1FS0E

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
128
Chain Sequence
AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHDVDYAQASAELAKAIAQLRVIELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
total genus 32
structure length 128
sequence length 134
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
E PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1fs0E02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1fs0E01
1JEKA 2E5TA 2W6JH 5FL7H 1E79H 2WSSH 3PJSK 3OE7H 1AQTA 1BSNA 4DJGA 2XNDH 1FS0E 3FKSH 2V7QH 2RQ7A 2XOKH 2CK3H 3OEHH 2QE7H 3EFFK 2RQ6A 1BSHA 4YXWH 3OFNH 4TLFA 1IFPA 1H8EH 4ASUH 2HLDH 3OAAH 2E5YA 4WVZA 2JDIH 3USSA 5DN6I 4QMAA
chains in the Genus database with same CATH superfamily
1IZNB 1X79B 1DIPA 4B86A 2QA4P 2NZ2A 2W83C 3AECC 4OGQC 3CD6P 3M9BA 3Q5SA 1LTAC 3F5HA 3L37A 1ZN5A 2QIWA 3IAOA 5KAFH 1LT1A 3HE4A 2K88A 1IFIA 1SQQD 1YBKA 2E75C 5KAIH 1KB9E 2WT7A 5BU8B 2R3SA 4WWIA 1YI2P 1SQQJ 2FKWB 4XA4A 3CCRP 1KQGB 3H6PA 4HJGH 3HRNA 3SFEC 4ASUH 1KFNA 1JM0A 2C0WA 4GOFA 2JDIH 4IFFA 5DN6I 1FZFA 2YKQA 1PGJA 2WWWA 2E74B 3I5CA 3CC4P 2ZAEB 1YITP 3RK3B 1JCCA 4PJ0E 1HTLC 2CPSA 3EWKA 5GTIH 3M0DA 2RN0A 2YNYA 4GODA 2KZJA 3GHGB 3H1JD 2I8DA 1KFMA 2ZFCA 2CPBA 4N6JA 1XTGB 2IPPA 1U57A 3H1JJ 1GL2A 5TISH 4GOEA 2RQ6A 3L73D 1L0ND 1YJ9P 1VF5D 4H44D 2JR8A 3EFGA 3HD7D 2HR3A 4JQ0D 3L73J 1L0NJ 1JY3N 1WMKA 2XZRA 3NFQA 1HUCA 2E74C 3L71G 4PD4E 2HODA 3E1RA 3RK3C 4GDOA 4IFDK 1QGKB 3VP9A 1FOSF 1QVFO 2P7JA 3RBXA 1JOCA 1EDJA 1YQ4C 3V2NA 2Q6QA 1SQBD 3HD7A 4H13B 1BGYE 2AEMA 3KXDA 1BGYG 1JMBA 1SQBJ 2FYUD 4W80A 1PPJD 4KHXA 5KKZB 3O6QB 1Q90D 2FYUJ 2YKOA 1ZR2A 2HLOA 2KLVA 3L75D 3E7KA 2JO1A 1SFCD 1QVGO 1RE4A 2P10A 4IOIH 4BRYA 1MFTA 1NO4A 3II6A 1RF1A 5GTHH 1CZQA 3B5ND 1SQVE 3AE6C 5KLVD 1X8YA 2KXPB 3CC7P 3P32A 3H32A 1KN7A 4GIFA 3CX5E 5KLVJ 2Q3EA 4H13C 2LKMA 5L8RJ 3MD0A 1EDLA 3VN0A 2LXBA 5KKZC 2B88A 3T97A 5AVTB 2IBZD 2PGDA 5AW0B 2QRXA 2YO2A 1KILE 2HG5D 2I1KA 1NAFA 1PFIA 5AVXB 5BVZA 5KAIE 1SQPG 4GKGA 5AVUB 2C0XA 1BDCA 1NTKD 1OWAA 2M8RA 1HGZA 3MHVA 2R3CA 3C1LA 3HE5A 4JYCA 1M56D 1NTKJ 1T8ZA 1FZEA 3AEBC 3HUSB 1DEBA 1FDMA 2Y9YA 1FJPA 4WBAA 3V2PA 1SVFA 3A2AA 3S9OA 2YXRB 2KB7P 1CI6A 3BATA 1PGPA 2WPSA 3AE5C 3TGUD 1BCCG 2QM7A 5B66H 5B5EH 1H0TB 2O1JA 1KZUB 3TGUJ 3VOPA 1GW4A 1IJDB 2Y0CA 5AVRB 3H1KD 1AVOA 2R32A 1NYHA 2KOGA 1PP9E 2P1JA 1MUUA 2ZYGA 3H1KJ 1G1IA 1N86A 3D6YA 1OFCX 1VQ5P 3KZIH 3HUSC 2AEJA 1LNQA 1AVYA 1X9VA 2FXPA 3IFMA 2AEFA 1ZRTE 1VL2A 1KORA 1SQXK 1KQSO 2WSEJ 1EZVE 2ZVNB 1EZVG 5CBNA 5AVVB 4WY4D 2G8YA 1OVRA 4UB6H 3JC22 3N7NA 2IZ0A 2RH0A 1QL1A 1IFMA 2GM4A 4OH8B 3CCLP 3G9RA 1E5WA 2H88C 3AE4C 3Q5RA 5AW9B 2MKVA 4NPEA 3H1ID 5E79H 2FY8A 1Y47A 2Q9IA 4IL6X 3GMAA 3LIEA 1M8OB 2FXMA 3H1IJ 4ZMDA 2M3EA 1L0LE 5AW4B 1S5LH 1LTGC 1ZV8A 3KYQA 1FZCC 2PRRA 2M5AB 4JYBA 1JCDA 1GU5A 2O01J 4Z1MH 1KV4A 4KT0J 3RK2D 3O6QA 