1FS0E

Complex of gamma/epsilon atp synthase from e.coli
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
128
Chain Sequence
b'AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHDVDYAQASAELAKAIAQLRVIELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE EPSILON SUBUNIT
publication title Structure of the gamma-epsilon complex of ATP synthase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 32
structure length 128
sequence length 134
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
E PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1fs0E02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1fs0E01
3OEHH 4QMAA 1H8EH 2E5TA 2XOKH 3PJSK 3OFNH 2E5YA 2XNDH 3OAAH 1FS0E 1BSHA 2HLDH 2JDIH 2RQ7A 1IFPA 1JEKA 3EFFK 2CK3H 3FKSH 2WSSH 4DJGA 5FL7H 1AQTA 1E79H 2QE7H 4WVZA 2W6JH 5DN6I 2RQ6A 4YXWH 3OE7H 3USSA 4TLFA 2V7QH 4ASUH 1BSNA
chains in the Genus database with same CATH superfamily
3L74J 4U3FE 3L74G 4N78D 3CC4P 1RE3C 1T8ZA 1OIPA 3CI9A 2FXMA 2OYHB 3L71J 3L71G 3HE4A 1YI2P 1GL2B 1ZLLA 1HTLC 3OE7H 1L0NG 2WQYC 1EXIA 1S5LH 4YTPC 4KHXA 2YXRB 3QWOC 5DJTB 1S72P 2RQ7A 4UB6E 3OA7A 2HLOA 2PGDA 3M0AA 2K9JA 2FFDA 2KB7P 4IOIH 4L73A 3AE1C 1OVRA 1SFCD 1YJ9P 1JTHA 4PV1B 1PP9D 1AQTA 2KXPB 4H13C 2WT7B 5KLVD 2IX7C 4YXDC 2YMKA 2IBZG 1NHLA 1R5SA 2H8PD 5APTA 3Q5SA 1S5LE 2Q7CA 5GTHE 2N1TD 1LT9B 1KFMA 3HUSB 1VQOP 2Q6QA 3H1KD 1NVOA 5B5EE 3OFNH 2IYOA 1M1JB 2WSCH 2JWDA 1L0LD 3G4SP 3H1KJ 1KB9I 1QVGO 3F5HA 3H1HE 2E75D 3V5BA 3PH0A 1J1EB 5KJ7D 3GHGB 3CMAP 3NMDA 1UIIA 2OYIC 4WY4D 2K1AA 1S2EA 1L0LJ 4A7PA 3B71A 1YIJP 3H1JD 1NYHA 5AVQB 2YKOA 2IPPA 2QJPC 1Q81Q 5APSA 2I8DA 4R4MA 2IDBA 1IK7A 1NTZE 5GTIE 2P7JA 2BCCJ 2BCCG 1VDFA 4W7YA 4IL6H 5C39A 3CLQA 4OH8B 2A45G 1NTMD 1FS0E 5APQA 3BCCE 1L4AA 1GL2C 2WVRA 3B4SA 2RN0A 2YNYA 2KSEA 2XV5A 2AEMA 2OARA 1K05A 4U7JA 2QA4P 2VRSA 2GUSA 1BE3G 3CWBE 3P7KA 3TDKA 1NO4A 2YO3A 3OAAH 3GW6A 1JM0A 3H1ID 1OW7A 3CX5I 3AECC 3CCJP 3AE7C 1SQQK 3P8MC 2E43A 1LTGC 2KS1B 1LGHB 1LTJA 2POHA 2XOKH 2IZ0A 4PV1C 1HJBA 1KYOD 3OW2O 1SFCA 1SQBJ 1SQBG 1AVYA 2J59M 1S1CX 3FXEA 1ZRTD 3CCQP 2WZ7A 1JY3N 1PFIA 3V4WA 2C0XA 3B5NB 4UB8H 3HUSC 2CPSA 4TT3H 2ZFCA 1QL1A 4U3FJ 1SQQE 1N7SD 3M0DA 4U3FG 5APWA 2OTJP 3HD7B 1IZNB 1EZVI 3M06A 2N1TA 5E79H 1RF0C 1ZOYC 1M1JC 1YHQP 1NTKD 3RL0g 5AW0B 4JBZA 1XTCC 3TNUA 4N6JA 4OVNF 1J1EC 3GHGC 1FU1A 3RL0D 1N73A 4Y99B 3JCUH 1NTKJ 1JMMA 2NZ2A 3L35A 2ZVNB 1BDDA 2PRRA 3PTZA 1ZXGA 2WSEJ 5KJ7A 3U1CA 4WY4A 2Q3EA 1AQ5A 3H1LD 2OGUA 3N7NA 1LTSC 2P2UA 4UB8E 2OTLP 1DEEG 4EDFA 2HPCA 3V2RA 3VMYA 1NU1K 4IL6X 5E79E 1KILB 4I7ZB 1CZQA 1H89A 3T97B 3CCEP 3P32A 1FDOA 1ZR2A 3W67A 2HODA 1BCCD 2M3BA 1YYCA 5APYA 2Y9ZA 4N78E 4DT0A 2QG4A 3BRVB 1T6AA 1Z56A 3D6YA 3TGUD 2R3CA 3I55P 1DH3A 2FKWB 1AV1A 2IYPA 4PD4I 1SQVK 3MUDC 4D6TD 3IFMA 2V7QJ 3AE6C 3WUUA 3FWNA 3D6ZA 2Q5UA 5KLVK 2W6JH 4W80A 3O6QA 3CC2P 5AW7B 1KN7A 3H1HG 