1FS0E

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
128
Chain Sequence
AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHDVDYAQASAELAKAIAQLRVIELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 32
structure length 128
sequence length 134
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
E PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1fs0E02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1fs0E01
1AQTA 4WVZA 2E5YA 5DN6I 4QMAA 2W6JH 3FKSH 1E79H 3PJSK 4DJGA 2E5TA 1JEKA 2HLDH 1BSNA 2XNDH 2RQ7A 2QE7H 3OE7H 5FL7H 3OAAH 4YXWH 1H8EH 3USSA 2CK3H 2RQ6A 2XOKH 3EFFK 3OEHH 2V7QH 2WSSH 4ASUH 1FS0E 1IFPA 3OFNH 4TLFA 1BSHA 2JDIH
chains in the Genus database with same CATH superfamily
3AE1C 3H1LJ 3K5BA 1NO4A 2GUVA 5B66H 1NTMG 1L0LK 2OYHA 1KB9I 1A02J 1QVGO 2WPRA 3CMAP 4B86A 2A45H 3HD7D 3U1AA 4PJ0H 1FS0E 1N73A 2ZYGA 3IF4A 3L73D 1FU1A 1L4AB 1PGPA 1HBWA 3M06A 4C7NA 1SLQA 2Q9IA 3PP5A 1FZAA 1M1JB 5KLVE 1RE4A 1NYHA 1VPCA 1JY2N 1S3JA 1G2CB 3FXEA 3MGNA 1BDDA 3E7KA 4W7YA 4WY4C 1KYOI 1SQBD 2N9BA 1MV8A 1OVUA 1AQTA 3WUVA 1AFOA 4OH8B 3RBXA 2B9BA 1SQXD 5FL7H 3CWBD 1GK6A 1KZUB 3OJAB 4H13B 3CLQA 3EQ2A 4ASVA 3MD0A 3EFGA 2KI7B 1R5SA 2R3SA 3O6QA 4NPFX 1MFTA 1QVFO 4L73A 2K9YA 2Q5UA 1NOHA 5APWA 2KLUA 3B5NB 4H0LB 2K9JA 2M5AA 3BCCD 2HYNA 3TSIA 1NVOA 2QSIA 1OZHA 2YMYA 1BSHA 2E76C 2JDIH 4WVZA 4LGDE 3GMAA 1GZLA 1PP9J 2C9NY 3A0HE 1URQB 2HODA 2YKQA 5DJTB 1EZVE 1D7MA 2QA4P 5E79E 1YITP 3RL0C 1ZR2A 1L0LJ 1NTZK 1JY2P 1OXZA 3CX5E 2QEXP 4PV1D 1YI2P 5AVUB 1PFIA 2P7JA 1K73Q 3WMM0 2L5GB 2A06E 5GTIE 1NWQA 1JTHA 4PD4D 3H1KG 3GLMA 1BSNA 1IFIA 1PL5A 3KYQA 3CXHH 5KKZC 3IFMA 4U7JA 1ZMEC 3LW5H 1FAVA 2C0XA 1N7SA 1SQPD 3A0BE 4WWIA 3Q5RA 1BCCJ 2M0BA 4GKGA 1E5WA 1HUCA 1SQVD 3NMDA 2Q1KA 2RKLA 3CXHD 3S9OA 4ASUH 1L0NG 2OYIC 2NPSB 3MZWB 3H1ID 1YJNP 2QM7A 1N8RQ 3P8CE 2B87A 2FYZA 3G6EP 3MHVA 3KHUA 3JSVC 3RK3D 3I55P 3V2RA 2OYHB 3L73G 1KB9H 2AXCA 1N73B 2FXMA 1VQPP 3H1HG 3VP8A 4EI2A 2HG5D 2LXCB 3CCEP 1NU1D 1Y9BA 2YXRB 5CJ0A 1VQNP 4D6TD 2BCCD 2A45G 3KZIH 1FZCB 2P58A 5TISE 1KB9D 3OW2O 3L74G 3CC2P 2O1KA 5KAIH 1NTZJ 3V2NA 4Y99C 1RH5B 1JY3N 3AEGC 3W68A 3NFQA 1SQBG 4RJTA 3TF5A 1QEXA 3L71D 3ITKA 2B89A 5AW3B 2CPSA 1GL2D 1KYOH 1SQXG 1NHLA 3VMAA 4OGQC 1HVVA 3S4RA 1H89A 2Y0CA 3IR9A 3U1CA 4N78E 2CK3H 3RK2C 1LNQA 5CBOA 2ZT9B 5KAFH 2V7QH 2KK7A 4RKUJ 4PV1C 4RESB 3O6QB 3CCSP 3BCCG 2O1JA 1HJBA 3PTZA 2K9JB 2M5AB 2ZXEB 1KQFB 3HUSC 5AW8B 4EYYQ 1M56D 2AEJA 1J1EB 3H1KE 4KJMA 5CBNA 2HODB 5AVYB 1AVYA 3SFDC 2WT7B 1G2CA 3EFFK 4AQRD 5AW5B 3PH0A 4L76A 3BVHA 1VF5B 3FXDA 1J2JB 4MN4C 3G4SP 1IFDA 1KILE 1X79B 5AVSB 3D6ZA 3PHLA 2AXTE 5KJ7A 3C9IA 1PZQA 1Y47A 1LTSC 2WQYC 3TYYA 2H8PD 2ZFCA 4JPZB 1L0NE 1JTHB 2BEQD 4DJGA 4W80A 3RK3C 4ASWA 1SQPG 1IZNB 3L73E 3H25A 1MFZA 1XTCC 2FYUG 1N7SB 3P32A 1DIPA 3H1HE 2KSEA 2DW3A 4UB6H 4H44D 2R3CA 2E5TA 5B66E 