1H88A 3M0DC 1LP1B 1LTTC 4HH2A 1VF5B 4H44B 5EFWB 1SP4A 3GW6A 4D6TG 1BGYD 2JWDA 5KJ7C 3G4SP 5AVSB 1BGYJ 2V4HA 1GTWA 4O9BA 2WPQA 1OVVA 4CPGA 2M0BA 1P84I 1T3JA 1N7SD 4N78E 2IX7C 3AE2C 3G6EP 2OQQA 1N8RQ 1OW7A 1S9KE 5M1BA 1SQVD 3IF4A 2NRGA 2XDJA 3C8VA 1FE6A 1LTBC 1SQVJ 1RHZB 4H44C 1YIJP 1NOHA 5B66E 5DJTB 2L91A 1NTZK 3AE1C 1SFCB 4K3AA 5CJ0A 2HFED 1R5LA 4RJTA 3AEFC 2CK3H 1AA0A 3H1HE 1VQLP 3H1HG 4AUWA 3B5NB 3HUSA 4A7PA 1KILD 3NXSA 3KZIE 1FC2C 3H1LE 4KJMA 3U59A 3H1LG 2YMKA 2H43A 1VQOP 1GZLA 1KB9I 2WZ7A 1FZAA 1OW8A 4DT0A 3BASA 3FXEA 1LTIC 3CI9A 4UB6E 4C7NB 3LW5J 3AE7C 4RESB 3FWLA 1RQUA 3KQGA 2KIKA 1GK4A 1SFCC 1W5CE 1DEEG 3ZDMA 2H89C 1ZR4A 3A0BH 1K05A 1EDIA 1CI6B 2GUSA 3MGNA 3G71P 4LLHA 3BVHA 3B5NC 3KPEA 1FDIA 5E79E 3CCQP 1USEA 4C46A 3V4QA 3M9HA 1OZHA 1L4AD 4W7ZA 1Q82Q 1VQ4P 1SQQK 3I56P 1GMJA 1NAYA 3OFNH 3SWYA 3U1CA 2HLDH 1PP9D 1JTHA 5KJ7D 1S5LE 1ZXGA 1VQ8P 2W6JH 1FZCA 1PP9J 2WSFH 3L72G 4L74A 4H0LD 3FKSH 3Q2YA 3C9IA 3CXHH 1KMIZ 2O3JA 3Q1MA 1L2PA 2BASA 2JJLA 2LXCB 4EOTA 1ZRTD 1HH0A 3W68A 4PD4I 1EZVD 3VMAA 1K73Q 1W2EA 2WPRA 5KJ7A 1QEXA 3LIDA 1J2JB 2W8ZA 3W67A 1RE3A 2IZ1A 3VMYA 1GDTA 2J5UA 1T6AA 1FU1A 1Y9BA 2XNXA 1L0NK 1URQD 2Y0DA 5CBOA 2M5AA 3L71E 2HYNA 3WU2H 1IK7A 3P8CD 1S4XA 1LWUB 1FZGA 4I6MC 4WY4B 3V2QA 1EXJA 2W6AA 1NU1D 1L0LD 5CHXA 1IFDA 3V5BA 1LP1A 1OVUA 3CLQA 1GD2E 1FS0E 2O01N 1NU1J 1L0LJ 4L76A 4OWFA 3ITKA 1WRGA 1URQA 1KYOI 1SQBK 2OTKE 1Q2NA 3UIAA 2WSCJ 3AE3C 2GA1A 3CX5I 1VPCA 4U3FE 4U3FG 3EFFK 1OIPA 2A06E 1NKNA 3WUTA 2A06G 3L75J 3VMZA 3Q3DA 1KQLA 2KLUA 1PGQA 2OYIC 1LWUC 5AW5B 1JY2P 3Q5PA 4WY4C 2GUVA 3OAKA 1RQVA 2FFDA 5BU5A 1KYOE 4U7JA 1HWTC 3RK2B 3L70E 5KLVK 3GF7A 3L70G 4N78D 3VTPC 2KI7B 3NTNA 1SFCA 1S1CX 1NTZE 3H25A 1NTZG 4ASVA 2BCCE 3E1IA 2BCCG 1M7LA 1S9KD 3A0BE 3D6ZA 5KAFE 3B5NA 1RF0C 1SQPE 2P58A 3BCCE 5APSA 3BCCG 5AVQB 1N7SB 4IL6H 1P84D 1IFNA 2Z5HA 2Z4EA 1HGVA 3OEHH 3OJAB 1DH3A 1X0TA 1BE3G 1NTKK 4R4LA 1JY3P 1NH4A 4DOJA 3CC2P 3H1HD 1JY2O 4C7NA 3RBZA 3RK2C 1VQMP 2RMZA 4L73A 3AEEC 2PP6A 2J58A 1WT6A 1NTMD 3CXHE 3H1LD 4ZNCA 2SPZA 5GTIE 2KSEA 1NTMJ 3H1LJ 5APVA 2IDBA 2FBWC 1BCCE 3RL0g 3M06A 2ZYDA 3CPWO 1NHLA 5TISE 1EZVI 1KC8Q 3SWFA 1N7SC 1KILB 3A0HH 2O1KA 1SQQE 1K9MQ 3V4WA 3L74E 1EXIA 1SQQG 2V7QJ 3L74G 1K04A 3CCUP 2PFXA 1FOSE 5AW6B 1KB9D 1MZ9A 1JY3O 1EQ7A 4Y28J 5CCGC 2OTLP 3AEDC 1U7MA 1JTHB 2N9YB 2E5TA 3WMM0 1FZCB 2ZT9D 2N1TD 2AXTH 4M3LA 3B71A 3MZWB 3AEAC 2K9JB 1J1EB 3BRTB 2W6BA 1KILC 3S4RA 3CCSP 1L4AB 3MUDC 4JBZA 1R5SA 5TJHA 2A45H 5AW1B 2E42A 3L73G 1QL2A 2UWJE 2WITA 2H7HA 2OYIA 2VRSA 1LWUA 4WY4A 5GTHE 1ZW0A 2D2CD 1ZLLA 4OVNF 1G1JA 3I55P 2I1JA 1YJWP 4H0LB 2WTYA 2P2UA 2Q3IA 4HB1A 2MJZA 2WSEH 4NPDA 5APXA 3L71D 1YTZI 4PD4D 2G3AA 3TSIA 2POHA 1J1EC 1GK6A 3L71J 2XV5A 1SQBG 2KUBA 1L4AC 3D71A 2IYPA 1RF0A 2K37A 4D6TE 1OX3A 1D7MA 4XFJA 1PPJE 3FXDA 1PPJG 2PAJA 1ZMEC 2Y9ZA 1A02J 2KSJA 1URQB 