1BSNA

Solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex.
pubmed doi rcsb
molecule keywords PROTEIN (EPSILON SUBUNIT)
molecule tags Hydrolase
source organism Escherichia coli
total genus 31
structure length 138
sequence length 138
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1998-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1bsnA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1bsnA01
5FL7H 1IFPA 1AQTA 2XNDH 4YXWH 3OAAH 3OFNH 4TLFA 3USSA 1BSHA 4DJGA 2RQ7A 2W6JH 3EFFK 2WSSH 2RQ6A 2V7QH 1JEKA 1FS0E 2CK3H 3FKSH 1E79H 4WVZA 3OE7H 2XOKH 2JDIH 1H8EH 2QE7H 2E5YA 2E5TA 3PJSK 1BSNA 2HLDH 5DN6I 4QMAA 4ASUH 3OEHH
chains in the Genus database with same CATH superfamily
2E75C 1BCCE 4Y99B 2K9YA 3L70G 1AFOA 5AW7B 1FAVA 4RO0A 1OZHA 2KB7P 3TYYA 4JF7A 2M3EA 1FJPA 1LP1B 5KJ7D 3JSVC 1KZUB 2LXCB 2W27A 5GTIE 2ZT9C 1EZVE 1L0ND 5AVSB 2HODB 4IOIH 1L4AC 1T3JA 1SFCC 3H1IJ 2BCCE 1L0LE 4JBZA 1TU3F 2R3SA 1OW6A 4TLFA 2V4HA 1AVOA 5GTHH 2KS1A 1USEA 2W83C 1KFMA 3KDPB 3OE7H 1QX8A 1OMIA 1Y8AA 4N6JA 1KB9H 3H1LJ 3RK2C 1AV1A 3E7KA 1NTMD 3CCQP 4PV1B 5KAIH 4GODA 1YJ9P 1K8AQ 2MKVA 1VQ4P 2WTYA 3FKSH 2L5GB 2KXPB 3VTPC 1NU1J 3V2RA 3WU2E 2FYNB 5CCGD 1LTGC 3JCUH 1E5WA 1N86A 4DOJA 4C46A 4N3YB 4GIFA 1JY2O 2D2CB 1BCCJ 1HGVA 1RF1A 2H7HA 1SP4A 2JDIH 2M0BA 3A0BE 2KS1B 2FYUG 2IBZD 4KHXA 4PD4E 1PP9G 3L72G 2KI7B 1JUNA 3HUSC 4H0LD 3CCSP 1LNQA 3GHGA 2FY8A 1SVFA 3CX5E 4BXLA 1IO4A 1LJ2A 2IBZI 3QH9A 1HJ0A 2FYUK 1M1JC 1BE3J 1JB0J 4KJMA 4GT1A 1JO5A 1YBKA 3L74G 2J58A 2BCCJ 1HTLC 3WUTA 1YJNP 1L0LJ 3KYQA 4KT0J 3AE3C 5CCGC 2GA1A 1FOSF 3CCEP 1N7SC 2M3BA 2B88A 2E76B 2ZYGA 1VQ8P 2WSFH 3L71G 3MUDC 2Q3IA 1RF1B 1QLED 5AW9B 2QM8A 1PGOA 1ZN5A 1NTKJ 5APSA 3FXDA 3PP5A 4UB8E 1KQFB 3GHGB 4H0LC 3H1HE 2JKVA 2YKPA 1KYOE 2E74C 4ZKUA 1EXIA 1NTZD 3OFNH 5TISH 1BGYG 1VF5D 1DIPA 2WWWA 2RQ6A 3HE5A 4JPZB 3R4YA 1SQBE 4XA4A 1EDKA 4H13B 1JMMA 1J1DB 3TNUA 1W5CE 1URQA 1LT9C 4RKUJ 3L36A 1WT6A 5DJUB 2WMMA 3CWBE 3BCCE 2ZYDA 4YPCA 2FFDC 3IAOA 3W68A 3GF7A 1FZCC 1M1KQ 2JO1A 1HUCA 1S5LH 2FYUD 1PP9D 1M57D 3L72D 3CLQA 3H1KE 3L73E 2OGUA 1ZLLA 3HE5B 1X79B 2M5AA 2ZXEB 1FZEA 2GM4A 3MD0A 1FC2C 1GL2D 3CXHE 2YIUB 5CCHD 3E1RA 1NO4A 5KTBA 2WSCH 2QM7A 3TNUB 1YYCA 2P67A 3H1IG 3PLNA 3PJSK 1Q7YQ 2XNXA 1NOHA 1KB9D 3H1HJ 3P8CE 1KD1Q 2UWJE 4C7NA 4JQ0D 3SWFA 3BASA 4WY4D 2A06G 5APTA 3V4QA 3V4WA 1KILD 5KLVD 3KHUA 5AVQB 1KB9I 1YQ3C 3HD7C 1Q81Q 1IK7A 3CCLP 2M5AB 3OAKA 5E79H 4U3FD 1JCCA 3H25A 1SQPD 2OYIC 3H1JG 1VQPP 1FDOA 4LLHA 2E75B 1SQVE 4ASUH 2WITA 2AEMA 3BCCJ 5APXA 1KMIZ 3AE9C 1S9KD 1PGQA 1BCCG 1LTBC 1NTZJ 4ZMDA 1ZRTE 1U7JA 4C7NB 2QJKC 1H8EH 1GW4A 4LGDE 3TF5A 1NKNA 3C8VA 3TGUE 3SFDC 1USDA 1DD3A 1S3JA 5B66E 3L73J 1L4AB 1KV4A 1KILC 3BVHA 1SQXE 2B87A 4H44D 3A0BH 4PD4H 1M90Q 1VQ5P 2DW3A 1GTWA 1GU5A 5TJHA 1MV8A 3Q1MA 1RE4C 2C9NY 3CX5H 2LKMA 2BCCG 2QJPC 3CPWO 5AVWB 