4O9BA 1EXIA 3H1LD 2QJYB 4PD4I 4PJ0E 2JWAA 3L74E 4TT3H 2MJZA 1LWUC 2Z5IA 2FFDA 1S5LH 3MUDA 2WPVB 1SQBE 3TGUJ 1SQQG 2BASA 1GL2C 5EFWB 4ZMDA 3Q3DA 3L75D 1KFMA 2IX7C 5B5EH 1SQXE 3CC4P 2KOGA 1NH4A 4D6TG 2BCCG 3L72G 2OQQA 1IC2A 1KFNA 1DEEG 3M9HA 1T8ZA 2FYNC 3AE2C 1NTKG 1LGHB 2XZRA 3CD6P 1QX8A 2YKOA 1T3UA 3RL0B 3PRJA 3AE6C 2RN0A 3KXDA 3OA7A 2WPSA 3M0DC 1PV3A 1L0NK 4EIJA 3BCCE 2Q3IA 1FOSF 1IFNA 1KILB 5CCHD 1UIXA 3FWNA 2Q6QA 1J1DC 1AV1A 4JBZA 5AW4B 1A02F 2PP6A 1R5LA 3TDKA 3VMYA 2NPSA 4DT0A 2JEEA 3GF7A 2FXPA 4Z1MH 1H8AA 3AE3C 5KKZB 1JUNA 3UIAA 1YQ4C 2RMZA 1JMMA 1T6AA 1LTJA 3L35A 1P84I 2W6JH 5H2FH 3KPEA 3G3ZA 1FZEA 2W6BA 1L2PA 1M57D 2O3JA 4U3FJ 1EZVI 4IFFA 2Q7CA 1U7MA 3L75J 1HWTC 1PP9D 3QWOC 1RE3A 1KQLA 1FZCA 3A2AA 2GUSA 3IN6A 2E75C 2R5DA 1FZFA 5AVQB 1L4AD 2OARA 1NGMB 1FDOA 3BASA 2OYIB 4IL6H 2ZAEB 1L0LD 1OVVA 2WITA 1LT9A 3PLNA 1BDCA 1AJYA 5AW2B 1SQPE 3WU2H 1HJ0A 3JCUH 2FYUE 3D71A 3Q5PA 3H1KJ 2QVAA 4I7ZC 5KTBA 5CCGD 3HTKB 2CPBA 3BRVB 3CXHE 4C46A 1BE3J 1JOCA 1S5LX 3GHGC 2I1JA 3V4QA 1KMIZ 3V2PA 3VTPC 1RF1C 5APQA 2YIUC 2H7HA 3SFEC 1RF0A 1Q7YQ 1PGQA 1SFCC 1VQ8P 4NPEA 2QJKB 3E1RA 1Q2NA 1USDA 3NTNA 2JP3A 1BCCD 1SQQE 2K3RA 1JO5A 4IFDK 1L0NJ 2N1TA 1RY3A 2KIKA 4H13D 3AE9C 2WZ7A 4L75A 2ZJSE 5CMZA 4OWFA 3H1JJ 4D6TE 2BCCE 3H1LG 4OGQB 1EDIA 3L72E 3OE7H 2B88A 1W2BO 1BGYG 1H0TA 2IZ1A 1LJ2A 3L70E 3B5ND 2C0WA 1NTKE 2WT7A 4H0LD 3RK2B 2WMMA 3CCUP 1HF9A 2Y9ZA 4PD4H 5AVTB 3H1HJ 3W67A 2YKPA 1K05A 1LTBC 4JQ0D 3H6PA 2E43A 3N4XA 1WT6A 1URQD 4AUWA 5CCHC 2FFDB 3USSA 3VP9A 3F89A 1FJPA 5KLVK 3KZIE 1PGJA 2KS1A 2UWJE 3L74J 2YO2A 1U7JA 3HUSB 2QJPB 1KORA 5KAIE 2FYUK 3AECC 1NTME 3V6IA 1NTZD 3HD7C 1VQ5P 1DEBA 1DX7A 1KYOE 4WY4A 2P67A 2WTYA 1JEKA 5TJHA 4IL6X 3F5HA 3I56P 4EDFA 3VMXA 1FDMA 3OEHH 3CCLP 5KAFE 1GD2E 4BRYA 2KXPB 3V5BA 2WVRA 5BU5A 1L4AC 2MKVA 1PPJD 2QM8A 1SQQK 5GTHH 3CPWO 2H88C 3M9QA 3AEEC 3VOPA 1M1JC 3G9RA 1LTJB 5CCGC 4YXDC 1RHZB 1NTKK 1P84H 1PP9G 4Y28J 1ZRTE 3E1IA 5E79H 1LP1A 1ZOYC 4CPGA 2Z5HA 2HPCA 1FJKA 1RQUA 3T97B 1E79H 3FX0A 4HB1A 1LT9B 4W7ZA 3MTUE 1P84D 3CCVP 3D70A 1KILA 2XKMA 2Y0DA 1EZVD 4H13C 5KLVJ 2O01H 1NTMK 1DH3A 3CWBG 1S1CX 2GM4A 3CX5D 1GK4A 1FOSE 3B5NC 4H0LC 4L74A 1BGYE 2OYOA 4DZOA 2WSEH 5KLIB 1H88A 2FYUJ 3L36A 4HKZH 1EQ7A 3A0BH 4UB6E 4HH2A 1URQC 2Y9YA 1FE6A 1KQSO 1N2DC 1CI6B 3SWFA 1ZR4A 3MP7B 1RQVA 5AW1B 2N1TB 3B4SA 2K37A 1IO4A 2W8ZA 1J1DB 5C39A 5AW7B 4ZNCA 3AEFC 2XDJA 4R4MA 2OYIA 1EXJA 1YYCA 1LTTC 2R44A 1H0TB 1S5LE 2J58A 1NAYA 1SQQJ 5APVA 1VQ4P 4DOJA 1XTGB 1YTZI 1LTGC 3TGUD 2WSFJ 5B5EE 2Y0EA 1JM0A 1FZBA 3HTKA 1NAFA 3L70J 4YTPC 1NTKJ 2W83C 4OVNF 2P1JA 1JCCA 4XA4A 2ZYAA 4WBAA 2IBZI 2KS1B 1VF5D 1Q86Q 2E75B 1JCDA 1KTMA 4DCKA 1M8OB 2Z4EA 1NTZG 1MKMA 3FWLA 1KD1Q 2WSCJ 3HRNA 1SP4A 3OAKA 4WY4B 1VQ7P 2ZVNB 4I7ZB 1SQVG 2OYHC 1PP9E 1VQOP 3OAAH 1M7LA 1NTMJ 1SVFA 1PPJG 1GTWA 4IOIH 1N73C 4BRYB 4N3YB 3H1IG 