SQV K;  3P8M C;  2W8Z A;  2ZYA A;  3BAS A;  2OGU A;  1WRG A;  2E76 B;  2BCC J;  3OAA H;  4XA4 A;  1YIJ P;  3QWO C;  3CC7 P;  3GLM A;  1S72 P;  1KV4 A;  1NAY A;  4YXW H;  1S5L X;  5AW1 B;  2C0X A;  1HH0 A;  1KYO I;  1L0L D;  3PTZ A;  2J58 A;  2WT7 B;  2H8P D;  2W27 A;  2LKM A;  2XZR A;  1HF9 A;  5KLI C;  1FS0 E;  2E76 D;  2ZFC A;  2BCC E;  3AE9 C;  1YYC A;  4YPC A;  3EFF K;  1OVV A;  2Q7C A;  1HJB A;  5KKZ C;  2ZVO B;  1L0L J;  2IYO A;  4Y99 B;  1KB9 H;  3M0D C;  2K3R A;  3L71 G;  3BVH A;  1NKN A;  1SLQ A;  2KK7 A;  3Q5S A;  4WB4 A;  2E75 D;  2P1J A;  1KMI Z;  4C46 A;  1OFC X;  2FFD B;  4UB8 H;  1H89 A;  2W90 A;  3N4X A;  2J5U A;  4N6J A;  5AW4 B;  2N1T C;  2BEZ F;  1SFC A;  3QH9 A;  1NTM D;  2IYP A;  2WPV B;  4HKZ H;  3P7K A;  2KS1 A;  5B5E E;  2WPR A;  2KB7 P;  1NTM J;  3CXH E;  3OAK A;  1MFZ A;  2XNX A;  3LW5 H;  4UB6 H;  5CCH A;  5TIS E;  3II6 A;  1PPJ G;  2R44 A;  1VQ8 P;  1BGY D;  4K35 A;  3H25 A;  2BEQ D;  1M57 D;  1K04 A;  2A06 D;  4JYC A;  4I1L A;  2R5B A;  1LTB C;  3IF4 A;  3ZDM A;  1HBW A;  1PIX A;  1T2K D;  1NTZ G;  1Q82 Q;  1WMK A;  3O6Q A;  1BGY J;  4DOJ A;  1VQL P;  3LID A;  2KSJ A;  4BWN A;  4EOT A;  3WU2 H;  1VQK P;  1NTM G;  2WPQ A;  3D6Y A;  4I2L C;  2PRR A;  2GUS A;  3I56 P;  1BGY E;  3EFG A;  3CCV P;  3P32 A;  2W83 C;  2A45 G;  1LWU C;  3OJA B;  4LLH A;  1L0L K;  2E75 C;  2J59 M;  2FYZ A;  1RE3 A;  2KP8 A;  1W2E A;  3TGU D;  1M56 D;  1M1J C;  1MUU A;  2FYN B;  3H1K J;  1HVV A;  3RGU A;  1PP9 E;  2RQ7 A;  1BDC A;  1SFC D;  1IK7 A;  2BAS A;  3TGU J;  5GTI H;  1SQB D;  1USD A;  2OYI C;  4U3F E;  4IFM A;  1J1E C;  3JSV C;  2Q5U A;  3A0B E;  1NOH A;  1LTJ B;  3FKS H;  3AEC C;  3H1L E;  2WPS A;  1NTM K;  1SQB J;  3M91 A;  1S3J A;  3TGU E;  1VQ7 P;  1LGH B;  3L74 D;  1BE3 E;  1GD2 E;  1RF1 A;  1ZP0 C;  1GMJ A;  3GF3 A;  2PAJ A;  1RE4 A;  1S4X A;  1PZQ A;  3H1K G;  3B71 A;  3Q2Y A;  1KQG B;  2YXR B;  3AEB C;  1SQB E;  3VMZ A;  5AVV B;  2K9Y A;  4KHX A;  3OFN H;  2ZT9 C;  5KJ7 A;  1NTK G;  4PJ0 E;  1LP1 B;  4L73 A;  1IC2 A;  3CX5 D;  1VF5 D;  5KLV D;  4PV1 C;  1ZV8 A;  4RJT A;  2FKW B;  2V7Q H;  4DT0 A;  1JOC A;  5CBN A;  4K3A A;  3L74 E;  4PD4 I;  3KZI E;  1Q90 D;  5KLV J;  3EWK A;  3KXD A;  4HJG H;  1FC2 C;  2XKM A;  1NKZ B;  4OGQ D;  2LXB A;  4KT0 J;  1ZLL A;  1KC8 Q;  2D2C C;  2QA4 P;  2P10 A;  2PP6 A;  3CX5 E;  3H1J G;  3CCL P;  4NPD A;  1N7S C;  4D6T D;  2NPS A;  1LTI C;  2K88 A;  3IN6 A;  2POH A;  1L0N D;  1QL1 A;  2P2U A;  1SFC C;  4RKU J;  3CLQ A;  1EXI A;  1RH5 B;  2JWA A;  3HTK A;  4CPG A;  2AEJ A;  5AW9 B;  1L4A A;  3MUD A;  1FZC A;  4D6T J;  3C8V A;  1N2D C;  1NAF A;  1HGZ A;  4L75 A;  2I1J A;  2AEM A;  1KIL A;  5DN6 I;  2O3J A;  5AVY B;  4TT3 H;  2Z4E A;  3L73 D;  3L75 G;  5B5E H;  2YKP A;  2O01 J;  2ITA A;  3H1I G;  4H44 D;  2B9B A;  4D6T E;  1M7L A;  1SS1 A;  1SQQ D;  1SQB K;  2M3B A;  3CXH H;  3ITK A;  5CCH