1L0LG 2V7QH 1SQQD 2Z5HA 1G1JA 3N7NA 5AW6B 2NZ2A 3RK2B 3CL3D 1LT1A 1PIXA 3BRTB 1ZXGA 3NXSA 5KAFE 1M1JA 1VDFA 1L0LK 1VL2A 4YXDC 4OGQC 4EDFA 1FDIA 4NPDA 1GU4A 4TT3H 1OX3A 2B87B 1N7SA 3S1KA 4L73A 1H88A 3T97A 2Q1KA 4EOTA 3L37A 3SFEC 3MUDA 3B4SA 2R44A 4EIJA 3OA7A 3PHLA 2ZVOB 2FYZA 3K5BA 3MIWA 4EI2A 2AXTE 2OTJP 5KLVJ 1ZV8A 2G8YA 3H1JD 4AQRD 3B8EB 3LIDA 3RK3C 3L75J 3TGUJ 1JEKA 5CBNA 1JNMA 2RH0A 3H1LE 1IFDA 1M1JB 2XU6A 2RKLA 4U3FJ 4B86A 1SQPJ 1FBMA 3W67A 1N7SB 2YXQB 2Y9ZA 1OVRA 1NU1E 2A45G 3AEGC 1VQOP 3LW5H 3RGUA 4DT0A 1CSBA 1LT9A 4C7RA 1NYHA 4IL6X 1Z56A 3CCMP 3AE2C 2CPSA 2IFNA 1UIXA 5B5EH 1YIJP 1OFCX 2R3CA 2FFDA 1M56D 3CI9A 2E74B 4IFFA 3HE4A 1N2DC 2N1TD 1SS1A 3H1HG 4ASVA 1X22A 1P84E 5H2FH 1CI6A 4D6TD 1HJBA 2NPSD 3AEAC 3D70A 3A5TA 2KUBA 2Q5UA 3EWKA 3VYIA 5AW1B 2CK3H 2PGDA 1BE3E 2YNYA 3CMAP 1RE3C 4NPEA 3II6A 2WPSA 1JTHB 3H32A 1PFIA 1SQBG 1LT9B 1Q2NA 5APYA 3A3YB 1NWQA 3VMXA 1YITP 3O6QA 2PAJA 4WVZA 2FFDB 1A02F 1NTKE 3KZIH 1SQBK 3CWBG 4L76A 4DCKA 3IFMA 3HE4B 5KJ7C 3BCCG 2YMYA 3I5CA 1K9MQ 2O01J 3HD7A 3LIEA 1CI6B 3VMAA 2K9JA 1PPJD 1W2BO 2H8PD 4PD4D 3S9OA 3H1KG 2OYIA 4GDOA 3L73G 1NH4A 2P10A 3CX5D 4BWNA 1YJWP 2SPZA 3H32B 3MTUE 3G71P 1HWTC 4PD4I 1T2KD 5B66H 1VQ9P 3O6QB 3B5ND 3Q2YA 3P8MC 3CX5I 1VQMP 1NTME 3D6YA 1PGJA 3RL0g 1EC5A 2R5BA 3E1IA 3HD7B 3BRVB 2JEEA 4A7PA 3L70D 1IFPA 2K9JB 4RJTA 2P1JA 1KC8Q 4PJ0E 2WT7A 2QA4P 2OYIB 1HBWA 1RE4A 1FOSE 4K35A 3D71A 1NJIQ 2Y0EA 2H43A 3IR9A 2QSIA 4M3LA 1OVUA 5AVYB 1LTIC 1A02J 1SQVG 3V6IA 1RQVA 1IFMA 1KYOI 2QJKB 1SQBD 2ZFCA 2FKWB 3B5NC 1L0NJ 1N73C 3V5BA 2BASA 2PFXA 2XKMA 3AE1C 2MJZA 3Q5PA 3GF3A 2FXMA 1KILB 1SQVK 5AW0B 1IZNB 2WZ7A 3TGUG 1ZMEC 1LTJC 1Q82Q 3CWBD 3WMM0 1SQXG 5AW3B 2AXTH 2WT7B 2OTLP 4PV1D 2QJPB 3Q3DA 1VQKP 5CJ0A 2QEXP 1KQGB 4UB6E 2KSJA 2P2UA 2GUSA 2KZIA 3H1KD 3TSIA 5C39A 1NTMJ 1NAYA 1SQXK 4L75A 4NPFX 3CCUP 2N9YB 4GKGA 2D2CD 1NTZE 2B9BA 3ZDMA 4IL6E 4OGQB 2ZAEB 3KXDA 1JY2P 3CXHI 1VF5C 5KKZC 3P8CD 4R4LA 4I1LA 4YXWH 2FXPA 1OIPA 1OW8A 4W7YA 5APUA 4HKZH 1J2JB 3M0AA 3SWYA 1JY3N 1S72P 1RH5B 2QIWA 2ZJSE 1PL5A 3L74D 2H89C 2IDBA 5GTIH 1YHQP 1VQ6P 2E5TA 2HLDH 1N7LA 1IC2A 3H6PA 3AEDC 1YQ4C 2K37A 4MN4C 4I2LC 3RK3B 1N8RQ 4I6MC 2E76D 4N78D 3L71D 2E43A 1U7MA 2ZVNB 3O8ZA 1HF9A 2WSEH 1SQVD 2Q6QA 1L4AA 1SFCA 3H1LG 1RE3A 1RHZB 4IFDK 1SLQA 2POHA 5GTHE 1ZRTD 2ZXXA 2YO2A 1GL2C 2HYNA 3VN0A 2PRRA 5AW2B 1NU1G 1WRGA 1XTGB 5CCHC 2L91A 1BGYD 1KN7A 1AQTA 4JYCA 1BSHA 3G4SP 5AVUB 1SQXD 1JOCA 1JY3O 5KAIE 1T3UA 1ZR2A 1S1CX 3WU2H 5KJ7A 4H13D 2XOKH 2O1KA 2IFMA 1KILE 1NU1K 2ZT9B 5KLVE 3CC2P 1K05A 4WY4C 1PV3A 3AECC 3BATA 3L75E 3JCUE 1G2CA 1OXZA 3M9QA 3CCRP 1SFCB 1ZR4A 4U3FE 1GK6A 1EZVG 1SQPE 5AVRB 1RQUA 3GHGC 2O1JA 4HYTB 2WQYC 2J5UA 1BE3G 3FX0A 5BU8B 2HR3A 2RQ7A 1S9KE 1Q86Q 3HUSA 4HH2A 2O01N 3CC4P 1CW5A 2FYUJ 2A45H 2K3RA 1PP9J 3L72J 4PJ0H 3GLMA 3U1AA 1NTKG 1URQD 3H1ID 1LGHB 3AEEC 