3IF4A 3RK2B 2KUBA 1S4XA 2AXTE 1N86A 3VN0A 2NPSB 3ABVC 4NPEA 1JY2O 3SSUA 2OYOA 2DW3A 4K35A 3B5NC 3BASA 1CW5A 2Z5IA 1NTZG 3HD7C 1OX3A 1PP9E 2YKQA 5KLVE 1M90Q 3PP5A 5TISH 2FYUD 1N7SA 5AW6B 2AEFA 3BCCJ 3BCCG 2A45H 4H13D 2KNCB 2W90A 3ZDMA 3C8VA 1EDJA 1H88A 4EOTA 3LW5J 1JMBA 1BSNA 3OAKA 1FJPA 3CPWO 2A06D 4EIJA 4K3AA 4Y99C 4RJTA 3CWBG 5B66H 3H1KE 2RMZA 4JF7A 1A02J 1RH5B 2ZYDA 2Y0CA 2CPBA 1MKMA 3CXHE 1L0LE 3WU2H 1NTMK 3AE3C 1SQXK 1PL5A 1LP1B 1M57D 3CCRP 1KILC 4I7ZC 1FZBA 3H1JE 1A02F 1EDIA 2AEJA 1USEA 1CI6A 5BU5A 5AVYB 2ZT9B 1JY2N 5H2FH 3GF7A 2O01N 2FYNB 2G8YA 1SQQJ 1SQQG 5B66E 1NTME 1J1DB 4H44B 1CSBA 1JO5A 1OW6A 1RF1B 2O1KA 1GU5A 1U7MA 3WU2E 1GL2D 3MHVA 3GG2A 1GK6A 3RK2C 3GMAA 1W2BO 1HVVA 4OWFA 3H1IE 1IFNA 1NOHA 2D2CB 3H25A 4UB6H 3CCSP 1IFPA 4XFJA 2C9NY 2WSEH 2WSSH 3EFGA 3E1RA 1KYOE 1H0TB 1OVUA 3AEAC 4PV1D 4AYCA 4BRYA 3MZWB 1ZRTE 4C7RA 1N8RQ 3FKSH 3IAOA 1N2DC 3IN6A 1URQC 2ZJSE 4WBAA 4EI2A 2V4HA 1NU1D 2WMMA 5GTHH 1EXJA 4I1LA 5M1BA 1JCDA 1ZV8A 2B88A 1SQPD 3R2PA 1IO4A 1NTKE 1VQMP 1P84E 1AA0A 4DOJA 3AE8C 3A7OA 1M1KQ 1NU1J 5B5EH 2V7QH 2K3RA 5EFWB 2KSJA 5L8RJ 1VQ5P 1FZCB 3M9BA 2GA1A 1SQVD 3VP9A 3MD0A 2L5GB 3AEGC 3M9HA 1BGYD 2ZT9C 2M5AB 3AEDC 3H1LE 1M8OB 2FYNC 2OYIA 1SQVJ 4O9BA 1E5WA 1LWUB 1J1DC 5AVTB 2JO1A 4H44C 1PP9J 1RQUA 1PP9G 1GZLA 1NAYA 1PV3A 2PFXA 5GTIH 5KLVJ 2P1JA 5KLVG 3A0HE 1RF1C 3GLMA 1SLQA 4KT0J 1AFOA 2Y9YA 2JEEA 1DD3A 1K04A 2OTKE 4N3YB 3H32B 2IZ1A 1BCCE 3TK1A 3WMM0 2OYHA 1JOCA 1G1JA 3LW5H 2W6AA 1GL2A 3CXHD 2PP6A 3TGUE 3W68A 3H1KG 2D2CC 3TF5A 2R32A 1FC2C 3WUVA 3CX5D 4D6TE 5CJ0A 3RK3C 3C1LA 3PHLA 2ZXXA 2M8RA 2E5YA 3O8ZA 1L0LG 2QEXP 3HE5B 2FYUK 2KLUA 2JJLA 2XDJA 1LJ2A 2BEQD 1PGOA 4RESB 4NPFX 2IBZI 1PZQA 1X79B 5KAFH 2H89C 5CBNA 3H1JJ 1HJ0A 1NKZB 3H1JG 1RQVA 3L70E 3Q2YA 2HG5D 1SQXD 3VTPC 4L76A 2WT7A 2O01J 2IFMA 1W5CE 2PAJA 3B5ND 4YXWH 1EZVD 1NGMB 2O1JA 1OXZA 1NTMJ 1NTMG 4BWNA 3HD7D 2FYUE 3G9RA 1SQXJ 3NFQA 3M9QA 1X0TA 1S5LX 1LT9A 2P58A 1XTGB 3HUSA 2YKPA 4JYCA 1S9KD 2RKLA 4GKGA 2A06E 5CCHD 5CCGC 2B89A 2QVAA 1FZCC 1RF0A 1M1JA 2JR8A 1ZP0C 1WT6A 3A3YB 1QX8A 3H1IJ 3H1IG 3Q5PA 4RO0A 5KAFE 1RY3A 2CK3H 3GHGA 3HTKB 3L72D 1MV8A 3KXDA 3CCUP 1LWUC 1OZHA 1VQ6P 5AVUB 3VOPA 2A45I 4XE5B 1GW3A 1LT1A 1L4AC 2I1KA 3C9IA 1Y47A 3L73D 3Q1MA 1VL2A 4LC1A 1KILD 1UIXA 1M7LA 3CCMP 3KQGA 1KQLA 1VQNP 3M91A 4EYYQ 2WSFJ 1P84D 3B8EB 3PLNA 2QJYB 2RH0A 1G2CB 5AW9B 4DZOA 4PD4D 4WWIA 5CHXA 4KJMA 4C46A 2FXPA 1NTKG 1LTJC 1GW4A 4C7NB 1D7MA 2I1JA 3UIAA 3TYYA 5AVZB 2LKMA 2HYNA 3KPEA 4ZMDA 1SP4A 3RK2D 2KS1A 1HGVA 4ZKUA 2NPSD 2AXTH 1RHZB 3FXDA 3H1LJ 3EWKA 3H1LG 1SQPK 4PJ0E 4IFFA 4HH2A 4BXLA 2BASA 3CCVP 3RGUA 3OJAB 1NWQA 4R4LA 3V2PA 2IFNA 3B5NA 2WWWA 3KHUA 3HD7A 1SS1A 1JY3P 4RKUJ 1BCCJ 1BCCG 4XA4A 1N73C 1PPJD 1NU1E 1URQD 5CCHA 3TGUJ 3KYQA 3TGUG 2B87B 4GOFA 3AE4C 1SQPE 2P67A 4M3LA 3N4XA 1KQSO 4D6TJ 4D6TG 5AW2B 1FZGA 1FJKA 1U57A 1KB9E 1JUNA 1HBWA 