1BSNA

Solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EPSILON SUBUNIT)
publication title Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 31
structure length 138
sequence length 138
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1998-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1bsnA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1bsnA01
1BSHA 2XOKH 1FS0E 2CK3H 2XNDH 1IFPA 3OAAH 4WVZA 2HLDH 2W6JH 3OE7H 1AQTA 3PJSK 1E79H 4DJGA 2E5YA 1H8EH 3FKSH 3OEHH 2V7QH 3OFNH 4TLFA 3EFFK 4YXWH 2E5TA 1BSNA 2JDIH 4ASUH 2QE7H 3USSA 2RQ7A 2RQ6A 2WSSH 5FL7H 4QMAA 1JEKA 5DN6I
chains in the Genus database with same CATH superfamily
1RF0C 1HH0A 1KILD 1KB9H 1LTIC 1NTZE 1L0NG 3PJSK 2FYUK 1S5LH 2A45H 3V2NA 1VQNP 3W68A 4BWNA 1P84H 2ZVOB 1RF1A 3GLMA 3G3ZA 2QEXP 3CC7P 5KJ7C 1A02J 3BRTB 3FXEA 1JTHB 3L70E 1VQ5P 5KAIE 1L0NE 2JR8A 2WSCJ 3HRNA 5AW7B 1ZXGA 2D2CC 4AYCA 4D6TG 1EC5A 1PGQA 4C46A 1KB9I 4Y99B 2NPSB 1YJ9P 3SWKA 3MZWB 1JCCA 5KLVG 2ZFCA 2A45I 2M3EA 1JOCA 1L0ND 1P84I 2ZYGA 3KPEA 2NZ2A 2OGUA 1NWQA 3TK1A 4D6TE 2QM8A 3USSA 2WZ7A 1NTMD 1RE4C 1JY2N 2HG5D 1NTKJ 2FYZA 5KLVE 4U3FE 1USDA 2W6AA 1IFJA 1YJNP 3B71A 4H13B 3KQGA 2QE7H 1S9KE 3VTPC 3GHGC 3CC4P 3H1JE 2K9JB 5KLVD 4YXDC 1OZHA 4DCKA 1M1JB 3HD7D 3NXSA 4WY4D 1NU1K 3CWBJ 5CMZA 3ZDMA 1L0LK 1G1IA 1NOHA 5AW4B 3VYIA 3RBXA 2WT7A 1YQ4C 5E79E 1S9KD 1SFCB 5DN6I 3AE8C 1GD2E 3V2QA 2RN0A 2IDBA 2GUVA 4GODA 2ZXXA 4PV1B 3U1CA 5KLIC 4ASUH 2L5GB 3B5NC 3SFEC 1MUUA 1BGYJ 2XOKH 4PD4E 3AEEC 1OX3A 4NPDA 3VMYA 1JUNA 1L4AA 1RY3A 1ZRTD 1ZR4A 3QWOC 5CJ4A 5AVQB 3Q3DA 1ZMEC 2MKVA 4EIJA 2E74C 1FZCA 2N1TA 1JY3N 2BCCJ 2E43A 1ZW0A 3RGUA 5CCGC 2H89C 1LTAC 3L74G 4PD4D 3H32A 2POHA 3L75G 2B87B 1GL2C 2E42A 5KTBA 1G1JA 3RBZA 2R3SA 3SSUA 3GG2A 5KAIH 2FYNB 4YXWH 1YTZT 2KS1B 4OWFA 4H44D 4L76A 3BRVB 4IFMA 