2YKQA 2ITAA 5CBOA 3G3ZA 1FS0E 2K1AA 1G2CB 3HRNA 1X9VA 1GDTA 2Y0CA 5CCGA 1NHLA 3P32A 4QMAA 2A06D 3C1LA 4H44C 5CMZA 1M8OB 2P7JA 1NTKK 1IFNA 2W6JH 4UB8H 2Q7CA 5AW5B 3SSUA 1FZGA 1KYOH 1SQQE 3H1LD 3U1CA 3L71J 3HUSB 3RK3E 1OW7A 1RF0C 1N73A 1ZOYC 2KSEA 4GOEA 1KTMA 2YIUC 3A7OA 2IYOA 5TISE 2E75D 4W80A 1NTMG 1AA0A 2OYOA 5AW4B 1URQC 1H89A 1LTJA 2RN0A 1BCCD 1HVVA 2XNDH 4OWFA 2I1JA 3MGNA 4UB6H 3AE7C 3FGAD 1FDMA 2KYVA 1NTMK 2GUVA 1JTHA 3ITKA 5KLIC 2QE7H 3R2PA 1L4AD 4AUWA 1QVFO 3V2NA 4ZKPA 1YTZI 1EZVD 3PH0A 1GK4A 1QVGO 5K5GB 2NRGA 1VQLP 1N73B 3VMYA 4H0LB 1FZCA 1DEBA 4WWIA 3OJAB 1QEXA 4BRYA 4OVNF 2BCCD 3QWOC 1L0LD 3M06A 4U7JA 3CXHH 5DN6I 2VRSA 1EZVI 1KFNA 2Q9IA 4O9BA 1QL2A 1DEEG 2JWAA 1LTJB 2WPVB 1MUUA 3RK2D 2WSFJ 3SWKA 1BDCA 1S4XA 1NTKD 3AEFC 1SQQJ 2Z4EA 1J1EC 3HTKA 2BEQD 3NFQA 2XZRA 3AEBC 1JY2N 3IN6A 2WSSH 1JM0A 1HH0A 3GMAA 2B89A 1FZCB 3KQGA 4BRYB 1DD4A 4D6TE 2KLVA 2O3JA 2KIKA 1L0NE 3N4XA 3VMZA 2N1TC 1NTZG 3VP9A 1MFZA 5E79E 2RMZA 1VF5B 5KKZB 3OW2O 3I56P 2NPSC 2KP8A 3OEHH 5FL7H 1GL2A 4WBAA 5CCHA 3RBZA 1NTZK 1AJYA 2R32A 3HTKB 3H1JJ 1ZP0C 1N7SD 1EDIA 1CZQA 1NAFA 2N9BA 3CCVP 3OAAH 3I55P 4LC1A 1IJDB 1Y47A 4WY4A 4ASWA 3MHVA 3V2PA 1X0TA 3JC22 3P7KA 2KNCA 3MZWB 3L4FA 3RL0D 1KILA 1PPJE 2PP6A 2JWDA 2W90A 2A45I 4YTPC 2M8RA 2WSCJ 2HFED 3USSA 2XV5A 2QJYC 2E74D 1GL2B 1DH3A 1LTTC 1X8YA 3H1HD 4DZOA 5BU5A 1KYOD 2JP3A 2OYHC 1BSNA 2OTKE 4EYYQ 2IBZE 2IYPA 5KAFH 1D7MA 5CHXA 2WSEJ 1T2KC 1LWUC 4D6TJ 4I7ZC 3FWLA 4WY4B 1VQ7P 5AW8B 4XE5B 3L70E 2KNCB 1VQNP 3F89A 2HPCA 1Q90D 3RL0C 5KLVG 4Y99C 3PRJA 3G6EP 3L75G 1K04A 1T8ZA 3Q5SA 2IZ1A 3L35A 3BCCD 3NMDA 4U3FG 2OQQA 3M0DC 1SQPG 1T6AA 2AEFA 5KLVK 2Y0DA 1RF0A 1XTCC 1BDDA 3L73D 4GOFA 2O01H 5APQA 1QL1A 3EQ2A 1Y9BA 1SQPK 3CXHD 3VOPA 1GW3A 1KORA 3GW6A 2P58A 2AXCA 3C9IA 5AVVB 3A0HE 3CMEP 2J59M 1R8EA 1FZFA 2HPCB 1R5LA 1FJKA 2QG4A 2HLOA 1FU1A 2OARA 2IZ0A 4H44B 3AE8C 1GD2E 3FXEA 4HJGH 2V7QJ 1S5LX 4CPGA 3G9RA 5B5EE 4R4MA 1MZ9A 3HD7D 4PV1C 2QVAA 1S2EA 4Y28J 2KZJA 4K3AA 3VP8A 1P84H 2QRXA 1SQQG 2FYNC 1KQSO 2C0XA 5AVTB 3B71A 3CCJP 3WUVA 2XDJA 3L70J 4IFMA 3EFFK 5H2FE 5M1BA 2FYUE 3EFGA 2D2CC 3AE5C 1URQB 1PP9E 3L72E 4Z1MH 2KLUA 1SQQK 2YO3A 2WVRA 1G1IA 2W6BA 1QGKB 5L8RJ 1HGZA 1FZBA 5KLIB 5APVA 2FBWC 1JCDA 1PZQA 3TDKA 3L74E 1SQBJ 3L75D 3TGUD 1KB9E 2CPBA 1EQ7A 2LXBA 2R5DA 3KZIE 1UIIA 3IF4A 2C0WA 4N78E 3L71E 2KOGA 1DX7A 3F5HA 2AEJA 1H8AA 2KK7A 1W2EA 2E5YA 1VPCA 4ZNCA 3AE4C 2N1TA 2E76C 3PTZA 4WB4A 3CWBJ 4HB1A 2YMKA 3LW5J 3RBXA 3M9BA 1RF1C 2NPSA 1NGMB 1IFJA 4XFJA 3UIAA 5AVZB 2I1KA 1ZW0A 1YI2P 3AE6C 1J1EB 4AYCA 1BGYE 3H1KJ 4OGQD 1AVYA 4DJGA 2I8DA 3ABVC 1LTSC 1JMBA 3D6ZA 2HG5D 1RY3A 1R5SA 1EDLA 4H13C 4OH8B 2LR2A 2N1TB 1J1DC 2H88C 3M91A 2Z5IA 1E79H 4D6TG 2JR8A 5EFWB 2NPSB 1L0NG 3FWNA 5BVZA 3RK3D 3U59A 4L74A 3NTNA 1KQLA 5APWA 3L74J 1GZLA 1EDJA 2IPPA 2OYHA 2IX7C 1K73Q 2Y9YA 1IK9A 4RESB 3TK1A 