2R44A 5APVA 1ZMEC 3BATA 3CXHH 3L70D 3PRJA 1MFZA 2WPVB 1NH4A 2XZRA 4ASUH 1SQVE 1KV4A 3L75D 4GIFA 2KP8A 1BGYE 5AVXB 1PGJA 1AJYA 3L70J 5APUA 1KQGB 1LNQA 1KILA 2ZXEB 1SVFA 2NRGA 2ZT9D 3U59A 3AEBC 3T97A 1H8AA 2QJYC 3SWFA 1KZUB 2K88A 3A5TA 2O01H 2ZVOB 4W7ZA 1URQB 1MZ9A 2FYUJ 4ASVA 2FYUG 4H44D 2HLDH 2E74B 3S9OA 4OGQB 4H0LB 1EQ7A 1VF5B 1K9MQ 2A06G 4Y28J 2XU6A 3CL3D 4L75A 1Q2NA 2H43A 3NXSA 2E76B 2LXBA 3CX5E 5AW4B 2E42A 2GM4A 1U7JA 2D2CD 2R5DA 1GDTA 4JQ0D 3RK3D 1FDMA 2FY8A 2ZYGA 3NTNA 1ZW0A 2NPSA 4WB4A 4IFMA 2XNDH 4AQRD 2FBWC 5K5GB 1KYOH 1JCCA 5DN6I 1SQXE 4Z1MH 3HE4B 3MP7B 2Y0DA 2KK7A 1EZVE 2W6BA 2KNCA 1HUCA 2LXCB 1RE3A 1USDA 4B86A 3V2NA 2WSFH 1BE3E 2KOGA 1S9KE 2K9JB 2QM7A 2FFDB 3CC7P 1P84H 3RK3B 3MIWA 1HWTC 2KZIA 1VPCA 5CCGD 3LIEA 1IC2A 5FL7H 1JTHB 4PD4H 1PGPA 2WTYA 3E7KA 3JSVC 1VQPP 1LP1A 1H8EH 3L72E 3KZIE 3A2AA 4GODA 2QM8A 4IFDK 2Y0EA 1DX7A 1LTBC 3V6IA 2K9YA 2SPZA 3L73E 5AVWB 2E74C 2W8ZA 1KILE 1L0ND 3E1IA 1ZR4A 1L4AD 3K5BA 4OGQC 4ZKPA 1VQ4P 1EC5A 4H0LC 1VF5C 2Q1KA 3A0HH 5AVVB 1WMKA 1X22A 5KTBA 2N9BA 1HGZA 1RF1A 1KQFB 1NAFA 1JY2P 1L0NJ 1NU1G 2E76C 1KB9D 4QMAA 4PD4E 1IFMA 1SQPJ 1SQPG 2H7HA 1GD2E 1JEKA 2R3SA 1QEXA 3SFEC 3RBZA 1RE4C 3USSA 2UWJE 3F89A 1IFDA 2WPRA 3VMAA 3AE9C 1DD4A 1SQVG 2IBZD 3WUTA 1YITP 1YJWP 1H0TA 1BGYJ 1M56D 4HKZH 1BGYG 1L4AB 1PIXA 3LIDA 2M3EA 1VQ8P 2R5BA 3AE2C 5AVRB 2J58A 3D71A 1OFCX 2BEZF 3HRNA 3VMZA 2Z5HA 1OVVA 4DJGA 1LTTC 1FZEA 2FFDC 1Q90D 1MFTA 3OEHH 1PPJE 1NTZK 1QGKB 3D70A 1Q7YQ 1LTJB 4CPGA 3KDPB 2P10A 5CJ4A 4DCKA 1SFCB 2QE7H 5CCGA 3L4FA 1J2JB 3P8CD 1FZCA 1BDCA 1MUUA 4TLFA 1JY3O 1KD1Q 2BCCD 3SWKA 3VYIA 5DJUB 1R8EA 2YIUB 1OWAA 1YQ4C 1QLED 2M5AA 3L75E 1YQ3C 1KC8Q 3I56P 1LWUA 2N1TB 3BVHA 2K37A 1X9VA 1T2KC 1SQXG 2OYHC 1OMIA 1ZN5A 1BE3D 2JP3A 1K73Q 1Q82Q 1KORA 3SFDC 3G3ZA 1K8AQ 3IR9A 1EZVG 3TNUB 3H32A 2YXQB 1N73B 1BE3J 1Y9BA 3CXHI 2N9YB 2E75B 1EDLA 1LTIC 5TJHA 1FZFA 4WY4B 1FOSE 1FBMA 1JB0J 1SQBD 2Q3IA 4YPCA 2HPCB 3II6A 3HE5A 2E5TA 2GUVA 1IFIA 4IL6E 5KLIB 5BVZA 3L72J 2KI7B 3L72G 3RK3E 1Q86Q 2AXCA 4U3FD 3R4YA 2LR2A 5AW1B 2HR3A 1YTZI 5AW3B 3H6PA 2HODB 3G71P 4I6MC 3BRTB 2JKVA 5APXA 1LT9C 1X8YA 4PJ0H 2B9BA 1T3JA 3L73J 3L73G 5AVSB 1GTWA 2MKVA 1HH0A 4HB1A 1GK4A 2WPQA 2Q9IA 1FZAA 2MJZA 1KFNA 1EDKA 2YMYA 1IK9A 1HF9A 1SFCC 3O6QB 3MUDA 5BU8B 1YBKA 4GOEA 4MN4C 4JPZB 2KYVA 1YJNP 1KYOI 1VQLP 1L0NK 2YIUC 1LTAC 3TSIA 1KB9H 2M0BA 3HTKA 3M0DC 3FGAD 4LLHA 4JYBA 2N1TC 3U1AA 1OW8A 1G1IA 1N7SB 3L74E 2FXOA 2C0WA 1NJIQ 1VQKP 2OQQA 4ASWA 1T3UA 3L71E 1PGQA 2WITA 1L0NE 2E75C 1P84I 5KJ7C 3JCUE 3RL0B 2E74D 1G2CA 3FWLA 3MGNA 4WY4C 4OGQD 3H1HD 1YTZT 1PPJG 4H0LD 1VF5D 4NPDA 2O3JA 4C7NA 1Y8AA 2RQ6A 5KLIC 3L37A 3SWYA 2E76D 3H1HJ 1R5LA 1JNMA 3CX5H 1NTZD 1QVFO 3GF3A 1CI6B 3VP8A 5CMZA 2ZYAA 1TU3F 3L70G 5KAIH 2IBZE 2XNXA 3BCCD 3L75J 3L75G 2W83C 5KKZB 1NTZJ 2QRXA 2QJKB 1W2EA 3PJSK 2KZJA 4GT1A 1WRGA 1L0LK 4LGDE 2FYZA 1FE6A 