1SLQA 5H2FH 2B87A 4IL6E 1RE3C 1FJKA 2QG4A 4H0LC 1Q7YQ 5AVWB 2C9LY 2QEXP 5DJUB 4BWNA 1NVOA 1YYCA 1LGHB 1GU4A 3CMEP 3L36A 1JO5A 5KLVE 4AYCA 5KLVG 1LTSC 2Y0EA 1VDFA 1QX8A 1LJ2A 2FFDB 1AV1A 2O01H 3SSUA 1KYOD 2M3BA 1H8EH 3JSVC 1SQVK 5B5EE 5CCGD 3CX5D 3L70D 2OYHB 5CCHD 1URQC 2IBZG 1N7SA 3OE7H 1DD3A 4NPFX 1NTZD 3A0HE 3L70J 2OARA 1USDA 2XOKH 1LTJB 3L4FA 1N7LA 2E76D 3AE8C 1AQ5A 1NTZJ 1Q86Q 3M0AA 4C7RA 3GLMA 1PIXA 4K35A 1NTKG 2QJYB 2B89A 1NKZB 3N4XA 1SQPD 3BCCD 4JPZB 3TDKA 1VQPP 5CCGA 1YJNP 1SQPJ 2FYZA 5APUA 4Y99C 2QE7H 3BCCJ 1QLED 2H8PD 2FFDC 3FGAD 2KYVA 1EC5A 2AXTE 4DJGA 2OYHC 5C39A 2ZJSE 1N73C 4AQRD 1KILA 3RK3E 2KZIA 3OA7A 3MUDA 3GF3A 1KD1Q 1LTJC 1T2KC 3V6IA 2QJPC 1JNMA 3RL0C 3H1KE 1DX7A 2A45G 3H1KG 3FX0A 1BCCD 1FAVA 2QJYC 5AVZB 4BXLA 5APTA 1CW5A 1BCCJ 4YXWH 3PTZA 4HKZH 1XTCC 2KS1B 3L74D 1SQXE 4DZOA 1SQXG 1LT9C 1U7JA 3L72E 2ZYAA 2Q5UA 1JY2N 3L74J 5APWA 2LR2A 1GW3A 2W27A 3B4SA 1BSHA 2K9JA 3LW5H 3D70A 3IN6A 3OW2O 1GL2D 2NPSC 1L4AA 4ZKUA 4QMAA 2R5DA 4PV1D 3MIWA 3AE9C 4XE5B 1PGOA 4WB4A 3MTUE 2WQYC 4N3YB 5H2FE 3SFDC 2W90A 1OXZA 1S2EA 1VQNP 1R8EA 1JEKA 1MFZA 2Q1KA 3H1IE 3H1IG 2K3RA 5AW3B 4UB8H 1M57D 1TU3F 2OTJP 3IR9A 3F89A 2QJKB 3EQ2A 3CWBE 3CWBG 2OYIB 5AW2B 4WVZA 4DCKA 1PV3A 2ZT9B 1NWQA 1SS1A 2R44A 1PL5A 2N1TB 4YXDC 3JCUH 4LGDE 3BRVB 5APYA 1NU1K 1L0LK 1M1JB 3O8ZA 3QH9A 3CCJP 1HVVA 2BEQD 3GHGC 4ASWA 1G2CB 2FYUK 3PLNA 3VMXA 2D2CB 5CMZA 3KHUA 4EIJA 1VQ7P 4D6TD 4HYTB 3VP8A 2QJKC 2N9BA 1T2KD 3R2PA 4D6TJ 5KTBA 2B87B 2ZT9C 3HTKB 3RL0D 1BSNA 3PH0A 2R5BA 3A3YB 4OGQD 2OGUA 2N1TC 3CCVP 1IO4A 1IK9A 1HF9A 1BDDA 3TF5A 3M91A 3L35A 2YO3A 2OYHA 1M1JC 2E75D 1SQVG 1N73A 5FL7H 3U1AA 4MN4C 1DD4A 1MV8A 2J59M 1LTJA 1PZQA 2WSCH 2QVAA 2D2CC 3CXHI 2FXOA 2XKMA 2ZVOB 2NPSD 2ITAA 2IFNA 1FBMA 2HPCB 1BE3E 1IFPA 1MKMA 1LT9A 3R4YA 3USSA 4YPCA 3H1HJ 1NGMB 4RO0A 2YXQB 2Q7CA 1CSBA 4IFMA 3AEGC 1RY3A 2NPSA 4EYYQ 3TNUB 1NTMK 3VYIA 1H8AA 5AVYB 2KNCB 1FZBA 3ABVC 3B8EB 2WSSH 2KP8A 3FWNA 4EI2A 2E76B 2E74D 1T3UA 4L75A 3PHLA 2L5GB 3RK3D 2KS1A 1AFOA 3MP7B 1YTZT 2B9BA 1UIIA 3KDPB 4UB8E 2ZXXA 1M90Q 1P84H 1YQ3C 2ZXEB 3WU2E 2DW3A 1PP9G 4EDFA 1AJYA 3HE4B 5CCHC 2YKPA 3JCUE 3V2RA 2Z5IA 2WT7B 1SQXD 3L72D 2E76C 4I7ZB 1SQXJ 1ZOYC 3GHGA 3H1JE 3L72J 3P8MC 2FYNB 2IYOA 3H1JG 3NMDA 5CJ4A 3CMAP 3PP5A 3L73E 2V7QH 1L0NE 1VQKP 2QSIA 3G3ZA 1L0NG 1K8AQ 3PRJA 2K9YA 4H13D 2AXCA 2YIUB 2JEEA 2N1TA 1W2BO 4LC1A 1KB9H 2XNDH 2JKVA 3M9QA 3P8CE 2BEZF 1GL2B 1M1KQ 4TLFA 1M1JA 1NU1E 4PV1B 4I7ZC 1NU1G 1L0LG 3CWBD 5AW8B 3TYYA 2FYNC 1G2CA 1SQBE 1HBWA 3CWBJ 2JP3A 2WVRA 5APQA 1Z56A 1ZP0C 3WUVA 4I1LA 2FYUE 2HODB 2FYUG 4GT1A 4PJ0H 2E43A 1S72P 2YMYA 3K5BA 4R4MA 5KLIB 3HTKA 3L75E 1E79H 2YIUC 1H89A 3L75G 2RKLA 1J1DB 3CCEP 3HD7B 2RQ7A 2IBZI 1JMMA 4U3FD 2QM8A 3OAAH 3A7OA 1GL2C 3GG2A 2A06D 1S3JA 1JB0J 1JUNA 4U3FJ 4PV1C 1RH5B 2WMMA 4Y99B 2OYOA 1VQ6P 4RKUJ 4BRYB 4PD4H 4JF7A 1RF1B 