1AQ5A 3MP7B 1L0NK 1GMJA 1LWUA 1LTAC 2K88A 1EXJA 2G3AA 3B5NA 1FE6A 3WUUA 2WPQA 1U57A 3CC7P 1SQVJ 2ZYAA 2W8ZA 2W6AA 3H1IE 1H0TA 1NU1D 1M7LA 2E42A 1OVVA 3Q5RA 3GG2A 2C9LY 2A06E 1YTZT 2QJYB 1PPJG 1OWAA 1LP1A 3M9HA 1BGYJ 3CD6P 3M0DA 2ZT9D 3A2AA 2WPRA 2BEZF 4JYBA 2OYHB 1SQXJ 3S4RA 4W7ZA 5DJTB 2FXOA 1JY3P 2HODA 3KPEA 4IL6H 3V2QA 1SFCD 1P84D 2YXRB 1MKMA 3A0HH 1LWUB 1WMKA 1PGPA 3H1JE 2Q3EA 1MFTA 1L2PA 2IBZG 1NKZB 3B5NB 4I7ZB 1S5LE 1NVOA 3T97B 1BE3D 1FZAA 2JJLA 1H0TB 5AVXB 1IFIA 5CJ4A 2YKOA 1P84I 3RL0B
chains in the Genus database with same CATH topology
5FL7H 1IFPA 1AQTA 2XNDH 4YXWH 3OAAH 3OFNH 4TLFA 3USSA 1BSHA 4DJGA 2RQ7A 2W6JH 3EFFK 2WSSH 2RQ6A 2V7QH 1JEKA 1FS0E 2CK3H 3FKSH 1E79H 4WVZA 3OE7H 2XOKH 2JDIH 1H8EH 2QE7H 2E5YA 2E5TA 3PJSK 1BSNA 2HLDH 5DN6I 4QMAA 4ASUH 3OEHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FL7 H;  1IFP A;  1AQT A;  2XND H;  4YXW H;  3OAA H;  3OFN H;  4TLF A;  3USS A;  1BSH A;  4DJG A;  2RQ7 A;  2W6J H;  3EFF K;  2WSS H;  2RQ6 A;  2V7Q H;  1JEK A;  1FS0 E;  2CK3 H;  3FKS H;  1E79 H;  4WVZ A;  3OE7 H;  2XOK H;  2JDI H;  1H8E H;  2QE7 H;  2E5Y A;  2E5T A;  3PJS K;  1BSN A;  2HLD H;  5DN6 I;  4QMA A;  4ASU H;  3OEH H; 
#chains in the Genus database with same CATH topology
 2E75 C;  1BCC E;  4Y99 B;  2K9Y A;  3L70 G;  1AFO A;  5AW7 B;  1FAV A;  4RO0 A;  1OZH A;  2KB7 P;  3TYY A;  4JF7 A;  2M3E A;  1FJP A;  1LP1 B;  5KJ7 D;  3JSV C;  1KZU B;  2LXC B;  2W27 A;  5GTI E;  2ZT9 C;  1EZV E;  1L0N D;  5AVS B;  2HOD B;  4IOI H;  1L4A C;  1T3J A;  1SFC C;  3H1I J;  2BCC E;  1L0L E;  4JBZ A;  1TU3 F;  2R3S A;  1OW6 A;  4TLF A;  2V4H A;  1AVO A;  5GTH H;  2KS1 A;  1USE A;  2W83 C;  1KFM A;  3KDP B;  3OE7 H;  1QX8 A;  1OMI A;  1Y8A A;  4N6J A;  1KB9 H;  3H1L J;  3RK2 C;  1AV1 A;  3E7K A;  1NTM D;  3CCQ P;  4PV1 B;  5KAI H;  4GOD A;  1YJ9 P;  1K8A Q;  2MKV A;  1VQ4 P;  2WTY A;  3FKS H;  2L5G B;  2KXP B;  3VTP C;  1NU1 J;  3V2R A;  3WU2 E;  2FYN B;  5CCG D;  1LTG C;  3JCU H;  1E5W A;  1N86 A;  4DOJ A;  4C46 A;  4N3Y B;  4GIF A;  1JY2 O;  2D2C B;  1BCC J;  1HGV A;  1RF1 A;  2H7H A;  1SP4 A;  2JDI H;  2M0B A;  3A0B E;  2KS1 B;  2FYU G;  2IBZ D;  4KHX A;  4PD4 E;  1PP9 G;  3L72 G;  2KI7 B;  1JUN A;  3HUS C;  4H0L D;  3CCS P;  1LNQ A;  3GHG A;  2FY8 A;  1SVF A;  3CX5 E;  4BXL A;  1IO4 A;  1LJ2 A;  2IBZ I;  3QH9 A;  1HJ0 A;  2FYU K;  1M1J C;  1BE3 J;  1JB0 J;  4KJM A;  4GT1 A;  1JO5 A;  1YBK A;  3L74 G;  2J58 A;  2BCC J;  1HTL C;  3WUT A;  1YJN P;  1L0L J;  3KYQ A;  4KT0 J;  3AE3 C;  5CCG C;  2GA1 A;  1FOS F;  3CCE P;  1N7S C;  2M3B A;  2B88 A;  2E76 B;  2ZYG A;  1VQ8 P;  2WSF H;  3L71 G;  3MUD C;  2Q3I A;  1RF1 B;  1QLE D;  5AW9 B;  2QM8 A;  1PGO A;  1ZN5 A;  1NTK J;  5APS A;  3FXD A;  3PP5 A;  4UB8 E;  1KQF B;  3GHG B;  4H0L C;  3H1H E;  2JKV A;  2YKP A;  1KYO E;  