5K5GB 1N7SD 1AVOA 3VMZA 5H2FE 4NPDA 2YIUB 2XU6A 2KP8A 1SFCB 3Q2YA 1HGZA 5AVXB 4N78D 3CCJP 2FXOA 4U3FD 1YJ9P 1RE4C 1NU1G 2AEMA 5APUA 1K04A 3TK1A 3HUSA 1IFJA 1LTIC 2E76B 3CWBE 3R2PA 1ZXGA 1QL1A 1FZGA 1DD4A 1OIPA 2XOKH 1LP1B 1IJDB 1Y8AA 2KUBA 3WU2E 3JCUE 2HPCB 5M1BA 4XE5B 5L8RJ 2O01N 2J59M 1GU4A 3FKSH 2J5UA 4I2LC 2XV5A 2M3EA 3H1KD 1EDLA 1EZVG 3L71G 2H43A 1PGOA 2E74D 1MZ9A 2KZIA 1S72P 3RL0D 1BE3D 4KT0J 2WPQA 4BWNA 1JB0J 1ZW0A 3O8ZA 2D2CD 2OTLP 1HGVA 2R5BA 1KILD 2KZJA 3V2QA 4JF7A 2OGUA 3HD7B 2AEFA 1IFPA 1J1EC 2G8YA 3AE8C 4UB8H 1NKZB 2KB7P 2FBWC 1QL2A 1L0ND 1S9KD 3C1LA 1BGYJ 3AEAC 3H1JD 3EWKA 4PD4E 1VF5C 1KV4A 3ABVC 1GMJA 3CX5I 3II6A 1SQBK 3T97A 3H1HD 1T3JA 1NTZE 1Z56A 3G71P 2W90A 3LIDA 2RQ6A 1SQXK 1LWUA 1CZQA 3TGUG 1YQ3C 5AVZB 2YXQB 2HR3A 4H44C 1GL2A 2IDBA 3C8VA 3FGAD 3L74D 1SQVE 2XNXA 1VQLP 1PPJE 1YJWP 3H32A 3RBZA 1N7SC 5AVVB 3AEDC 3L4FA 1EDKA 3H1IE 1PIXA 2E5YA 4IFMA 1VQ9P 2R32A 2I1KA 3RK3E 5KJ7D 1H8EH 2QJYC 5AW6B 4Y99B 3M0DA 1CI6A 3CL3D 4BXLA 1KC8Q 1LTAC 2WSSH 4GT1A 2Q3EA 1GU5A 1LT1A 3KDPB 1NU1E 3SWKA 1N86A 1S2EA 4QMAA 2IBZD 2IYOA 1GW4A 5GTHE 2FKWB 2K1AA 1IK7A 3L73J 1WMKA 1W5CE 1KB9E 1IK9A 1NKNA 3MIWA 1GDTA 2YNYA 1P84E 4OGQD 4PV1B 2OTJP 4U3FG 2E74C 5BVZA 3L71E 3A7OA 3RK2D 3L75G 1Q82Q 2KNCA 3M0AA 3SSUA 2H89C 3VYIA 1OFCX 2JWDA 2D2CC 1SQPK 4R4LA 3HE5B 1FC2C 1KILC 2IFNA 3RGUA 3AEBC 1OW7A 5BU8B 3A5TA 1SQBJ 1FDIA 1AA0A 2KYVA 2LR2A 2IYPA 5AW9B 1SQVK 5CJ4A 3M91A 1SQXJ 2WWWA 3HE4A 3CWBJ 3IAOA 1VDFA 4GODA 5KLVD 5AW0B 2HLDH 2P2UA 3TNUB 1BE3G 2SPZA 3LIEA 3BRTB 3NXSA 1GW3A 3GHGA 2ZXXA 4LC1A 3CCQP 4GIFA 2N9YB 1N7LA 2FYUD 3I5CA 1RF1A 3R4YA 3BCCJ 2QE7H 1NU1K 3RK3B 1SFCA 3Q5SA 1M1KQ 3GF3A 3TGUE 4K3AA 1CW5A 2K88A 2LXBA 2NPSD 2WSFH 4M3LA 3GW6A 2C9LY 3A0HH 3H1JG 1JNMA 1SS1A 4AYCA 3M9BA 1ZP0C 1JY2O 4HYTB 3CCRP 1YTZT 1T2KD 1SQQD 1IFMA 1L0LG 4GOEA 3CX5H 1W2EA 1R8EA 1K8AQ 1ZLLA 3B8EB 5KJ7C 4KHXA 3JC22 4C7NB 3L72D 1LWUB 5CCHA 3L70D 3CC7P 2ZVOB 1NTKD 2L91A 2WSCH 3AE7C 1G1JA 5GTIH 1GL2B 3RL0g 4RO0A 1X9VA 2QJKC 3P8MC 2NZ2A 4JYCA 3H1LE 2POHA 4WB4A 2FYNB 1SQPJ 3H32B 1KN7A 4JYBA 4K35A 1UIIA 3HD7A 2G3AA 5CHXA 3D6YA 1SQVJ 2A06D 2NRGA 1OX3A 1TU3F 1BCCG 2V4HA 4U3FE 2A45I 2JJLA 2ZT9D 3L75E 1Q90D 3H1IJ 1ZV8A 3LW5J 1USEA 2IBZG 1CSBA 1NTMD 4TLFA 4N6JA 2QRXA 1QLED 1MUUA 2QIWA 5DN6I 1L4AA 1KYOD 3CCMP 2FFDC 3MUDC 2RH0A 1EC5A 1QGKB 4ZKUA 1OVRA 2N1TD 2QJPC 1NU1J 2PAJA 5AVRB 3U59A 2HFED 3Q1MA 1M1JA 4GDOA 4D6TJ 2BCCJ 3L72J 5CCGA 1G1IA 2RQ7A 2FY8A 1S4XA 4LLHA 2KLVA 2OTKE 3P8CD 2M3BA 1BE3E 2KNCB 1JMBA 5TISH 1JY3P 4I6MC 3ZDMA 4GOFA 3PJSK 1YHQP 2IPPA 1VQ6P 3SWYA 3L71J 5DJUB 1OW6A 2PFXA 1VL2A 5APSA 2P10A 3WUUA 2JR8A 1ZRTD 3N7NA 3BATA 1U57A 1HH0A 2NPSC 4YPCA 4EOTA 5KLVG 1S9KE 2E75D 1KQGB 3HE4B 1X0TA 3KQGA 3VN0A 2I8DA 4H44B 4C7RA 1Q81Q 2XNDH 3H1JE 5APYA 4A7PA 2IFMA 2E42A 3QH9A 3B5NA 1LTJC 2QG4A 1T2KC 2W27A 2O01J 3GHGB 4WY4D 