4ZKPA 1FDOA 3P7KA 4YTPC 2IBZE 4TT3H 1N73B 3WUUA 5KLIC 2HPCA 1UIXA 2BCCD 1J1DC 2JWAA 1VF5C 3QWOC 1OMIA 3H32B 3HD7C 3TK1A 1Q81Q 1IC2A 2QJPB 2BCCJ 2P67A 3RL0B 1HJ0A 1NTKE 4OGQB 1YHQP 1P84E 1A02F 3CL3D 1OW6A 2IFMA 4W7YA 1AQTA 3T97B 3A5TA 1KTMA 3CCMP 2A45I 1SQPK 5CCHA 2K1AA 3TNUA 2E75B 4I2LC 1BE3D 2E5YA 5AW7B 2KNCA 1RE4C 3RGUA 1VQ9P 1EDKA 1LT9B 1N2DC 3SWKA 1X22A 1NTME 1KQFB 1NTMG 3S1KA 1RF1C 1BE3J 3PJSK 2XU6A 2C9NY 1Y8AA 3HE5B 1S5LX 5K5GB 2WSFJ 3CXHD 1IFJA 1HJBA 1KYOH 3TGUE 2NPSB 3TGUG 2WPVB 2KK7A 1H0TA 3CX5H 1NJIQ
chains in the Genus database with same CATH topology
1JEKA 2E5TA 2W6JH 5FL7H 1E79H 2WSSH 3PJSK 3OE7H 1AQTA 1BSNA 4DJGA 2XNDH 1FS0E 3FKSH 2V7QH 2RQ7A 2XOKH 2CK3H 3OEHH 2QE7H 3EFFK 2RQ6A 1BSHA 4YXWH 3OFNH 4TLFA 1IFPA 1H8EH 4ASUH 2HLDH 3OAAH 2E5YA 4WVZA 2JDIH 3USSA 5DN6I 4QMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JEK A;  2E5T A;  2W6J H;  5FL7 H;  1E79 H;  2WSS H;  3PJS K;  3OE7 H;  1AQT A;  1BSN A;  4DJG A;  2XND H;  1FS0 E;  3FKS H;  2V7Q H;  2RQ7 A;  2XOK H;  2CK3 H;  3OEH H;  2QE7 H;  3EFF K;  2RQ6 A;  1BSH A;  4YXW H;  3OFN H;  4TLF A;  1IFP A;  1H8E H;  4ASU H;  2HLD H;  3OAA H;  2E5Y A;  4WVZ A;  2JDI H;  3USS A;  5DN6 I;  4QMA A; 
#chains in the Genus database with same CATH topology
 1IZN B;  1X79 B;  1DIP A;  4B86 A;  2QA4 P;  2NZ2 A;  2W83 C;  3AEC C;  4OGQ C;  3CD6 P;  3M9B A;  3Q5S A;  1LTA C;  3F5H A;  3L37 A;  1ZN5 A;  2QIW A;  3IAO A;  5KAF H;  1LT1 A;  3HE4 A;  2K88 A;  1IFI A;  1SQQ D;  1YBK A;  2E75 C;  5KAI H;  1KB9 E;  2WT7 A;  5BU8 B;  2R3S A;  4WWI A;  1YI2 P;  1SQQ J;  2FKW B;  4XA4 A;  3CCR P;  1KQG B;  3H6P A;  4HJG H;  3HRN A;  3SFE C;  4ASU H;  1KFN A;  1JM0 A;  2C0W A;  4GOF A;  2JDI H;  4IFF A;  5DN6 I;  1FZF A;  2YKQ A;  1PGJ A;  2WWW A;  2E74 B;  3I5C A;  3CC4 P;  2ZAE B;  1YIT P;  3RK3 B;  1JCC A;  4PJ0 E;  1HTL C;  2CPS A;  3EWK A;  5GTI H;  3M0D A;  2RN0 A;  2YNY A;  4GOD A;  2KZJ A;  3GHG B;  3H1J D;  2I8D A;  1KFM A;  2ZFC A;  2CPB A;  4N6J A;  1XTG B;  2IPP A;  1U57 A;  3H1J J;  1GL2 A;  5TIS H;  4GOE A;  2RQ6 A;  3L73 D;  1L0N D;  1YJ9 P;  1VF5 D;  4H44 D;  2JR8 A;  3EFG A;  3HD7 D;  2HR3 A;  4JQ0 D;  3L73 J;  1L0N J;  1JY3 N;  1WMK A;  2XZR A;  3NFQ A;  1HUC A;  2E74 C;  3L71 G;  4PD4 E;  2HOD A;  3E1R A;  3RK3 C;  4GDO A;  4IFD K;  1QGK B;  3VP9 A;  1FOS F;  1QVF O;  2P7J A;  3RBX A;  1JOC A;  1EDJ A;  1YQ4 C;  3V2N A;  2Q6Q A;  1SQB D;  3HD7 A;  4H13 B;  1BGY E;  2AEM A;  3KXD A;  1BGY G;  1JMB A;  1SQB J;  2FYU D;  4W80 A;  1PPJ D;  4KHX A;  5KKZ B;  3O6Q B;  1Q90 D;  2FYU J;  2YKO A;  1ZR2 A;  2HLO A;  2KLV A;  3L75 D;  3E7K A;  2JO1 A;  1SFC D;  1QVG O;  1RE4 A;  2P10 A;  4IOI H;  4BRY A;  1MFT A;  1NO4 A;  3II6 A;  1RF1 A;  5GTH H;  1CZQ A;  3B5N D;  1SQV E;  3AE6 C;  5KLV D;  1X8Y A;  2KXP B;  3CC7 P;  3P32 