2E74 C;  4ZKU A;  1EXI A;  1NTZ D;  3OFN H;  5TIS H;  1BGY G;  1VF5 D;  1DIP A;  2WWW A;  2RQ6 A;  3HE5 A;  4JPZ B;  3R4Y A;  1SQB E;  4XA4 A;  1EDK A;  4H13 B;  1JMM A;  1J1D B;  3TNU A;  1W5C E;  1URQ A;  1LT9 C;  4RKU J;  3L36 A;  1WT6 A;  5DJU B;  2WMM A;  3CWB E;  3BCC E;  2ZYD A;  4YPC A;  2FFD C;  3IAO A;  3W68 A;  3GF7 A;  1FZC C;  1M1K Q;  2JO1 A;  1HUC A;  1S5L H;  2FYU D;  1PP9 D;  1M57 D;  3L72 D;  3CLQ A;  3H1K E;  3L73 E;  2OGU A;  1ZLL A;  3HE5 B;  1X79 B;  2M5A A;  2ZXE B;  1FZE A;  2GM4 A;  3MD0 A;  1FC2 C;  1GL2 D;  3CXH E;  2YIU B;  5CCH D;  3E1R A;  1NO4 A;  5KTB A;  2WSC H;  2QM7 A;  3TNU B;  1YYC A;  2P67 A;  3H1I G;  3PLN A;  3PJS K;  1Q7Y Q;  2XNX A;  1NOH A;  1KB9 D;  3H1H J;  3P8C E;  1KD1 Q;  2UWJ E;  4C7N A;  4JQ0 D;  3SWF A;  3BAS A;  4WY4 D;  2A06 G;  5APT A;  3V4Q A;  3V4W A;  1KIL D;  5KLV D;  3KHU A;  5AVQ B;  1KB9 I;  1YQ3 C;  3HD7 C;  1Q81 Q;  1IK7 A;  3CCL P;  2M5A B;  3OAK A;  5E79 H;  4U3F D;  1JCC A;  3H25 A;  1SQP D;  2OYI C;  3H1J G;  1VQP P;  1FDO A;  4LLH A;  2E75 B;  1SQV E;  4ASU H;  2WIT A;  2AEM A;  3BCC J;  5APX A;  1KMI Z;  3AE9 C;  1S9K D;  1PGQ A;  1BCC G;  1LTB C;  1NTZ J;  4ZMD A;  1ZRT E;  1U7J A;  4C7N B;  2QJK C;  1H8E H;  1GW4 A;  4LGD E;  3TF5 A;  1NKN A;  3C8V A;  3TGU E;  3SFD C;  1USD A;  1DD3 A;  1S3J A;  5B66 E;  3L73 J;  1L4A B;  1KV4 A;  1KIL C;  3BVH A;  1SQX E;  2B87 A;  4H44 D;  3A0B H;  4PD4 H;  1M90 Q;  1VQ5 P;  2DW3 A;  1GTW A;  1GU5 A;  5TJH A;  1MV8 A;  3Q1M A;  1RE4 C;  2C9N Y;  3CX5 H;  2LKM A;  2BCC G;  2QJP C;  3CPW O;  5AVW B;  1L0L G;  2V7Q H;  1SQQ D;  2Z5H A;  1G1J A;  3N7N A;  5AW6 B;  2NZ2 A;  3RK2 B;  3CL3 D;  1LT1 A;  1PIX A;  3BRT B;  1ZXG A;  3NXS A;  5KAF E;  1M1J A;  1VDF A;  1L0L K;  1VL2 A;  4YXD C;  4OGQ C;  4EDF A;  1FDI A;  4NPD A;  1GU4 A;  4TT3 H;  1OX3 A;  2B87 B;  1N7S A;  3S1K A;  4L73 A;  1H88 A;  3T97 A;  2Q1K A;  4EOT A;  3L37 A;  3SFE C;  3MUD A;  3B4S A;  2R44 A;  4EIJ A;  3OA7 A;  3PHL A;  2ZVO B;  2FYZ A;  3K5B A;  3MIW A;  4EI2 A;  2AXT E;  2OTJ P;  5KLV J;  1ZV8 A;  2G8Y A;  3H1J D;  4AQR D;  3B8E B;  3LID A;  3RK3 C;  3L75 J;  3TGU J;  1JEK A;  5CBN A;  1JNM A;  2RH0 A;  3H1L E;  1IFD A;  1M1J B;  2XU6 A;  2RKL A;  4U3F J;  4B86 A;  1SQP J;  1FBM A;  3W67 A;  1N7S B;  2YXQ B;  2Y9Z A;  1OVR A;  1NU1 E;  2A45 G;  3AEG C;  1VQO P;  3LW5 H;  3RGU A;  4DT0 A;  1CSB A;  1LT9 A;  4C7R A;  1NYH A;  4IL6 X;  1Z56 A;  3CCM P;  3AE2 C;  2CPS A;  2IFN A;  1UIX A;  5B5E H;  1YIJ P;  1OFC X;  2R3C A;  2FFD A;  1M56 D;  3CI9 A;  2E74 B;  4IFF A;  3HE4 A;  1N2D C;  2N1T D;  1SS1 A;  3H1H G;  4ASV A;  1X22 A;  1P84 E;  5H2F H;  1CI6 A;  4D6T D;  1HJB A;  2NPS D;  3AEA C;  3D70 A;  3A5T A;  2KUB A;  2Q5U A;  3EWK A;  3VYI A;  5AW1 B;  2CK3 H;  2PGD A;  1BE3 E;  2YNY A;  3CMA P;  