5AVWB 4UB8E 1OWAA 1L0LE 1X8YA 3GG2A 1RF1B 1NJIQ 1HTLC 2JKVA 1RE3C 1URQA 2IZ0A 1FZCC 2WSEJ 1WRGA 2KSJA 2V7QJ 2BEZF 1BGYD 2JO1A 3A3YB 1AQ5A 4HJGH 5APXA 3OFNH 1OW8A 1LT9C 2B87B 4XFJA 3AE5C 4I1LA 4IL6E 2ITAA 1EDJA 5APTA 1ZN5A 1SFCD 3HE5A 3P7KA 2M8RA 2PGDA 3S1KA 2PRRA 3CI9A 1YIJP 1OMIA 3B71A 1YBKA 3L37A 1JY3O 3WUTA 2E76D 1X22A 2LKMA 3V4WA 1FBMA 1M90Q 3CXHI 1BCCE 3L70G 1VQKP 2ZT9C 2AXTH 5KLIC 3CMEP 2E74B 1DD3A 3TNUA 2IBZE 2HLOA 2VRSA 1RF0C 4ZKPA 2YO3A 2D2CB 2ZYDA 2GA1A 2W6AA 4YXWH 2N1TC 3AE4C 1VQMP 2A06G 2YMKA 1K9MQ
chains in the Genus database with same CATH topology
1AQTA 4WVZA 2E5YA 5DN6I 4QMAA 2W6JH 3FKSH 1E79H 3PJSK 4DJGA 2E5TA 1JEKA 2HLDH 1BSNA 2XNDH 2RQ7A 2QE7H 3OE7H 5FL7H 3OAAH 4YXWH 1H8EH 3USSA 2CK3H 2RQ6A 2XOKH 3EFFK 3OEHH 2V7QH 2WSSH 4ASUH 1FS0E 1IFPA 3OFNH 4TLFA 1BSHA 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQT A;  4WVZ A;  2E5Y A;  5DN6 I;  4QMA A;  2W6J H;  3FKS H;  1E79 H;  3PJS K;  4DJG A;  2E5T A;  1JEK A;  2HLD H;  1BSN A;  2XND H;  2RQ7 A;  2QE7 H;  3OE7 H;  5FL7 H;  3OAA H;  4YXW H;  1H8E H;  3USS A;  2CK3 H;  2RQ6 A;  2XOK H;  3EFF K;  3OEH H;  2V7Q H;  2WSS H;  4ASU H;  1FS0 E;  1IFP A;  3OFN H;  4TLF A;  1BSH A;  2JDI H; 
#chains in the Genus database with same CATH topology
 3AE1 C;  3H1L J;  3K5B A;  1NO4 A;  2GUV A;  5B66 H;  1NTM G;  1L0L K;  2OYH A;  1KB9 I;  1A02 J;  1QVG O;  2WPR A;  3CMA P;  4B86 A;  2A45 H;  3HD7 D;  3U1A A;  4PJ0 H;  1FS0 E;  1N73 A;  2ZYG A;  3IF4 A;  3L73 D;  1FU1 A;  1L4A B;  1PGP A;  1HBW A;  3M06 A;  4C7N A;  1SLQ A;  2Q9I A;  3PP5 A;  1FZA A;  1M1J B;  5KLV E;  1RE4 A;  1NYH A;  1VPC A;  1JY2 N;  1S3J A;  1G2C B;  3FXE A;  3MGN A;  1BDD A;  3E7K A;  4W7Y A;  4WY4 C;  1KYO I;  1SQB D;  2N9B A;  1MV8 A;  1OVU A;  1AQT A;  3WUV A;  1AFO A;  4OH8 B;  3RBX A;  2B9B A;  1SQX D;  5FL7 H;  3CWB D;  1GK6 A;  1KZU B;  3OJA B;  4H13 B;  3CLQ A;  3EQ2 A;  4ASV A;  3MD0 A;  3EFG A;  2KI7 B;  1R5S A;  2R3S A;  3O6Q A;  4NPF X;  1MFT A;  1QVF O;  4L73 A;  2K9Y A;  2Q5U A;  1NOH A;  5APW A;  2KLU A;  3B5N B;  4H0L B;  2K9J A;  2M5A A;  3BCC D;  2HYN A;  3TSI A;  1NVO A;  2QSI A;  1OZH A;  2YMY A;  1BSH A;  2E76 C;  2JDI H;  4WVZ A;  4LGD E;  3GMA A;  1GZL A;  1PP9 J;  2C9N Y;  3A0H E;  1URQ B;  2HOD A;  2YKQ A;  5DJT B;  1EZV E;  1D7M A;  2QA4 P;  5E79 E;  1YIT P;  3RL0 C;  1ZR2 A;  1L0L J;  1NTZ K;  1JY2 P;  1OXZ A;  3CX5 E;  2QEX P;  4PV1 D;  1YI2 P;  5AVU B;  1PFI A;  2P7J A;  1K73 Q;  3WMM 0;  2L5G B;  2A06 E;  5GTI E;  1NWQ A;  1JTH A;  4PD4 D;  3H1K G;  3GLM A;  1BSN A;  1IFI A;  1PL5 A;  3KYQ A;  3CXH H;  5KKZ C;  3IFM A;  4U7J A;  1ZME C;  3LW5 H;  1FAV A;  2C0X A;  1N7S A;  1SQP D;  3A0B E;  4WWI A;  3Q5R A;  1BCC J;  2M0B A;  4GKG A;  1E5W A;  1HUC A;  1SQV D;  3NMD A;  2Q1K A;  2RKL A;  3CXH D;  3S9O A;  4ASU H;  