C;  1L0N E;  3HUS B;  1CI6 A;  2KLV A;  1LT9 A;  2KI7 B;  1N7L A;  3FXD A;  4GKG A;  1YTZ T;  2M8R A;  1S2E A;  2LXC B;  5TIS H;  3G6E P;  3HE4 B;  1OVU A;  3ABV C;  4DCK A;  1IFP A;  1T8Z A;  2JP3 A;  3TNU A;  3L73 E;  1EDK A;  2NRG A;  1VQ6 P;  1AFO A;  4PD4 D;  1IFD A;  1HGV A;  1SQQ E;  3O8Z A;  1JY2 N;  1SQV E;  1HJ0 A;  1R5L A;  4OGQ C;  5C39 A;  3Q5P A;  1IJD B;  3GMA A;  3L35 A;  3RL0 C;  3AE6 C;  3IAO A;  5KLV K;  1RY3 A;  1KN7 A;  4JPZ B;  5CJ4 A;  2QJP C;  5KLI B;  3RBX A;  1RE3 C;  2WT7 A;  4IFD K;  2Q9I A;  3CCU P;  4RES B;  1G2C B;  3A2A A;  2NPS D;  3PJS K;  1SQP G;  3RL0 g;  1G1I A;  1SVF A;  2R5D A;  2XOK H;  2HFE D;  2P7J A;  1RQV A;  4ZKU A;  2FFD A;  1IFN A;  2HG5 D;  2N1T B;  1L0N K;  3CCJ P;  3KQG A;  4W7Z A;  1KTM A;  3AEA C;  3VP8 A;  3JC2 2;  1OZH A;  5CBO A;  4XE5 B;  3A0B H;  2W6A A;  3TSI A;  2O1K A;  3NFQ A;  1RF1 C;  3L71 D;  1NWQ A;  1GK4 A;  4GIF A;  2WSC J;  1P84 I;  2Q1K A;  1E5W A;  2WWW A;  1GL2 B;  1FOS E;  5KJ7 C;  1SQQ K;  2FXO A;  2FYU G;  2GUV A;  3GW6 A;  1KIL E;  1YQ3 C;  3B5N C;  1YJW P;  2KSE A;  1S9K D;  3CC2 P;  4RO0 A;  2KNC B;  1JUN A;  1RHZ B;  3F89 A;  4PJ0 H;  1PGJ A;  5GTH E;  3JCU E;  2WSE J;  2WZ7 A;  1GDT A;  3CCQ P;  4ASV A;  3L71 E;  1XTC C;  4A7P A;  2YIU C;  5CHX A;  1J1D C;  5BU5 A;  2KXP B;  3AE5 C;  3AEE C;  3V2R A;  5CCG A;  5APT A;  4I7Z C;  4DZO A;  3KZI H;  2RKL A;  5KAF E;  2Q3I A;  5DJT B;  4H0L C;  1JCC A;  1BSH A;  2QM7 A;  5E79 E;  4IOI H;  2HYN A;  1PPJ D;  2R32 A;  5AVT B;  1BCC G;  2Z5H A;  2LR2 A;  3B8E B;  1FDO A;  3A5T A;  3G71 P;  1QX8 A;  3CX5 H;  2NPS C;  3P8C D;  3C9I A;  3PH0 A;  3VN0 A;  1QGK B;  4O9B A;  3N7N A;  1EZV I;  1NTZ D;  1J2J B;  3B4S A;  4WY4 B;  3FXE A;  4KJM A;  2QJK B;  2O01 N;  1L4A C;  1L0L E;  3MUD C;  1FZC C;  3IFM A;  1M1J B;  3NMD A;  3R2P A;  1KIL C;  1FZF A;  4ZNC A;  2W6J H;  1M1K Q;  4B86 A;  4Z1M H;  4ZMD A;  1PPJ E;  1NTZ J;  1Y47 A;  1LTS C;  4ZKP A;  1ZR4 A;  4WY4 D;  1LT1 A;  4WWI A;  4MN4 C;  3KPE A;  3VYI A;  2OYI B;  3P8C E;  1VQP P;  2UWJ E;  2AXT E;  1OVR A;  1P84 D;  1LT9 C;  1Q2N A;  1NTZ E;  3RK2 C;  3VOP A;  2YMY A;  1SQX J;  1LTJ A;  3V6I A;  3CWB J;  2GM4 A;  2XDJ A;  5AW7 B;  3FWL A;  1NTM E;  2O01 H;  1MFT A;  3SWF A;  2QEX P;  4WBA A;  3AE2 C;  3K5B A;  1JMM A;  4C7N A;  2H88 C;  1VQO P;  4BRY A;  1R8E A;  3HD7 B;  1KYO D;  5AW6 B;  4AUW A;  1AVY A;  1LP1 A;  2E76 C;  2JJL A; 
#chains in the Genus database with same CATH homology
 2HLD H;  3OFN H;  3OE7 H;  1BSH A;  3OAA H;  4QMA A;  2XOK H;  3USS A;  2E5Y A;  1IFP A;  3EFF K;  4TLF A;  5FL7 H;  3OEH H;  1JEK A;  2JDI H;  4ASU H;  2CK3 H;  5DN6 I;  4YXW H;  1AQT A;  2E5T A;  2RQ6 A;  4DJG A;  1E79 H;  4WVZ A;  3FKS H;  1BSN A;  2QE7 H;  2V7Q H;  2XND H;  2RQ7 A;  1H8E H;  2W6J H;  1FS0 E;  3PJS K;  2WSS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...