1RE3 C;  4NPE A;  3II6 A;  2WPS A;  1JTH B;  3H32 A;  1PFI A;  1SQB G;  1LT9 B;  1Q2N A;  5APY A;  3A3Y B;  1NWQ A;  3VMX A;  1YIT P;  3O6Q A;  2PAJ A;  4WVZ A;  2FFD B;  1A02 F;  1NTK E;  3KZI H;  1SQB K;  3CWB G;  4L76 A;  4DCK A;  3IFM A;  3HE4 B;  5KJ7 C;  3BCC G;  2YMY A;  3I5C A;  1K9M Q;  2O01 J;  3HD7 A;  3LIE A;  1CI6 B;  3VMA A;  2K9J A;  1PPJ D;  1W2B O;  2H8P D;  4PD4 D;  3S9O A;  3H1K G;  2OYI A;  4GDO A;  3L73 G;  1NH4 A;  2P10 A;  3CX5 D;  4BWN A;  1YJW P;  2SPZ A;  3H32 B;  3MTU E;  3G71 P;  1HWT C;  4PD4 I;  1T2K D;  5B66 H;  1VQ9 P;  3O6Q B;  3B5N D;  3Q2Y A;  3P8M C;  3CX5 I;  1VQM P;  1NTM E;  3D6Y A;  1PGJ A;  3RL0 g;  1EC5 A;  2R5B A;  3E1I A;  3HD7 B;  3BRV B;  2JEE A;  4A7P A;  3L70 D;  1IFP A;  2K9J B;  4RJT A;  2P1J A;  1KC8 Q;  4PJ0 E;  2WT7 A;  2QA4 P;  2OYI B;  1HBW A;  1RE4 A;  1FOS E;  4K35 A;  3D71 A;  1NJI Q;  2Y0E A;  2H43 A;  3IR9 A;  2QSI A;  4M3L A;  1OVU A;  5AVY B;  1LTI C;  1A02 J;  1SQV G;  3V6I A;  1RQV A;  1IFM A;  1KYO I;  2QJK B;  1SQB D;  2ZFC A;  2FKW B;  3B5N C;  1L0N J;  1N73 C;  3V5B A;  2BAS A;  2PFX A;  2XKM A;  3AE1 C;  2MJZ A;  3Q5P A;  3GF3 A;  2FXM A;  1KIL B;  1SQV K;  5AW0 B;  1IZN B;  2WZ7 A;  3TGU G;  1ZME C;  1LTJ C;  1Q82 Q;  3CWB D;  3WMM 0;  1SQX G;  5AW3 B;  2AXT H;  2WT7 B;  2OTL P;  4PV1 D;  2QJP B;  3Q3D A;  1VQK P;  5CJ0 A;  2QEX P;  1KQG B;  4UB6 E;  2KSJ A;  2P2U A;  2GUS A;  2KZI A;  3H1K D;  3TSI A;  5C39 A;  1NTM J;  1NAY A;  1SQX K;  4L75 A;  4NPF X;  3CCU P;  2N9Y B;  4GKG A;  2D2C D;  1NTZ E;  2B9B A;  3ZDM A;  4IL6 E;  4OGQ B;  2ZAE B;  3KXD A;  1JY2 P;  3CXH I;  1VF5 C;  5KKZ C;  3P8C D;  4R4L A;  4I1L A;  4YXW H;  2FXP A;  1OIP A;  1OW8 A;  4W7Y A;  5APU A;  4HKZ H;  1J2J B;  3M0A A;  3SWY A;  1JY3 N;  1S72 P;  1RH5 B;  2QIW A;  2ZJS E;  1PL5 A;  3L74 D;  2H89 C;  2IDB A;  5GTI H;  1YHQ P;  1VQ6 P;  2E5T A;  2HLD H;  1N7L A;  1IC2 A;  3H6P A;  3AED C;  1YQ4 C;  2K37 A;  4MN4 C;  4I2L C;  3RK3 B;  1N8R Q;  4I6M C;  2E76 D;  4N78 D;  3L71 D;  2E43 A;  1U7M A;  2ZVN B;  3O8Z A;  1HF9 A;  2WSE H;  1SQV D;  2Q6Q A;  1L4A A;  1SFC A;  3H1L G;  1RE3 A;  1RHZ B;  4IFD K;  1SLQ A;  2POH A;  5GTH E;  1ZRT D;  2ZXX A;  2YO2 A;  1GL2 C;  2HYN A;  3VN0 A;  2PRR A;  5AW2 B;  1NU1 G;  1WRG A;  1XTG B;  5CCH C;  2L91 A;  1BGY D;  1KN7 A;  1AQT A;  4JYC A;  1BSH A;  3G4S P;  5AVU B;  1SQX D;  1JOC A;  1JY3 O;  5KAI E;  1T3U A;  1ZR2 A;  1S1C X;  3WU2 H;  5KJ7 A;  4H13 D;  2XOK H;  2O1K A;  2IFM A;  1KIL E;  1NU1 K;  2ZT9 B;  5KLV E;  3CC2 P;  1K05 A;  4WY4 C;  1PV3 A;  3AEC C;  3BAT A;  3L75 E;  3JCU E;  1G2C A;  1OXZ A;  3M9Q A;  3CCR P;  1SFC B;  1ZR4 A;  4U3F E;  1GK6 A;  1EZV G;  1SQP E;  5AVR B;  1RQU A;  3GHG C;  2O1J A;  4HYT B;  2WQY C;  2J5U A;  1BE3 G;  3FX0 A;  5BU8 B;  2HR3 A;  2RQ7 A;  1S9K E;  