1L0N G;  2OYI C;  2NPS B;  3MZW B;  3H1I D;  1YJN P;  2QM7 A;  1N8R Q;  3P8C E;  2B87 A;  2FYZ A;  3G6E P;  3MHV A;  3KHU A;  3JSV C;  3RK3 D;  3I55 P;  3V2R A;  2OYH B;  3L73 G;  1KB9 H;  2AXC A;  1N73 B;  2FXM A;  1VQP P;  3H1H G;  3VP8 A;  4EI2 A;  2HG5 D;  2LXC B;  3CCE P;  1NU1 D;  1Y9B A;  2YXR B;  5CJ0 A;  1VQN P;  4D6T D;  2BCC D;  2A45 G;  3KZI H;  1FZC B;  2P58 A;  5TIS E;  1KB9 D;  3OW2 O;  3L74 G;  3CC2 P;  2O1K A;  5KAI H;  1NTZ J;  3V2N A;  4Y99 C;  1RH5 B;  1JY3 N;  3AEG C;  3W68 A;  3NFQ A;  1SQB G;  4RJT A;  3TF5 A;  1QEX A;  3L71 D;  3ITK A;  2B89 A;  5AW3 B;  2CPS A;  1GL2 D;  1KYO H;  1SQX G;  1NHL A;  3VMA A;  4OGQ C;  1HVV A;  3S4R A;  1H89 A;  2Y0C A;  3IR9 A;  3U1C A;  4N78 E;  2CK3 H;  3RK2 C;  1LNQ A;  5CBO A;  2ZT9 B;  5KAF H;  2V7Q H;  2KK7 A;  4RKU J;  4PV1 C;  4RES B;  3O6Q B;  3CCS P;  3BCC G;  2O1J A;  1HJB A;  3PTZ A;  2K9J B;  2M5A B;  2ZXE B;  1KQF B;  3HUS C;  5AW8 B;  4EYY Q;  1M56 D;  2AEJ A;  1J1E B;  3H1K E;  4KJM A;  5CBN A;  2HOD B;  5AVY B;  1AVY A;  3SFD C;  2WT7 B;  1G2C A;  3EFF K;  4AQR D;  5AW5 B;  3PH0 A;  4L76 A;  3BVH A;  1VF5 B;  3FXD A;  1J2J B;  4MN4 C;  3G4S P;  1IFD A;  1KIL E;  1X79 B;  5AVS B;  3D6Z A;  3PHL A;  2AXT E;  5KJ7 A;  3C9I A;  1PZQ A;  1Y47 A;  1LTS C;  2WQY C;  3TYY A;  2H8P D;  2ZFC A;  4JPZ B;  1L0N E;  1JTH B;  2BEQ D;  4DJG A;  4W80 A;  3RK3 C;  4ASW A;  1SQP G;  1IZN B;  3L73 E;  3H25 A;  1MFZ A;  1XTC C;  2FYU G;  1N7S B;  3P32 A;  1DIP A;  3H1H E;  2KSE A;  2DW3 A;  4UB6 H;  4H44 D;  2R3C A;  2E5T A;  5B66 E;  4O9B A;  1EXI A;  3H1L D;  2QJY B;  4PD4 I;  4PJ0 E;  2JWA A;  3L74 E;  4TT3 H;  2MJZ A;  1LWU C;  2Z5I A;  2FFD A;  1S5L H;  3MUD A;  2WPV B;  1SQB E;  3TGU J;  1SQQ G;  2BAS A;  1GL2 C;  5EFW B;  4ZMD A;  3Q3D A;  3L75 D;  1KFM A;  2IX7 C;  5B5E H;  1SQX E;  3CC4 P;  2KOG A;  1NH4 A;  4D6T G;  2BCC G;  3L72 G;  2OQQ A;  1IC2 A;  1KFN A;  1DEE G;  3M9H A;  1T8Z A;  2FYN C;  3AE2 C;  1NTK G;  1LGH B;  2XZR A;  3CD6 P;  1QX8 A;  2YKO A;  1T3U A;  3RL0 B;  3PRJ A;  3AE6 C;  2RN0 A;  3KXD A;  3OA7 A;  2WPS A;  3M0D C;  1PV3 A;  1L0N K;  4EIJ A;  3BCC E;  2Q3I A;  1FOS F;  1IFN A;  1KIL B;  5CCH D;  1UIX A;  3FWN A;  2Q6Q A;  1J1D C;  1AV1 A;  4JBZ A;  5AW4 B;  1A02 F;  2PP6 A;  1R5L A;  3TDK A;  3VMY A;  2NPS A;  4DT0 A;  2JEE A;  3GF7 A;  2FXP A;  4Z1M H;  1H8A A;  3AE3 C;  5KKZ B;  1JUN A;  3UIA A;  1YQ4 C;  2RMZ A;  1JMM A;  1T6A A;  1LTJ A;  3L35 A;  1P84 I;  2W6J H;  5H2F H;  3KPE A;  3G3Z A;  1FZE A;  2W6B A;  1L2P A;  1M57 D;  2O3J A;  4U3F J;  1EZV I;  4IFF A;  2Q7C A;  1U7M A;  3L75 J;  1HWT C;  1PP9 D;  3QWO C;  1RE3 A;  1KQL A;  1FZC A;  3A2A A;  2GUS A;  3IN6 A;  2E75 C;  2R5D A;  1FZF A;  5AVQ B;  1L4A D;  2OAR A;  1NGM B;  1FDO A;  3BAS A;  2OYI B;  4IL6 H;  2ZAE B;  1L0L D;  