3S1KA 1GU4A 2G3AA 3CWBD 5CCHC 3Q3DA 1E79H 3V2QA 4AUWA 2WSCJ 2H88C 2KIKA 2J5UA 3CMEP 1L2PA 3CWBJ 4HYTB 1N7LA 1IJDB 2B87A 2JWAA 2C9LY 2QIWA 3AE5C 5KAIE 4L74A 4GDOA 1QL2A 3MTUE 4I2LC 4ZNCA 3P8CE 2JDIH 4HJGH 1FAVA 1N7SC 4BRYB 2BCCE 3CD6P 3FX0A 5TISE 2HFED 3L36A 2W27A 2WPSA 2YO2A 1SQQD 3EQ2A 3KZIH 3QH9A 1AVOA 3S4RA 3Q5RA 2QSIA 4H13B 1FOSF 2ZAEB 5AW5B 1VQ7P 1SQBK 2Z4EA 3RL0C 3A0BH 1GMJA 4WVZA 1KMIZ 1S3JA 1URQA 1DEBA 1NKNA 1IFJA 1T2KD 1BSHA 3EFFK 3V4QA 3JC22 3ITKA 3I5CA 1VQ9P 1KTMA 3AEFC 2NPSC 1FDIA 3VMXA 1DIPA 5AW8B 1SQBE 3G6EP 5CBOA 2ITAA 2L91A 3L74D 2OYIB 5KKZC 3RBXA 2QJKC 5H2FE 2QJPB 1NTKK 3A0BE 1RE4A 3CCLP 3AEEC 2KLVA 3L71D 2XKMA
chains in the Genus database with same CATH topology
3OEHH 4QMAA 1H8EH 2E5TA 2XOKH 3PJSK 3OFNH 2E5YA 2XNDH 3OAAH 1FS0E 1BSHA 2HLDH 2JDIH 2RQ7A 1IFPA 1JEKA 3EFFK 2CK3H 3FKSH 2WSSH 4DJGA 5FL7H 1AQTA 1E79H 2QE7H 4WVZA 2W6JH 5DN6I 2RQ6A 4YXWH 3OE7H 3USSA 4TLFA 2V7QH 4ASUH 1BSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEH H;  4QMA A;  1H8E H;  2E5T A;  2XOK H;  3PJS K;  3OFN H;  2E5Y A;  2XND H;  3OAA H;  1FS0 E;  1BSH A;  2HLD H;  2JDI H;  2RQ7 A;  1IFP A;  1JEK A;  3EFF K;  2CK3 H;  3FKS H;  2WSS H;  4DJG A;  5FL7 H;  1AQT A;  1E79 H;  2QE7 H;  4WVZ A;  2W6J H;  5DN6 I;  2RQ6 A;  4YXW H;  3OE7 H;  3USS A;  4TLF A;  2V7Q H;  4ASU H;  1BSN A; 
#chains in the Genus database with same CATH topology
 3L74 J;  4U3F E;  3L74 G;  4N78 D;  3CC4 P;  1RE3 C;  1T8Z A;  1OIP A;  3CI9 A;  2FXM A;  2OYH B;  3L71 J;  3L71 G;  3HE4 A;  1YI2 P;  1GL2 B;  1ZLL A;  1HTL C;  3OE7 H;  1L0N G;  2WQY C;  1EXI A;  1S5L H;  4YTP C;  4KHX A;  2YXR B;  3QWO C;  5DJT B;  1S72 P;  2RQ7 A;  4UB6 E;  3OA7 A;  2HLO A;  2PGD A;  3M0A A;  2K9J A;  2FFD A;  2KB7 P;  4IOI H;  4L73 A;  3AE1 C;  1OVR A;  1SFC D;  1YJ9 P;  1JTH A;  4PV1 B;  1PP9 D;  1AQT A;  2KXP B;  4H13 C;  2WT7 B;  5KLV D;  2IX7 C;  4YXD C;  2YMK A;  2IBZ G;  1NHL A;  1R5S A;  2H8P D;  5APT A;  3Q5S A;  1S5L E;  2Q7C A;  5GTH E;  2N1T D;  1LT9 B;  1KFM A;  3HUS B;  1VQO P;  2Q6Q A;  3H1K D;  1NVO A;  5B5E E;  3OFN H;  2IYO A;  1M1J B;  2WSC H;  2JWD A;  1L0L D;  3G4S P;  3H1K J;  1KB9 I;  1QVG O;  3F5H A;  3H1H E;  2E75 D;  3V5B A;  3PH0 A;  1J1E B;  5KJ7 D;  3GHG B;  3CMA P;  3NMD A;  1UII A;  2OYI C;  4WY4 D;  2K1A A;  1S2E A;  1L0L J;  4A7P A;  3B71 A;  1YIJ P;  3H1J D;  1NYH A;  5AVQ B;  2YKO A;  2IPP A;  2QJP C;  1Q81 Q;  5APS A;  2I8D A;  4R4M A;  2IDB A;  1IK7 A;  1NTZ E;  5GTI E;  2P7J A;  2BCC J;  2BCC G;  1VDF A;  4W7Y A;  4IL6 H;  5C39 A;  3CLQ A;  4OH8 B;  2A45 G;  1NTM D;  1FS0 E;  5APQ A;  3BCC E;  1L4A A;  1GL2 C;  2WVR A;  3B4S A;  2RN0 A;  2YNY A;  2KSE A;  2XV5 A;  2AEM A;  2OAR A;  1K05 A;  4U7J A;  2QA4 P;  2VRS A;  2GUS A;  1BE3 G;  3CWB E;  3P7K A;  3TDK A;  1NO4 A;  2YO3 A;  3OAA H;  3GW6 A;  1JM0 A;  3H1I D;  1OW7 