1Q86 Q;  3HUS A;  4HH2 A;  2O01 N;  3CC4 P;  1CW5 A;  2FYU J;  2A45 H;  2K3R A;  1PP9 J;  3L72 J;  4PJ0 H;  3GLM A;  3U1A A;  1NTK G;  1URQ D;  3H1I D;  1LGH B;  3AEE C;  2YKQ A;  2ITA A;  5CBO A;  3G3Z A;  1FS0 E;  2K1A A;  1G2C B;  3HRN A;  1X9V A;  1GDT A;  2Y0C A;  5CCG A;  1NHL A;  3P32 A;  4QMA A;  2A06 D;  3C1L A;  4H44 C;  5CMZ A;  1M8O B;  2P7J A;  1NTK K;  1IFN A;  2W6J H;  4UB8 H;  2Q7C A;  5AW5 B;  3SSU A;  1FZG A;  1KYO H;  1SQQ E;  3H1L D;  3U1C A;  3L71 J;  3HUS B;  3RK3 E;  1OW7 A;  1RF0 C;  1N73 A;  1ZOY C;  2KSE A;  4GOE A;  1KTM A;  2YIU C;  3A7O A;  2IYO A;  5TIS E;  2E75 D;  4W80 A;  1NTM G;  1AA0 A;  2OYO A;  5AW4 B;  1URQ C;  1H89 A;  1LTJ A;  2RN0 A;  1BCC D;  1HVV A;  2XND H;  4OWF A;  2I1J A;  3MGN A;  4UB6 H;  3AE7 C;  3FGA D;  1FDM A;  2KYV A;  1NTM K;  2GUV A;  1JTH A;  3ITK A;  5KLI C;  2QE7 H;  3R2P A;  1L4A D;  4AUW A;  1QVF O;  3V2N A;  4ZKP A;  1YTZ I;  1EZV D;  3PH0 A;  1GK4 A;  1QVG O;  5K5G B;  2NRG A;  1VQL P;  1N73 B;  3VMY A;  4H0L B;  1FZC A;  1DEB A;  4WWI A;  3OJA B;  1QEX A;  4BRY A;  4OVN F;  2BCC D;  3QWO C;  1L0L D;  3M06 A;  4U7J A;  3CXH H;  5DN6 I;  2VRS A;  1EZV I;  1KFN A;  2Q9I A;  4O9B A;  1QL2 A;  1DEE G;  2JWA A;  1LTJ B;  2WPV B;  1MUU A;  3RK2 D;  2WSF J;  3SWK A;  1BDC A;  1S4X A;  1NTK D;  3AEF C;  1SQQ J;  2Z4E A;  1J1E C;  3HTK A;  2BEQ D;  3NFQ A;  2XZR A;  3AEB C;  1JY2 N;  3IN6 A;  2WSS H;  1JM0 A;  1HH0 A;  3GMA A;  2B89 A;  1FZC B;  3KQG A;  4BRY B;  1DD4 A;  4D6T E;  2KLV A;  2O3J A;  2KIK A;  1L0N E;  3N4X A;  3VMZ A;  2N1T C;  1NTZ G;  3VP9 A;  1MFZ A;  5E79 E;  2RMZ A;  1VF5 B;  5KKZ B;  3OW2 O;  3I56 P;  2NPS C;  2KP8 A;  3OEH H;  5FL7 H;  1GL2 A;  4WBA A;  5CCH A;  3RBZ A;  1NTZ K;  1AJY A;  2R32 A;  3HTK B;  3H1J J;  1ZP0 C;  1N7S D;  1EDI A;  1CZQ A;  1NAF A;  2N9B A;  3CCV P;  3OAA H;  3I55 P;  4LC1 A;  1IJD B;  1Y47 A;  4WY4 A;  4ASW A;  3MHV A;  3V2P A;  1X0T A;  3JC2 2;  3P7K A;  2KNC A;  3MZW B;  3L4F A;  3RL0 D;  1KIL A;  1PPJ E;  2PP6 A;  2JWD A;  2W90 A;  2A45 I;  4YTP C;  2M8R A;  2WSC J;  2HFE D;  3USS A;  2XV5 A;  2QJY C;  2E74 D;  1GL2 B;  1DH3 A;  1LTT C;  1X8Y A;  3H1H D;  4DZO A;  5BU5 A;  1KYO D;  2JP3 A;  2OYH C;  1BSN A;  2OTK E;  4EYY Q;  2IBZ E;  2IYP A;  5KAF H;  1D7M A;  5CHX A;  2WSE J;  1T2K C;  1LWU C;  4D6T J;  4I7Z C;  3FWL A;  4WY4 B;  1VQ7 P;  5AW8 B;  4XE5 B;  3L70 E;  2KNC B;  1VQN P;  3F89 A;  2HPC A;  1Q90 D;  3RL0 C;  5KLV G;  4Y99 C;  3PRJ A;  3G6E P;  3L75 G;  1K04 A;  1T8Z A;  3Q5S A;  2IZ1 A;  3L35 A;  3BCC D;  3NMD A;  4U3F G;  2OQQ A;  3M0D C;  1SQP G;  1T6A A;  2AEF A;  5KLV K;  2Y0D A;  1RF0 A;  1XTC C;  1BDD A;  3L73 D;  4GOF A;  2O01 H;  5APQ A;  1QL1 A;  3EQ2 A;  1Y9B A;  1SQP K;  3CXH D;  3VOP A;  1GW3 A;  1KOR A;  3GW6 A;  2P58 A;  2AXC A;  3C9I A;  