1OVV A;  2WIT A;  1LT9 A;  3PLN A;  1BDC A;  1AJY A;  5AW2 B;  1SQP E;  3WU2 H;  1HJ0 A;  3JCU H;  2FYU E;  3D71 A;  3Q5P A;  3H1K J;  2QVA A;  4I7Z C;  5KTB A;  5CCG D;  3HTK B;  2CPB A;  3BRV B;  3CXH E;  4C46 A;  1BE3 J;  1JOC A;  1S5L X;  3GHG C;  2I1J A;  3V4Q A;  1KMI Z;  3V2P A;  3VTP C;  1RF1 C;  5APQ A;  2YIU C;  2H7H A;  3SFE C;  1RF0 A;  1Q7Y Q;  1PGQ A;  1SFC C;  1VQ8 P;  4NPE A;  2QJK B;  3E1R A;  1Q2N A;  1USD A;  3NTN A;  2JP3 A;  1BCC D;  1SQQ E;  2K3R A;  1JO5 A;  4IFD K;  1L0N J;  2N1T A;  1RY3 A;  2KIK A;  4H13 D;  3AE9 C;  2WZ7 A;  4L75 A;  2ZJS E;  5CMZ A;  4OWF A;  3H1J J;  4D6T E;  2BCC E;  3H1L G;  4OGQ B;  1EDI A;  3L72 E;  3OE7 H;  2B88 A;  1W2B O;  1BGY G;  1H0T A;  2IZ1 A;  1LJ2 A;  3L70 E;  3B5N D;  2C0W A;  1NTK E;  2WT7 A;  4H0L D;  3RK2 B;  2WMM A;  3CCU P;  1HF9 A;  2Y9Z A;  4PD4 H;  5AVT B;  3H1H J;  3W67 A;  2YKP A;  1K05 A;  1LTB C;  4JQ0 D;  3H6P A;  2E43 A;  3N4X A;  1WT6 A;  1URQ D;  4AUW A;  5CCH C;  2FFD B;  3USS A;  3VP9 A;  3F89 A;  1FJP A;  5KLV K;  3KZI E;  1PGJ A;  2KS1 A;  2UWJ E;  3L74 J;  2YO2 A;  1U7J A;  3HUS B;  2QJP B;  1KOR A;  5KAI E;  2FYU K;  3AEC C;  1NTM E;  3V6I A;  1NTZ D;  3HD7 C;  1VQ5 P;  1DEB A;  1DX7 A;  1KYO E;  4WY4 A;  2P67 A;  2WTY A;  1JEK A;  5TJH A;  4IL6 X;  3F5H A;  3I56 P;  4EDF A;  3VMX A;  1FDM A;  3OEH H;  3CCL P;  5KAF E;  1GD2 E;  4BRY A;  2KXP B;  3V5B A;  2WVR A;  5BU5 A;  1L4A C;  2MKV A;  1PPJ D;  2QM8 A;  1SQQ K;  5GTH H;  3CPW O;  2H88 C;  3M9Q A;  3AEE C;  3VOP A;  1M1J C;  3G9R A;  1LTJ B;  5CCG C;  4YXD C;  1RHZ B;  1NTK K;  1P84 H;  1PP9 G;  4Y28 J;  1ZRT E;  3E1I A;  5E79 H;  1LP1 A;  1ZOY C;  4CPG A;  2Z5H A;  2HPC A;  1FJK A;  1RQU A;  3T97 B;  1E79 H;  3FX0 A;  4HB1 A;  1LT9 B;  4W7Z A;  3MTU E;  1P84 D;  3CCV P;  3D70 A;  1KIL A;  2XKM A;  2Y0D A;  1EZV D;  4H13 C;  5KLV J;  2O01 H;  1NTM K;  1DH3 A;  3CWB G;  1S1C X;  2GM4 A;  3CX5 D;  1GK4 A;  1FOS E;  3B5N C;  4H0L C;  4L74 A;  1BGY E;  2OYO A;  4DZO A;  2WSE H;  5KLI B;  1H88 A;  2FYU J;  3L36 A;  4HKZ H;  1EQ7 A;  3A0B H;  4UB6 E;  4HH2 A;  1URQ C;  2Y9Y A;  1FE6 A;  1KQS O;  1N2D C;  1CI6 B;  3SWF A;  1ZR4 A;  3MP7 B;  1RQV A;  5AW1 B;  2N1T B;  3B4S A;  2K37 A;  1IO4 A;  2W8Z A;  1J1D B;  5C39 A;  5AW7 B;  4ZNC A;  3AEF C;  2XDJ A;  4R4M A;  2OYI A;  1EXJ A;  1YYC A;  1LTT C;  2R44 A;  1H0T B;  1S5L E;  2J58 A;  1NAY A;  1SQQ J;  5APV A;  1VQ4 P;  4DOJ A;  1XTG B;  1YTZ I;  1LTG C;  3TGU D;  2WSF J;  5B5E E;  2Y0E A;  1JM0 A;  1FZB A;  3HTK A;  1NAF A;  3L70 J;  4YTP C;  1NTK J;  2W83 C;  4OVN F;  2P1J A;  1JCC A;  4XA4 A;  2ZYA A;  4WBA A;  2IBZ I;  2KS1 B;  1VF5 D;  1Q86 Q;  2E75 B;  1JCD A;  1KTM A;  4DCK A;  1M8O B;  2Z4E A;  1NTZ G;  1MKM A;  3FWL A;  1KD1 Q;  2WSC J;  3HRN A;  1SP4 A;  3OAK A;  4WY4 B;  1VQ7 P;  