A;  3CX5 I;  3AEC C;  3CCJ P;  3AE7 C;  1SQQ K;  3P8M C;  2E43 A;  1LTG C;  2KS1 B;  1LGH B;  1LTJ A;  2POH A;  2XOK H;  2IZ0 A;  4PV1 C;  1HJB A;  1KYO D;  3OW2 O;  1SFC A;  1SQB J;  1SQB G;  1AVY A;  2J59 M;  1S1C X;  3FXE A;  1ZRT D;  3CCQ P;  2WZ7 A;  1JY3 N;  1PFI A;  3V4W A;  2C0X A;  3B5N B;  4UB8 H;  3HUS C;  2CPS A;  4TT3 H;  2ZFC A;  1QL1 A;  4U3F J;  1SQQ E;  1N7S D;  3M0D A;  4U3F G;  5APW A;  2OTJ P;  3HD7 B;  1IZN B;  1EZV I;  3M06 A;  2N1T A;  5E79 H;  1RF0 C;  1ZOY C;  1M1J C;  1YHQ P;  1NTK D;  3RL0 g;  5AW0 B;  4JBZ A;  1XTC C;  3TNU A;  4N6J A;  4OVN F;  1J1E C;  3GHG C;  1FU1 A;  3RL0 D;  1N73 A;  4Y99 B;  3JCU H;  1NTK J;  1JMM A;  2NZ2 A;  3L35 A;  2ZVN B;  1BDD A;  2PRR A;  3PTZ A;  1ZXG A;  2WSE J;  5KJ7 A;  3U1C A;  4WY4 A;  2Q3E A;  1AQ5 A;  3H1L D;  2OGU A;  3N7N A;  1LTS C;  2P2U A;  4UB8 E;  2OTL P;  1DEE G;  4EDF A;  2HPC A;  3V2R A;  3VMY A;  1NU1 K;  4IL6 X;  5E79 E;  1KIL B;  4I7Z B;  1CZQ A;  1H89 A;  3T97 B;  3CCE P;  3P32 A;  1FDO A;  1ZR2 A;  3W67 A;  2HOD A;  1BCC D;  2M3B A;  1YYC A;  5APY A;  2Y9Z A;  4N78 E;  4DT0 A;  2QG4 A;  3BRV B;  1T6A A;  1Z56 A;  3D6Y A;  3TGU D;  2R3C A;  3I55 P;  1DH3 A;  2FKW B;  1AV1 A;  2IYP A;  4PD4 I;  1SQV K;  3MUD C;  4D6T D;  3IFM A;  2V7Q J;  3AE6 C;  3WUU A;  3FWN A;  3D6Z A;  2Q5U A;  5KLV K;  2W6J H;  4W80 A;  3O6Q A;  3CC2 P;  5AW7 B;  1KN7 A;  3H1H G;  3IF4 A;  3RK2 B;  2KUB A;  1S4X A;  2AXT E;  1N86 A;  3VN0 A;  2NPS B;  3ABV C;  4NPE A;  1JY2 O;  3SSU A;  2OYO A;  2DW3 A;  4K35 A;  3B5N C;  3BAS A;  1CW5 A;  2Z5I A;  1NTZ G;  3HD7 C;  1OX3 A;  1PP9 E;  2YKQ A;  5KLV E;  1M90 Q;  3PP5 A;  5TIS H;  2FYU D;  1N7S A;  5AW6 B;  2AEF A;  3BCC J;  3BCC G;  2A45 H;  4H13 D;  2KNC B;  2W90 A;  3ZDM A;  3C8V A;  1EDJ A;  1H88 A;  4EOT A;  3LW5 J;  1JMB A;  1BSN A;  3OAK A;  1FJP A;  3CPW O;  2A06 D;  4EIJ A;  4K3A A;  4Y99 C;  4RJT A;  3CWB G;  5B66 H;  3H1K E;  2RMZ A;  4JF7 A;  1A02 J;  1RH5 B;  2ZYD A;  2Y0C A;  2CPB A;  1MKM A;  3CXH E;  1L0L E;  3WU2 H;  1NTM K;  3AE3 C;  1SQX K;  1PL5 A;  1LP1 B;  1M57 D;  3CCR P;  1KIL C;  4I7Z C;  1FZB A;  3H1J E;  1A02 F;  1EDI A;  2AEJ A;  1USE A;  1CI6 A;  5BU5 A;  5AVY B;  2ZT9 B;  1JY2 N;  5H2F H;  3GF7 A;  2O01 N;  2FYN B;  2G8Y A;  1SQQ J;  1SQQ G;  5B66 E;  1NTM E;  1J1D B;  4H44 B;  1CSB A;  1JO5 A;  1OW6 A;  1RF1 B;  2O1K A;  1GU5 A;  1U7M A;  3WU2 E;  1GL2 D;  3MHV A;  3GG2 A;  1GK6 A;  3RK2 C;  3GMA A;  1W2B O;  1HVV A;  4OWF A;  3H1I E;  1IFN A;  1NOH A;  2D2C B;  3H25 A;  4UB6 H;  3CCS P;  1IFP A;  4XFJ A;  2C9N Y;  2WSE H;  2WSS H;  3EFG A;  3E1R A;  1KYO E;  1H0T B;  1OVU A;  3AEA C;  4PV1 D;  4AYC A;  4BRY A;  3MZW B;  1ZRT E;  4C7R A;  1N8R Q;  3FKS H;  3IAO A;  1N2D C;  3IN6 A;  1URQ C;  2ZJS E;  4WBA A;  4EI2 A;  2V4H A;  1NU1 D;  2WMM A;  5GTH H;  1EXJ A;  