5AVV B;  3A0H E;  3CME P;  2J59 M;  1R8E A;  1FZF A;  2HPC B;  1R5L A;  1FJK A;  2QG4 A;  2HLO A;  1FU1 A;  2OAR A;  2IZ0 A;  4H44 B;  3AE8 C;  1GD2 E;  3FXE A;  4HJG H;  2V7Q J;  1S5L X;  4CPG A;  3G9R A;  5B5E E;  4R4M A;  1MZ9 A;  3HD7 D;  4PV1 C;  2QVA A;  1S2E A;  4Y28 J;  2KZJ A;  4K3A A;  3VP8 A;  1P84 H;  2QRX A;  1SQQ G;  2FYN C;  1KQS O;  2C0X A;  5AVT B;  3B71 A;  3CCJ P;  3WUV A;  2XDJ A;  3L70 J;  4IFM A;  3EFF K;  5H2F E;  5M1B A;  2FYU E;  3EFG A;  2D2C C;  3AE5 C;  1URQ B;  1PP9 E;  3L72 E;  4Z1M H;  2KLU A;  1SQQ K;  2YO3 A;  2WVR A;  1G1I A;  2W6B A;  1QGK B;  5L8R J;  1HGZ A;  1FZB A;  5KLI B;  5APV A;  2FBW C;  1JCD A;  1PZQ A;  3TDK A;  3L74 E;  1SQB J;  3L75 D;  3TGU D;  1KB9 E;  2CPB A;  1EQ7 A;  2LXB A;  2R5D A;  3KZI E;  1UII A;  3IF4 A;  2C0W A;  4N78 E;  3L71 E;  2KOG A;  1DX7 A;  3F5H A;  2AEJ A;  1H8A A;  2KK7 A;  1W2E A;  2E5Y A;  1VPC A;  4ZNC A;  3AE4 C;  2N1T A;  2E76 C;  3PTZ A;  4WB4 A;  3CWB J;  4HB1 A;  2YMK A;  3LW5 J;  3RBX A;  3M9B A;  1RF1 C;  2NPS A;  1NGM B;  1IFJ A;  4XFJ A;  3UIA A;  5AVZ B;  2I1K A;  1ZW0 A;  1YI2 P;  3AE6 C;  1J1E B;  4AYC A;  1BGY E;  3H1K J;  4OGQ D;  1AVY A;  4DJG A;  2I8D A;  3ABV C;  1LTS C;  1JMB A;  3D6Z A;  2HG5 D;  1RY3 A;  1R5S A;  1EDL A;  4H13 C;  4OH8 B;  2LR2 A;  2N1T B;  1J1D C;  2H88 C;  3M91 A;  2Z5I A;  1E79 H;  4D6T G;  2JR8 A;  5EFW B;  2NPS B;  1L0N G;  3FWN A;  5BVZ A;  3RK3 D;  3U59 A;  4L74 A;  3NTN A;  1KQL A;  5APW A;  3L74 J;  1GZL A;  1EDJ A;  2IPP A;  2OYH A;  2IX7 C;  1K73 Q;  2Y9Y A;  1IK9 A;  4RES B;  3TK1 A;  1AQ5 A;  3MP7 B;  1L0N K;  1GMJ A;  1LWU A;  1LTA C;  2K88 A;  1EXJ A;  2G3A A;  3B5N A;  1FE6 A;  3WUU A;  2WPQ A;  1U57 A;  3CC7 P;  1SQV J;  2ZYA A;  2W8Z A;  2W6A A;  3H1I E;  1H0T A;  1NU1 D;  1M7L A;  2E42 A;  1OVV A;  3Q5R A;  3GG2 A;  2C9L Y;  2A06 E;  1YTZ T;  2QJY B;  1PPJ G;  1OWA A;  1LP1 A;  3M9H A;  1BGY J;  3CD6 P;  3M0D A;  2ZT9 D;  3A2A A;  2WPR A;  2BEZ F;  4JYB A;  2OYH B;  1SQX J;  3S4R A;  4W7Z A;  5DJT B;  2FXO A;  1JY3 P;  2HOD A;  3KPE A;  4IL6 H;  3V2Q A;  1SFC D;  1P84 D;  2YXR B;  1MKM A;  3A0H H;  1LWU B;  1WMK A;  1PGP A;  3H1J E;  2Q3E A;  1MFT A;  1L2P A;  2IBZ G;  1NKZ B;  3B5N B;  4I7Z B;  1S5L E;  1NVO A;  3T97 B;  1BE3 D;  1FZA A;  2JJL A;  1H0T B;  5AVX B;  1IFI A;  5CJ4 A;  2YKO A;  1P84 I;  3RL0 B; 
#chains in the Genus database with same CATH homology
 5FL7 H;  1IFP A;  1AQT A;  2XND H;  4YXW H;  3OAA H;  3OFN H;  4TLF A;  3USS A;  1BSH A;  4DJG A;  2RQ7 A;  2W6J H;  3EFF K;  2WSS H;  2RQ6 A;  2V7Q H;  1JEK A;  1FS0 E;  2CK3 H;  3FKS H;  1E79 H;  4WVZ A;  3OE7 H;  2XOK H;  2JDI H;  1H8E H;  2QE7 H;  2E5Y A;  2E5T A;  3PJS K;  1BSN A;  2HLD H;  5DN6 I;  4QMA A;  4ASU H;  3OEH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...