2ZVN B;  4I7Z B;  1SQV G;  2OYH C;  1PP9 E;  1VQO P;  3OAA H;  1M7L A;  1NTM J;  1SVF A;  1PPJ G;  1GTW A;  4IOI H;  1N73 C;  4BRY B;  4N3Y B;  3H1I G;  5K5G B;  1N7S D;  1AVO A;  3VMZ A;  5H2F E;  4NPD A;  2YIU B;  2XU6 A;  2KP8 A;  1SFC B;  3Q2Y A;  1HGZ A;  5AVX B;  4N78 D;  3CCJ P;  2FXO A;  4U3F D;  1YJ9 P;  1RE4 C;  1NU1 G;  2AEM A;  5APU A;  1K04 A;  3TK1 A;  3HUS A;  1IFJ A;  1LTI C;  2E76 B;  3CWB E;  3R2P A;  1ZXG A;  1QL1 A;  1FZG A;  1DD4 A;  1OIP A;  2XOK H;  1LP1 B;  1IJD B;  1Y8A A;  2KUB A;  3WU2 E;  3JCU E;  2HPC B;  5M1B A;  4XE5 B;  5L8R J;  2O01 N;  2J59 M;  1GU4 A;  3FKS H;  2J5U A;  4I2L C;  2XV5 A;  2M3E A;  3H1K D;  1EDL A;  1EZV G;  3L71 G;  2H43 A;  1PGO A;  2E74 D;  1MZ9 A;  2KZI A;  1S72 P;  3RL0 D;  1BE3 D;  4KT0 J;  2WPQ A;  4BWN A;  1JB0 J;  1ZW0 A;  3O8Z A;  2D2C D;  2OTL P;  1HGV A;  2R5B A;  1KIL D;  2KZJ A;  3V2Q A;  4JF7 A;  2OGU A;  3HD7 B;  2AEF A;  1IFP A;  1J1E C;  2G8Y A;  3AE8 C;  4UB8 H;  1NKZ B;  2KB7 P;  2FBW C;  1QL2 A;  1L0N D;  1S9K D;  3C1L A;  1BGY J;  3AEA C;  3H1J D;  3EWK A;  4PD4 E;  1VF5 C;  1KV4 A;  3ABV C;  1GMJ A;  3CX5 I;  3II6 A;  1SQB K;  3T97 A;  3H1H D;  1T3J A;  1NTZ E;  1Z56 A;  3G71 P;  2W90 A;  3LID A;  2RQ6 A;  1SQX K;  1LWU A;  1CZQ A;  3TGU G;  1YQ3 C;  5AVZ B;  2YXQ B;  2HR3 A;  4H44 C;  1GL2 A;  2IDB A;  3C8V A;  3FGA D;  3L74 D;  1SQV E;  2XNX A;  1VQL P;  1PPJ E;  1YJW P;  3H32 A;  3RBZ A;  1N7S C;  5AVV B;  3AED C;  3L4F A;  1EDK A;  3H1I E;  1PIX A;  2E5Y A;  4IFM A;  1VQ9 P;  2R32 A;  2I1K A;  3RK3 E;  5KJ7 D;  1H8E H;  2QJY C;  5AW6 B;  4Y99 B;  3M0D A;  1CI6 A;  3CL3 D;  4BXL A;  1KC8 Q;  1LTA C;  2WSS H;  4GT1 A;  2Q3E A;  1GU5 A;  1LT1 A;  3KDP B;  1NU1 E;  3SWK A;  1N86 A;  1S2E A;  4QMA A;  2IBZ D;  2IYO A;  1GW4 A;  5GTH E;  2FKW B;  2K1A A;  1IK7 A;  3L73 J;  1WMK A;  1W5C E;  1KB9 E;  1IK9 A;  1NKN A;  3MIW A;  1GDT A;  2YNY A;  1P84 E;  4OGQ D;  4PV1 B;  2OTJ P;  4U3F G;  2E74 C;  5BVZ A;  3L71 E;  3A7O A;  3RK2 D;  3L75 G;  1Q82 Q;  2KNC A;  3M0A A;  3SSU A;  2H89 C;  3VYI A;  1OFC X;  2JWD A;  2D2C C;  1SQP K;  4R4L A;  3HE5 B;  1FC2 C;  1KIL C;  2IFN A;  3RGU A;  3AEB C;  1OW7 A;  5BU8 B;  3A5T A;  1SQB J;  1FDI A;  1AA0 A;  2KYV A;  2LR2 A;  2IYP A;  5AW9 B;  1SQV K;  5CJ4 A;  3M91 A;  1SQX J;  2WWW A;  3HE4 A;  3CWB J;  3IAO A;  1VDF A;  4GOD A;  5KLV D;  5AW0 B;  2HLD H;  2P2U A;  3TNU B;  1BE3 G;  2SPZ A;  3LIE A;  3BRT B;  3NXS A;  1GW3 A;  3GHG A;  2ZXX A;  4LC1 A;  3CCQ P;  4GIF A;  2N9Y B;  1N7L A;  2FYU D;  3I5C A;  1RF1 A;  3R4Y A;  3BCC J;  2QE7 H;  1NU1 K;  3RK3 B;  1SFC A;  3Q5S A;  1M1K Q;  3GF3 A;  3TGU E;  4K3A A;  1CW5 A;  2K88 A;  2LXB A;  2NPS D;  2WSF H;  4M3L A;  3GW6 A;  2C9L Y;  3A0H H;  3H1J G;  1JNM A;  1SS1 A;  4AYC A;  3M9B A;  1ZP0 C;  1JY2 O;  4HYT B;  