A;  3H32 A;  1KN7 A;  4GIF A;  3CX5 E;  5KLV J;  2Q3E A;  4H13 C;  2LKM A;  5L8R J;  3MD0 A;  1EDL A;  3VN0 A;  2LXB A;  5KKZ C;  2B88 A;  3T97 A;  5AVT B;  2IBZ D;  2PGD A;  5AW0 B;  2QRX A;  2YO2 A;  1KIL E;  2HG5 D;  2I1K A;  1NAF A;  1PFI A;  5AVX B;  5BVZ A;  5KAI E;  1SQP G;  4GKG A;  5AVU B;  2C0X A;  1BDC A;  1NTK D;  1OWA A;  2M8R A;  1HGZ A;  3MHV A;  2R3C A;  3C1L A;  3HE5 A;  4JYC A;  1M56 D;  1NTK J;  1T8Z A;  1FZE A;  3AEB C;  3HUS B;  1DEB A;  1FDM A;  2Y9Y A;  1FJP A;  4WBA A;  3V2P A;  1SVF A;  3A2A A;  3S9O A;  2YXR B;  2KB7 P;  1CI6 A;  3BAT A;  1PGP A;  2WPS A;  3AE5 C;  3TGU D;  1BCC G;  2QM7 A;  5B66 H;  5B5E H;  1H0T B;  2O1J A;  1KZU B;  3TGU J;  3VOP A;  1GW4 A;  1IJD B;  2Y0C A;  5AVR B;  3H1K D;  1AVO A;  2R32 A;  1NYH A;  2KOG A;  1PP9 E;  2P1J A;  1MUU A;  2ZYG A;  3H1K J;  1G1I A;  1N86 A;  3D6Y A;  1OFC X;  1VQ5 P;  3KZI H;  3HUS C;  2AEJ A;  1LNQ A;  1AVY A;  1X9V A;  2FXP A;  3IFM A;  2AEF A;  1ZRT E;  1VL2 A;  1KOR A;  1SQX K;  1KQS O;  2WSE J;  1EZV E;  2ZVN B;  1EZV G;  5CBN A;  5AVV B;  4WY4 D;  2G8Y A;  1OVR A;  4UB6 H;  3JC2 2;  3N7N A;  2IZ0 A;  2RH0 A;  1QL1 A;  1IFM A;  2GM4 A;  4OH8 B;  3CCL P;  3G9R A;  1E5W A;  2H88 C;  3AE4 C;  3Q5R A;  5AW9 B;  2MKV A;  4NPE A;  3H1I D;  5E79 H;  2FY8 A;  1Y47 A;  2Q9I A;  4IL6 X;  3GMA A;  3LIE A;  1M8O B;  2FXM A;  3H1I J;  4ZMD A;  2M3E A;  1L0L E;  5AW4 B;  1S5L H;  1LTG C;  1ZV8 A;  3KYQ A;  1FZC C;  2PRR A;  2M5A B;  4JYB A;  1JCD A;  1GU5 A;  2O01 J;  4Z1M H;  1KV4 A;  4KT0 J;  3RK2 D;  3O6Q A;  1H88 A;  3M0D C;  1LP1 B;  1LTT C;  4HH2 A;  1VF5 B;  4H44 B;  5EFW B;  1SP4 A;  3GW6 A;  4D6T G;  1BGY D;  2JWD A;  5KJ7 C;  3G4S P;  5AVS B;  1BGY J;  2V4H A;  1GTW A;  4O9B A;  2WPQ A;  1OVV A;  4CPG A;  2M0B A;  1P84 I;  1T3J A;  1N7S D;  4N78 E;  2IX7 C;  3AE2 C;  3G6E P;  2OQQ A;  1N8R Q;  1OW7 A;  1S9K E;  5M1B A;  1SQV D;  3IF4 A;  2NRG A;  2XDJ A;  3C8V A;  1FE6 A;  1LTB C;  1SQV J;  1RHZ B;  4H44 C;  1YIJ P;  1NOH A;  5B66 E;  5DJT B;  2L91 A;  1NTZ K;  3AE1 C;  1SFC B;  4K3A A;  5CJ0 A;  2HFE D;  1R5L A;  4RJT A;  3AEF C;  2CK3 H;  1AA0 A;  3H1H E;  1VQL P;  3H1H G;  4AUW A;  3B5N B;  3HUS A;  4A7P A;  1KIL D;  3NXS A;  3KZI E;  1FC2 C;  3H1L E;  4KJM A;  3U59 A;  3H1L G;  2YMK A;  2H43 A;  1VQO P;  1GZL A;  1KB9 I;  2WZ7 A;  1FZA A;  1OW8 A;  4DT0 A;  3BAS A;  3FXE A;  1LTI C;  3CI9 A;  4UB6 E;  4C7N B;  3LW5 J;  3AE7 C;  4RES B;  3FWL A;  1RQU A;  3KQG A;  2KIK A;  1GK4 A;  1SFC C;  1W5C E;  1DEE G;  3ZDM A;  2H89 C;  1ZR4 A;  3A0B H;  1K05 A;  1EDI A;  1CI6 B;  2GUS A;  3MGN A;  3G71 P;  4LLH A;  3BVH A;  3B5N C;  3KPE A;  1FDI A;  5E79 E;  3CCQ P;  1USE A;  4C46 A;  3V4Q A;  3M9H A;  1OZH A;  1L4A D;  4W7Z A;  1Q82 Q;  1VQ4 P;  1SQQ K;  3I56 P;  1GMJ A;  1NAY A;  3OFN H;  3SWY A;  