4I1L A;  5M1B A;  1JCD A;  1ZV8 A;  2B88 A;  1SQP D;  3R2P A;  1IO4 A;  1NTK E;  1VQM P;  1P84 E;  1AA0 A;  4DOJ A;  3AE8 C;  3A7O A;  1M1K Q;  1NU1 J;  5B5E H;  2V7Q H;  2K3R A;  5EFW B;  2KSJ A;  5L8R J;  1VQ5 P;  1FZC B;  3M9B A;  2GA1 A;  1SQV D;  3VP9 A;  3MD0 A;  2L5G B;  3AEG C;  3M9H A;  1BGY D;  2ZT9 C;  2M5A B;  3AED C;  3H1L E;  1M8O B;  2FYN C;  2OYI A;  1SQV J;  4O9B A;  1E5W A;  1LWU B;  1J1D C;  5AVT B;  2JO1 A;  4H44 C;  1PP9 J;  1RQU A;  1PP9 G;  1GZL A;  1NAY A;  1PV3 A;  2PFX A;  5GTI H;  5KLV J;  2P1J A;  5KLV G;  3A0H E;  1RF1 C;  3GLM A;  1SLQ A;  4KT0 J;  1AFO A;  2Y9Y A;  2JEE A;  1DD3 A;  1K04 A;  2OTK E;  4N3Y B;  3H32 B;  2IZ1 A;  1BCC E;  3TK1 A;  3WMM 0;  2OYH A;  1JOC A;  1G1J A;  3LW5 H;  2W6A A;  1GL2 A;  3CXH D;  2PP6 A;  3TGU E;  3W68 A;  3H1K G;  2D2C C;  3TF5 A;  2R32 A;  1FC2 C;  3WUV A;  3CX5 D;  4D6T E;  5CJ0 A;  3RK3 C;  3C1L A;  3PHL A;  2ZXX A;  2M8R A;  2E5Y A;  3O8Z A;  1L0L G;  2QEX P;  3HE5 B;  2FYU K;  2KLU A;  2JJL A;  2XDJ A;  1LJ2 A;  2BEQ D;  1PGO A;  4RES B;  4NPF X;  2IBZ I;  1PZQ A;  1X79 B;  5KAF H;  2H89 C;  5CBN A;  3H1J J;  1HJ0 A;  1NKZ B;  3H1J G;  1RQV A;  3L70 E;  3Q2Y A;  2HG5 D;  1SQX D;  3VTP C;  4L76 A;  2WT7 A;  2O01 J;  2IFM A;  1W5C E;  2PAJ A;  3B5N D;  4YXW H;  1EZV D;  1NGM B;  2O1J A;  1OXZ A;  1NTM J;  1NTM G;  4BWN A;  3HD7 D;  2FYU E;  3G9R A;  1SQX J;  3NFQ A;  3M9Q A;  1X0T A;  1S5L X;  1LT9 A;  2P58 A;  1XTG B;  3HUS A;  2YKP A;  4JYC A;  1S9K D;  2RKL A;  4GKG A;  2A06 E;  5CCH D;  5CCG C;  2B89 A;  2QVA A;  1FZC C;  1RF0 A;  1M1J A;  2JR8 A;  1ZP0 C;  1WT6 A;  3A3Y B;  1QX8 A;  3H1I J;  3H1I G;  3Q5P A;  4RO0 A;  5KAF E;  1RY3 A;  2CK3 H;  3GHG A;  3HTK B;  3L72 D;  1MV8 A;  3KXD A;  3CCU P;  1LWU C;  1OZH A;  1VQ6 P;  5AVU B;  3VOP A;  2A45 I;  4XE5 B;  1GW3 A;  1LT1 A;  1L4A C;  2I1K A;  3C9I A;  1Y47 A;  3L73 D;  3Q1M A;  1VL2 A;  4LC1 A;  1KIL D;  1UIX A;  1M7L A;  3CCM P;  3KQG A;  1KQL A;  1VQN P;  3M91 A;  4EYY Q;  2WSF J;  1P84 D;  3B8E B;  3PLN A;  2QJY B;  2RH0 A;  1G2C B;  5AW9 B;  4DZO A;  4PD4 D;  4WWI A;  5CHX A;  4KJM A;  4C46 A;  2FXP A;  1NTK G;  1LTJ C;  1GW4 A;  4C7N B;  1D7M A;  2I1J A;  3UIA A;  3TYY A;  5AVZ B;  2LKM A;  2HYN A;  3KPE A;  4ZMD A;  1SP4 A;  3RK2 D;  2KS1 A;  1HGV A;  4ZKU A;  2NPS D;  2AXT H;  1RHZ B;  3FXD A;  3H1L J;  3EWK A;  3H1L G;  1SQP K;  4PJ0 E;  4IFF A;  4HH2 A;  4BXL A;  2BAS A;  3CCV P;  3RGU A;  3OJA B;  1NWQ A;  4R4L A;  3V2P A;  2IFN A;  3B5N A;  2WWW A;  3KHU A;  3HD7 A;  1SS1 A;  1JY3 P;  4RKU J;  1BCC J;  1BCC G;  4XA4 A;  1N73 C;  1PPJ D;  1NU1 E;  1URQ D;  5CCH A;  3TGU J;  3KYQ A;  3TGU G;  2B87 B;  4GOF A;  3AE4 C;  1SQP E;  2P67 A;  4M3L A;  3N4X A;  1KQS O;  4D6T J;  4D6T G;  5AW2 B;  1FZG A;  1FJK A;  1U57 A;  1KB9 E;  1JUN A;  1HBW A;  2R44 A;  5APV A;  