3CCR P;  1YTZ T;  1T2K D;  1SQQ D;  1IFM A;  1L0L G;  4GOE A;  3CX5 H;  1W2E A;  1R8E A;  1K8A Q;  1ZLL A;  3B8E B;  5KJ7 C;  4KHX A;  3JC2 2;  4C7N B;  3L72 D;  1LWU B;  5CCH A;  3L70 D;  3CC7 P;  2ZVO B;  1NTK D;  2L91 A;  2WSC H;  3AE7 C;  1G1J A;  5GTI H;  1GL2 B;  3RL0 g;  4RO0 A;  1X9V A;  2QJK C;  3P8M C;  2NZ2 A;  4JYC A;  3H1L E;  2POH A;  4WB4 A;  2FYN B;  1SQP J;  3H32 B;  1KN7 A;  4JYB A;  4K35 A;  1UII A;  3HD7 A;  2G3A A;  5CHX A;  3D6Y A;  1SQV J;  2A06 D;  2NRG A;  1OX3 A;  1TU3 F;  1BCC G;  2V4H A;  4U3F E;  2A45 I;  2JJL A;  2ZT9 D;  3L75 E;  1Q90 D;  3H1I J;  1ZV8 A;  3LW5 J;  1USE A;  2IBZ G;  1CSB A;  1NTM D;  4TLF A;  4N6J A;  2QRX A;  1QLE D;  1MUU A;  2QIW A;  5DN6 I;  1L4A A;  1KYO D;  3CCM P;  2FFD C;  3MUD C;  2RH0 A;  1EC5 A;  1QGK B;  4ZKU A;  1OVR A;  2N1T D;  2QJP C;  1NU1 J;  2PAJ A;  5AVR B;  3U59 A;  2HFE D;  3Q1M A;  1M1J A;  4GDO A;  4D6T J;  2BCC J;  3L72 J;  5CCG A;  1G1I A;  2RQ7 A;  2FY8 A;  1S4X A;  4LLH A;  2KLV A;  2OTK E;  3P8C D;  2M3B A;  1BE3 E;  2KNC B;  1JMB A;  5TIS H;  1JY3 P;  4I6M C;  3ZDM A;  4GOF A;  3PJS K;  1YHQ P;  2IPP A;  1VQ6 P;  3SWY A;  3L71 J;  5DJU B;  1OW6 A;  2PFX A;  1VL2 A;  5APS A;  2P10 A;  3WUU A;  2JR8 A;  1ZRT D;  3N7N A;  3BAT A;  1U57 A;  1HH0 A;  2NPS C;  4YPC A;  4EOT A;  5KLV G;  1S9K E;  2E75 D;  1KQG B;  3HE4 B;  1X0T A;  3KQG A;  3VN0 A;  2I8D A;  4H44 B;  4C7R A;  1Q81 Q;  2XND H;  3H1J E;  5APY A;  4A7P A;  2IFM A;  2E42 A;  3QH9 A;  3B5N A;  1LTJ C;  2QG4 A;  1T2K C;  2W27 A;  2O01 J;  3GHG B;  4WY4 D;  5AVW B;  4UB8 E;  1OWA A;  1L0L E;  1X8Y A;  3GG2 A;  1RF1 B;  1NJI Q;  1HTL C;  2JKV A;  1RE3 C;  1URQ A;  2IZ0 A;  1FZC C;  2WSE J;  1WRG A;  2KSJ A;  2V7Q J;  2BEZ F;  1BGY D;  2JO1 A;  3A3Y B;  1AQ5 A;  4HJG H;  5APX A;  3OFN H;  1OW8 A;  1LT9 C;  2B87 B;  4XFJ A;  3AE5 C;  4I1L A;  4IL6 E;  2ITA A;  1EDJ A;  5APT A;  1ZN5 A;  1SFC D;  3HE5 A;  3P7K A;  2M8R A;  2PGD A;  3S1K A;  2PRR A;  3CI9 A;  1YIJ P;  1OMI A;  3B71 A;  1YBK A;  3L37 A;  1JY3 O;  3WUT A;  2E76 D;  1X22 A;  2LKM A;  3V4W A;  1FBM A;  1M90 Q;  3CXH I;  1BCC E;  3L70 G;  1VQK P;  2ZT9 C;  2AXT H;  5KLI C;  3CME P;  2E74 B;  1DD3 A;  3TNU A;  2IBZ E;  2HLO A;  2VRS A;  1RF0 C;  4ZKP A;  2YO3 A;  2D2C B;  2ZYD A;  2GA1 A;  2W6A A;  4YXW H;  2N1T C;  3AE4 C;  1VQM P;  2A06 G;  2YMK A;  1K9M Q; 
#chains in the Genus database with same CATH homology
 1AQT A;  4WVZ A;  2E5Y A;  5DN6 I;  4QMA A;  2W6J H;  3FKS H;  1E79 H;  3PJS K;  4DJG A;  2E5T A;  1JEK A;  2HLD H;  1BSN A;  2XND H;  2RQ7 A;  2QE7 H;  3OE7 H;  5FL7 H;  3OAA H;  4YXW H;  1H8E H;  3USS A;  2CK3 H;  2RQ6 A;  2XOK H;  3EFF K;  3OEH H;  2V7Q H;  2WSS H;  4ASU H;  1FS0 E;  1IFP A;  3OFN H;  4TLF A;  1BSH A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...