3U1C A;  2HLD H;  1PP9 D;  1JTH A;  5KJ7 D;  1S5L E;  1ZXG A;  1VQ8 P;  2W6J H;  1FZC A;  1PP9 J;  2WSF H;  3L72 G;  4L74 A;  4H0L D;  3FKS H;  3Q2Y A;  3C9I A;  3CXH H;  1KMI Z;  2O3J A;  3Q1M A;  1L2P A;  2BAS A;  2JJL A;  2LXC B;  4EOT A;  1ZRT D;  1HH0 A;  3W68 A;  4PD4 I;  1EZV D;  3VMA A;  1K73 Q;  1W2E A;  2WPR A;  5KJ7 A;  1QEX A;  3LID A;  1J2J B;  2W8Z A;  3W67 A;  1RE3 A;  2IZ1 A;  3VMY A;  1GDT A;  2J5U A;  1T6A A;  1FU1 A;  1Y9B A;  2XNX A;  1L0N K;  1URQ D;  2Y0D A;  5CBO A;  2M5A A;  3L71 E;  2HYN A;  3WU2 H;  1IK7 A;  3P8C D;  1S4X A;  1LWU B;  1FZG A;  4I6M C;  4WY4 B;  3V2Q A;  1EXJ A;  2W6A A;  1NU1 D;  1L0L D;  5CHX A;  1IFD A;  3V5B A;  1LP1 A;  1OVU A;  3CLQ A;  1GD2 E;  1FS0 E;  2O01 N;  1NU1 J;  1L0L J;  4L76 A;  4OWF A;  3ITK A;  1WRG A;  1URQ A;  1KYO I;  1SQB K;  2OTK E;  1Q2N A;  3UIA A;  2WSC J;  3AE3 C;  2GA1 A;  3CX5 I;  1VPC A;  4U3F E;  4U3F G;  3EFF K;  1OIP A;  2A06 E;  1NKN A;  3WUT A;  2A06 G;  3L75 J;  3VMZ A;  3Q3D A;  1KQL A;  2KLU A;  1PGQ A;  2OYI C;  1LWU C;  5AW5 B;  1JY2 P;  3Q5P A;  4WY4 C;  2GUV A;  3OAK A;  1RQV A;  2FFD A;  5BU5 A;  1KYO E;  4U7J A;  1HWT C;  3RK2 B;  3L70 E;  5KLV K;  3GF7 A;  3L70 G;  4N78 D;  3VTP C;  2KI7 B;  3NTN A;  1SFC A;  1S1C X;  1NTZ E;  3H25 A;  1NTZ G;  4ASV A;  2BCC E;  3E1I A;  2BCC G;  1M7L A;  1S9K D;  3A0B E;  3D6Z A;  5KAF E;  3B5N A;  1RF0 C;  1SQP E;  2P58 A;  3BCC E;  5APS A;  3BCC G;  5AVQ B;  1N7S B;  4IL6 H;  1P84 D;  1IFN A;  2Z5H A;  2Z4E A;  1HGV A;  3OEH H;  3OJA B;  1DH3 A;  1X0T A;  1BE3 G;  1NTK K;  4R4L A;  1JY3 P;  1NH4 A;  4DOJ A;  3CC2 P;  3H1H D;  1JY2 O;  4C7N A;  3RBZ A;  3RK2 C;  1VQM P;  2RMZ A;  4L73 A;  3AEE C;  2PP6 A;  2J58 A;  1WT6 A;  1NTM D;  3CXH E;  3H1L D;  4ZNC A;  2SPZ A;  5GTI E;  2KSE A;  1NTM J;  3H1L J;  5APV A;  2IDB A;  2FBW C;  1BCC E;  3RL0 g;  3M06 A;  2ZYD A;  3CPW O;  1NHL A;  5TIS E;  1EZV I;  1KC8 Q;  3SWF A;  1N7S C;  1KIL B;  3A0H H;  2O1K A;  1SQQ E;  1K9M Q;  3V4W A;  3L74 E;  1EXI A;  1SQQ G;  2V7Q J;  3L74 G;  1K04 A;  3CCU P;  2PFX A;  1FOS E;  5AW6 B;  1KB9 D;  1MZ9 A;  1JY3 O;  1EQ7 A;  4Y28 J;  5CCG C;  2OTL P;  3AED C;  1U7M A;  1JTH B;  2N9Y B;  2E5T A;  3WMM 0;  1FZC B;  2ZT9 D;  2N1T D;  2AXT H;  4M3L A;  3B71 A;  3MZW B;  3AEA C;  2K9J B;  1J1E B;  3BRT B;  2W6B A;  1KIL C;  3S4R A;  3CCS P;  1L4A B;  3MUD C;  4JBZ A;  1R5S A;  5TJH A;  2A45 H;  5AW1 B;  2E42 A;  3L73 G;  1QL2 A;  2UWJ E;  2WIT A;  2H7H A;  2OYI A;  2VRS A;  1LWU A;  4WY4 A;  5GTH E;  1ZW0 A;  2D2C D;  1ZLL A;  4OVN F;  1G1J A;  3I55 P;  2I1J A;  1YJW P;  4H0L B;  2WTY A;  2P2U A;  2Q3I A;  4HB1 A;  2MJZ A;  2WSE H;  4NPD A;  5APX A;  3L71 D;  1YTZ I;  4PD4 D;  2G3A A;  3TSI A;  2POH A;  1J1E C;  1GK6 A;  3L71 J;  2XV5 A;  1SQB G;  2KUB A;  1L4A C;  3D71 A;  