1ZME C;  3BAT A;  3CXH H;  3L70 D;  3PRJ A;  1MFZ A;  2WPV B;  1NH4 A;  2XZR A;  4ASU H;  1SQV E;  1KV4 A;  3L75 D;  4GIF A;  2KP8 A;  1BGY E;  5AVX B;  1PGJ A;  1AJY A;  3L70 J;  5APU A;  1KQG B;  1LNQ A;  1KIL A;  2ZXE B;  1SVF A;  2NRG A;  2ZT9 D;  3U59 A;  3AEB C;  3T97 A;  1H8A A;  2QJY C;  3SWF A;  1KZU B;  2K88 A;  3A5T A;  2O01 H;  2ZVO B;  4W7Z A;  1URQ B;  1MZ9 A;  2FYU J;  4ASV A;  2FYU G;  4H44 D;  2HLD H;  2E74 B;  3S9O A;  4OGQ B;  4H0L B;  1EQ7 A;  1VF5 B;  1K9M Q;  2A06 G;  4Y28 J;  2XU6 A;  3CL3 D;  4L75 A;  1Q2N A;  2H43 A;  3NXS A;  2E76 B;  2LXB A;  3CX5 E;  5AW4 B;  2E42 A;  2GM4 A;  1U7J A;  2D2C D;  2R5D A;  1GDT A;  4JQ0 D;  3RK3 D;  1FDM A;  2FY8 A;  2ZYG A;  3NTN A;  1ZW0 A;  2NPS A;  4WB4 A;  4IFM A;  2XND H;  4AQR D;  2FBW C;  5K5G B;  1KYO H;  1JCC A;  5DN6 I;  1SQX E;  4Z1M H;  3HE4 B;  3MP7 B;  2Y0D A;  2KK7 A;  1EZV E;  2W6B A;  2KNC A;  1HUC A;  2LXC B;  1RE3 A;  1USD A;  4B86 A;  3V2N A;  2WSF H;  1BE3 E;  2KOG A;  1S9K E;  2K9J B;  2QM7 A;  2FFD B;  3CC7 P;  1P84 H;  3RK3 B;  3MIW A;  1HWT C;  2KZI A;  1VPC A;  5CCG D;  3LIE A;  1IC2 A;  5FL7 H;  1JTH B;  4PD4 H;  1PGP A;  2WTY A;  3E7K A;  3JSV C;  1VQP P;  1LP1 A;  1H8E H;  3L72 E;  3KZI E;  3A2A A;  4GOD A;  2QM8 A;  4IFD K;  2Y0E A;  1DX7 A;  1LTB C;  3V6I A;  2K9Y A;  2SPZ A;  3L73 E;  5AVW B;  2E74 C;  2W8Z A;  1KIL E;  1L0N D;  3E1I A;  1ZR4 A;  1L4A D;  3K5B A;  4OGQ C;  4ZKP A;  1VQ4 P;  1EC5 A;  4H0L C;  1VF5 C;  2Q1K A;  3A0H H;  5AVV B;  1WMK A;  1X22 A;  5KTB A;  2N9B A;  1HGZ A;  1RF1 A;  1KQF B;  1NAF A;  1JY2 P;  1L0N J;  1NU1 G;  2E76 C;  1KB9 D;  4QMA A;  4PD4 E;  1IFM A;  1SQP J;  1SQP G;  2H7H A;  1GD2 E;  1JEK A;  2R3S A;  1QEX A;  3SFE C;  3RBZ A;  1RE4 C;  3USS A;  2UWJ E;  3F89 A;  1IFD A;  2WPR A;  3VMA A;  3AE9 C;  1DD4 A;  1SQV G;  2IBZ D;  3WUT A;  1YIT P;  1YJW P;  1H0T A;  1BGY J;  1M56 D;  4HKZ H;  1BGY G;  1L4A B;  1PIX A;  3LID A;  2M3E A;  1VQ8 P;  2R5B A;  3AE2 C;  5AVR B;  2J58 A;  3D71 A;  1OFC X;  2BEZ F;  3HRN A;  3VMZ A;  2Z5H A;  1OVV A;  4DJG A;  1LTT C;  1FZE A;  2FFD C;  1Q90 D;  1MFT A;  3OEH H;  1PPJ E;  1NTZ K;  1QGK B;  3D70 A;  1Q7Y Q;  1LTJ B;  4CPG A;  3KDP B;  2P10 A;  5CJ4 A;  4DCK A;  1SFC B;  2QE7 H;  5CCG A;  3L4F A;  1J2J B;  3P8C D;  1FZC A;  1BDC A;  1MUU A;  4TLF A;  1JY3 O;  1KD1 Q;  2BCC D;  3SWK A;  3VYI A;  5DJU B;  1R8E A;  2YIU B;  1OWA A;  1YQ4 C;  1QLE D;  2M5A A;  3L75 E;  1YQ3 C;  1KC8 Q;  3I56 P;  1LWU A;  2N1T B;  3BVH A;  2K37 A;  1X9V A;  1T2K C;  1SQX G;  2OYH C;  1OMI A;  1ZN5 A;  1BE3 D;  2JP3 A;  1K73 Q;  1Q82 Q;  1KOR A;  3SFD C;  3G3Z A;  1K8A Q;  3IR9 A;  1EZV G;  3TNU B;  3H32 A;  2YXQ B;  1N73 B;  1BE3 J;  1Y9B A;  3CXH I;  2N9Y B;  2E75 B;  1EDL A;  1LTI C;  5TJH A;  1FZF A;  4WY4 B;  1FOS E;  1FBM A;  1JB0 J;  1SQB D;  2Q3I A;  