2IYP A;  1RF0 A;  2K37 A;  4D6T E;  1OX3 A;  1D7M A;  4XFJ A;  1PPJ E;  3FXD A;  1PPJ G;  2PAJ A;  1ZME C;  2Y9Z A;  1A02 J;  2KSJ A;  1URQ B;  1SLQ A;  5H2F H;  2B87 A;  4IL6 E;  1RE3 C;  1FJK A;  2QG4 A;  4H0L C;  1Q7Y Q;  5AVW B;  2C9L Y;  2QEX P;  5DJU B;  4BWN A;  1NVO A;  1YYC A;  1LGH B;  1GU4 A;  3CME P;  3L36 A;  1JO5 A;  5KLV E;  4AYC A;  5KLV G;  1LTS C;  2Y0E A;  1VDF A;  1QX8 A;  1LJ2 A;  2FFD B;  1AV1 A;  2O01 H;  3SSU A;  1KYO D;  2M3B A;  1H8E H;  3JSV C;  1SQV K;  5B5E E;  5CCG D;  3CX5 D;  3L70 D;  2OYH B;  5CCH D;  1URQ C;  2IBZ G;  1N7S A;  3OE7 H;  1DD3 A;  4NPF X;  1NTZ D;  3A0H E;  3L70 J;  2OAR A;  1USD A;  2XOK H;  1LTJ B;  3L4F A;  1N7L A;  2E76 D;  3AE8 C;  1AQ5 A;  1NTZ J;  1Q86 Q;  3M0A A;  4C7R A;  3GLM A;  1PIX A;  4K35 A;  1NTK G;  2QJY B;  2B89 A;  1NKZ B;  3N4X A;  1SQP D;  3BCC D;  4JPZ B;  3TDK A;  1VQP P;  5CCG A;  1YJN P;  1SQP J;  2FYZ A;  5APU A;  4Y99 C;  2QE7 H;  3BCC J;  1QLE D;  2H8P D;  2FFD C;  3FGA D;  2KYV A;  1EC5 A;  2AXT E;  4DJG A;  2OYH C;  5C39 A;  2ZJS E;  1N73 C;  4AQR D;  1KIL A;  3RK3 E;  2KZI A;  3OA7 A;  3MUD A;  3GF3 A;  1KD1 Q;  1LTJ C;  1T2K C;  3V6I A;  2QJP C;  1JNM A;  3RL0 C;  3H1K E;  1DX7 A;  2A45 G;  3H1K G;  3FX0 A;  1BCC D;  1FAV A;  2QJY C;  5AVZ B;  4BXL A;  5APT A;  1CW5 A;  1BCC J;  4YXW H;  3PTZ A;  4HKZ H;  1XTC C;  2KS1 B;  3L74 D;  1SQX E;  4DZO A;  1SQX G;  1LT9 C;  1U7J A;  3L72 E;  2ZYA A;  2Q5U A;  1JY2 N;  3L74 J;  5APW A;  2LR2 A;  1GW3 A;  2W27 A;  3B4S A;  1BSH A;  2K9J A;  3LW5 H;  3D70 A;  3IN6 A;  3OW2 O;  1GL2 D;  2NPS C;  1L4A A;  4ZKU A;  4QMA A;  2R5D A;  4PV1 D;  3MIW A;  3AE9 C;  4XE5 B;  1PGO A;  4WB4 A;  3MTU E;  2WQY C;  4N3Y B;  5H2F E;  3SFD C;  2W90 A;  1OXZ A;  1S2E A;  1VQN P;  1R8E A;  1JEK A;  1MFZ A;  2Q1K A;  3H1I E;  3H1I G;  2K3R A;  5AW3 B;  4UB8 H;  1M57 D;  1TU3 F;  2OTJ P;  3IR9 A;  3F89 A;  2QJK B;  3EQ2 A;  3CWB E;  3CWB G;  2OYI B;  5AW2 B;  4WVZ A;  4DCK A;  1PV3 A;  2ZT9 B;  1NWQ A;  1SS1 A;  2R44 A;  1PL5 A;  2N1T B;  4YXD C;  3JCU H;  4LGD E;  3BRV B;  5APY A;  1NU1 K;  1L0L K;  1M1J B;  3O8Z A;  3QH9 A;  3CCJ P;  1HVV A;  2BEQ D;  3GHG C;  4ASW A;  1G2C B;  2FYU K;  3PLN A;  3VMX A;  2D2C B;  5CMZ A;  3KHU A;  4EIJ A;  1VQ7 P;  4D6T D;  4HYT B;  3VP8 A;  2QJK C;  2N9B A;  1T2K D;  3R2P A;  4D6T J;  5KTB A;  2B87 B;  2ZT9 C;  3HTK B;  3RL0 D;  1BSN A;  3PH0 A;  2R5B A;  3A3Y B;  4OGQ D;  2OGU A;  2N1T C;  3CCV P;  1IO4 A;  1IK9 A;  1HF9 A;  1BDD A;  3TF5 A;  3M91 A;  3L35 A;  2YO3 A;  2OYH A;  1M1J C;  2E75 D;  1SQV G;  1N73 A;  5FL7 H;  3U1A A;  4MN4 C;  1DD4 A;  1MV8 A;  2J59 M;  1LTJ A;  1PZQ A;  2WSC H;  2QVA A;  2D2C C;  3CXH I;  2FXO A;  2XKM A;  2ZVO B;  2NPS D;  2ITA A;  2IFN A;  1FBM A;  2HPC B;  1BE3 E;  1IFP A;  1MKM A;  1LT9 A;  3R4Y A;  3USS A;  4YPC A;  3H1H J;  1NGM B;  4RO0 A;  2YXQ B;  2Q7C A;  1CSB A;  4IFM A;  3AEG C;  1RY3 A;  2NPS A;  4EYY Q;  3TNU B;  1NTM K;  3VYI A;  1H8A A;  5AVY B;  2KNC B;  1FZB A;  3ABV C;  3B8E B;  2WSS H;  2KP8 A;  3FWN A;  4EI2 A;  2E76 B;  2E74 D;  1T3U A;  4L75 A;  3PHL A;  2L5G B;  3RK3 D;  2KS1 A;  1AFO A;  3MP7 B;  1YTZ T;  2B9B A;  1UII A;  3KDP B;  4UB8 E;  2ZXX A;  1M90 Q;  1P84 H;  1YQ3 C;  2ZXE B;  3WU2 E;  2DW3 A;  1PP9 G;  4EDF A;  1AJY A;  3HE4 B;  5CCH C;  2YKP A;  3JCU E;  3V2R A;  2Z5I A;  2WT7 B;  1SQX D;  3L72 D;  2E76 C;  4I7Z B;  1SQX J;  1ZOY C;  3GHG A;  3H1J E;  3L72 J;  3P8M C;  2FYN B;  2IYO A;  3H1J G;  3NMD A;  5CJ4 A;  3CMA P;  3PP5 A;  3L73 E;  2V7Q H;  1L0N E;  1VQK P;  2QSI A;  3G3Z A;  1L0N G;  1K8A Q;  3PRJ A;  2K9Y A;  4H13 D;  2AXC A;  2YIU B;  2JEE A;  2N1T A;  1W2B O;  4LC1 A;  1KB9 H;  2XND H;  2JKV A;  3M9Q A;  3P8C E;  2BEZ F;  1GL2 B;  1M1K Q;  4TLF A;  1M1J A;  1NU1 E;  4PV1 B;  4I7Z C;  1NU1 G;  1L0L G;  3CWB D;  5AW8 B;  3TYY A;  2FYN C;  1G2C A;  1SQB E;  1HBW A;  3CWB J;  2JP3 A;  2WVR A;  5APQ A;  1Z56 A;  1ZP0 C;  3WUV A;  4I1L A;  2FYU E;  2HOD B;  2FYU G;  4GT1 A;  4PJ0 H;  2E43 A;  1S72 P;  2YMY A;  3K5B A;  4R4M A;  5KLI B;  3HTK A;  3L75 E;  1E79 H;  2YIU C;  1H89 A;  3L75 G;  2RKL A;  1J1D B;  3CCE P;  3HD7 B;  2RQ7 A;  2IBZ I;  1JMM A;  4U3F D;  2QM8 A;  3OAA H;  3A7O A;  1GL2 C;  3GG2 A;  2A06 D;  1S3J A;  1JB0 J;  1JUN A;  4U3F J;  4PV1 C;  1RH5 B;  2WMM A;  4Y99 B;  2OYO A;  1VQ6 P;  4RKU J;  4BRY B;  4PD4 H;  4JF7 A;  1RF1 B;  4ZKP A;  1FDO A;  3P7K A;  4YTP C;  2IBZ E;  4TT3 H;  1N73 B;  3WUU A;  5KLI C;  2HPC A;  1UIX A;  2BCC D;  1J1D C;  2JWA A;  1VF5 C;  3QWO C;  1OMI A;  3H32 B;  3HD7 C;  3TK1 A;  1Q81 Q;  1IC2 A;  2QJP B;  2BCC J;  2P67 A;  3RL0 B;  1HJ0 A;  1NTK E;  4OGQ B;  1YHQ P;  1P84 E;  1A02 F;  3CL3 D;  1OW6 A;  2IFM A;  4W7Y A;  1AQT A;  3T97 B;  3A5T A;  1KTM A;  3CCM P;  2A45 I;  1SQP K;  5CCH A;  2K1A A;  3TNU A;  2E75 B;  4I2L C;  1BE3 D;  2E5Y A;  5AW7 B;  2KNC A;  1RE4 C;  3RGU A;  1VQ9 P;  1EDK A;  1LT9 B;  1N2D C;  3SWK A;  1X22 A;  1NTM E;  1KQF B;  1NTM G;  3S1K A;  1RF1 C;  1BE3 J;  3PJS K;  2XU6 A;  2C9N Y;  1Y8A A;  3HE5 B;  1S5L X;  5K5G B;  2WSF J;  3CXH D;  1IFJ A;  1HJB A;  1KYO H;  3TGU E;  2NPS B;  3TGU G;  2WPV B;  2KK7 A;  1H0T A;  3CX5 H;  1NJI Q; 
#chains in the Genus database with same CATH homology
 1JEK A;  2E5T A;  2W6J H;  5FL7 H;  1E79 H;  2WSS H;  3PJS K;  3OE7 H;  1AQT A;  1BSN A;  4DJG A;  2XND H;  1FS0 E;  3FKS H;  2V7Q H;  2RQ7 A;  2XOK H;  2CK3 H;  3OEH H;  2QE7 H;  3EFF K;  2RQ6 A;  1BSH A;  4YXW H;  3OFN H;  4TLF A;  1IFP A;  1H8E H;  4ASU H;  2HLD H;  3OAA H;  2E5Y A;  4WVZ A;  2JDI H;  3USS A;  5DN6 I;  4QMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...