4YPC A;  2HPC B;  3II6 A;  3HE5 A;  2E5T A;  2GUV A;  1IFI A;  4IL6 E;  5KLI B;  5BVZ A;  3L72 J;  2KI7 B;  3L72 G;  3RK3 E;  1Q86 Q;  2AXC A;  4U3F D;  3R4Y A;  2LR2 A;  5AW1 B;  2HR3 A;  1YTZ I;  5AW3 B;  3H6P A;  2HOD B;  3G71 P;  4I6M C;  3BRT B;  2JKV A;  5APX A;  1LT9 C;  1X8Y A;  4PJ0 H;  2B9B A;  1T3J A;  3L73 J;  3L73 G;  5AVS B;  1GTW A;  2MKV A;  1HH0 A;  4HB1 A;  1GK4 A;  2WPQ A;  2Q9I A;  1FZA A;  2MJZ A;  1KFN A;  1EDK A;  2YMY A;  1IK9 A;  1HF9 A;  1SFC C;  3O6Q B;  3MUD A;  5BU8 B;  1YBK A;  4GOE A;  4MN4 C;  4JPZ B;  2KYV A;  1YJN P;  1KYO I;  1VQL P;  1L0N K;  2YIU C;  1LTA C;  3TSI A;  1KB9 H;  2M0B A;  3HTK A;  3M0D C;  3FGA D;  4LLH A;  4JYB A;  2N1T C;  3U1A A;  1OW8 A;  1G1I A;  1N7S B;  3L74 E;  2FXO A;  2C0W A;  1NJI Q;  1VQK P;  2OQQ A;  4ASW A;  1T3U A;  3L71 E;  1PGQ A;  2WIT A;  1L0N E;  2E75 C;  1P84 I;  5KJ7 C;  3JCU E;  3RL0 B;  2E74 D;  1G2C A;  3FWL A;  3MGN A;  4WY4 C;  4OGQ D;  3H1H D;  1YTZ T;  1PPJ G;  4H0L D;  1VF5 D;  4NPD A;  2O3J A;  4C7N A;  1Y8A A;  2RQ6 A;  5KLI C;  3L37 A;  3SWY A;  2E76 D;  3H1H J;  1R5L A;  1JNM A;  3CX5 H;  1NTZ D;  1QVF O;  3GF3 A;  1CI6 B;  3VP8 A;  5CMZ A;  2ZYA A;  1TU3 F;  3L70 G;  5KAI H;  2IBZ E;  2XNX A;  3BCC D;  3L75 J;  3L75 G;  2W83 C;  5KKZ B;  1NTZ J;  2QRX A;  2QJK B;  1W2E A;  3PJS K;  2KZJ A;  4GT1 A;  1WRG A;  1L0L K;  4LGD E;  2FYZ A;  1FE6 A;  3S1K A;  1GU4 A;  2G3A A;  3CWB D;  5CCH C;  3Q3D A;  1E79 H;  3V2Q A;  4AUW A;  2WSC J;  2H88 C;  2KIK A;  2J5U A;  3CME P;  1L2P A;  3CWB J;  4HYT B;  1N7L A;  1IJD B;  2B87 A;  2JWA A;  2C9L Y;  2QIW A;  3AE5 C;  5KAI E;  4L74 A;  4GDO A;  1QL2 A;  3MTU E;  4I2L C;  4ZNC A;  3P8C E;  2JDI H;  4HJG H;  1FAV A;  1N7S C;  4BRY B;  2BCC E;  3CD6 P;  3FX0 A;  5TIS E;  2HFE D;  3L36 A;  2W27 A;  2WPS A;  2YO2 A;  1SQQ D;  3EQ2 A;  3KZI H;  3QH9 A;  1AVO A;  3S4R A;  3Q5R A;  2QSI A;  4H13 B;  1FOS F;  2ZAE B;  5AW5 B;  1VQ7 P;  1SQB K;  2Z4E A;  3RL0 C;  3A0B H;  1GMJ A;  4WVZ A;  1KMI Z;  1S3J A;  1URQ A;  1DEB A;  1NKN A;  1IFJ A;  1T2K D;  1BSH A;  3EFF K;  3V4Q A;  3JC2 2;  3ITK A;  3I5C A;  1VQ9 P;  1KTM A;  3AEF C;  2NPS C;  1FDI A;  3VMX A;  1DIP A;  5AW8 B;  1SQB E;  3G6E P;  5CBO A;  2ITA A;  2L91 A;  3L74 D;  2OYI B;  5KKZ C;  3RBX A;  2QJK C;  5H2F E;  2QJP B;  1NTK K;  3A0B E;  1RE4 A;  3CCL P;  3AEE C;  2KLV A;  3L71 D;  2XKM A; 
#chains in the Genus database with same CATH homology
 3OEH H;  4QMA A;  1H8E H;  2E5T A;  2XOK H;  3PJS K;  3OFN H;  2E5Y A;  2XND H;  3OAA H;  1FS0 E;  1BSH A;  2HLD H;  2JDI H;  2RQ7 A;  1IFP A;  1JEK A;  3EFF K;  2CK3 H;  3FKS H;  2WSS H;  4DJG A;  5FL7 H;  1AQT A;  1E79 H;  2QE7 H;  4WVZ A;  2W6J H;  5DN6 I;  2RQ6 A;  4YXW H;  3OE7 H;  3USS A;  4TLF A;  2V7Q H;  4ASU H;  1BSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...