3A0HH 2QRXA 4OGQB 3L74E 4N3YB 5KKZC 1FZBA 4H13D 3L75E 1N7LA 5APSA 1SQQE 1LTSC 1FE6A 1GZLA 1D7MA 2ZT9D 3M9BA 1SQXE 3W67A 3L74D 3KYQA 2IZ1A 1H0TA 2HLOA 3RL0B 1AQTA 1HVVA 1LT1A 3BCCG 1BDCA 1NTMK 1VDFA 1FC2C 4HH2A 1JMMA 1GTWA 1SQVD 2YXQB 2G3AA 5KAFE 2KNCB 3MP7B 2AEJA 3MUDC 2OYHA 3RK2B 2R32A 4ZNCA 1Q82Q 3BCCE 2J59M 3TGUG 2E5TA 3I56P 5KLVK 4GIFA 2KK7A 2P67A 1N2DC 1HJ0A 3G71P 3AECC 3D6YA 5E79H 3HUSB 3VP8A 2P7JA 3BCCD 3TGUE 3CD6P 1LP1A 4KHXA 1VQMP 2KYVA 3CMAP 1LTJB 2L91A 4I7ZB 4PD4H 3R2PA 5CBOA 1G2CA 1K05A 3RK3C 2WQYC 1CW5A 3H1HG 3TGUD 4KJMA 1LTGC 3PLNA 3AE3C 3S9OA 1PL5A 2XV5A 3ITKA 1X0TA 2OYIC 3WU2E 2E75C 1KYOE 3IAOA 4HKZH 4BRYB 3D71A 2LXCB 3L71J 3H1HE 3CCRP 1EXIA 2NRGA 5CCHC 2WSEJ 2O01H 1FZCC 2N1TC 1HTLC 1GU5A 1CI6B 2A45G 1N7SC 1SQBG 3WUVA 1LWUC 3CMEP 1URQD 1J2JB 5AW3B 1T3UA 1SQPJ 3AEAC 2KP8A 4L74A 2OTLP 2Y0CA 2AEMA 1YBKA 2I8DA 5KJ7A 2JEEA 4RKUJ 2AXCA 3B4SA 4LLHA 1QL2A 2NPSA 3PP5A 3AE4C 2AEFA 3RL0g 3HE5A 1LT9B 4AQRD 3P8CD 2R5BA 3V5BA 4JBZA 4K3AA 2QJPC 2H88C 3M0AA 1KB9D 5APTA 1W5CE 1SQBD 1JY3O 1ZN5A 1NTKG 2FFDC 5KAFH 1KILB 5AVRB 1P84D 1SQVK 2YMYA 1GK6A 2Q1KA 1RE4A 2M0BA 1SLQA 2YO3A 2WTYA 1BSHA 1JO5A 1QGKB 1NHLA 1T2KC 3O6QB 1JM0A 1NAYA 1NTKE 1BCCJ 2WMMA 1VF5D 1KV4A 4DOJA 3VOPA 2OYHC 3GHGA 2FY8A 4EDFA 3RK3E 2WSSH 1Y47A 1J1EC 2WPQA 3BASA 3M9HA 5BU5A 2Z5HA 3MIWA 1NAFA 3CWBE 1VPCA 2C0WA 3H6PA 2HPCA 2E76D 1IK7A 1AVYA 2I1JA 2PAJA 1BGYG 1RH5B 1N73C 2M5AB 2H7HA 2YXRB 1KYOH 4MN4C 3B5NA 2IFNA 3M9QA 1J1DB 2V7QJ 4WB4A 3HD7C 2BCCG 4WY4C 3V6IA 2FXMA 2RH0A 1PIXA 1BGYE 2KLVA 1NTZG 2XZRA 3LW5H 3JCUE 1FJKA 1NH4A 2CPBA 5CCGA 1EDLA 3HD7B 3Q1MA 2OYOA 3S4RA 2BCCE 2YKOA 3L70G 1VQ8P 1KYOI 2FYUJ 2K9YA 2QJYC 4ZKPA 1Q7YQ 1KZUB 1DD3A 2BASA 4IOIH 1Q2NA 2XNXA 2ZYDA 2IBZI 3TYYA 2WSCH 1M56D 2QJYB 2WSFJ 5TISE 1KORA 3R4YA 4Y99C 2NPSC 1NTZD 2PGDA 2M3BA 2QVAA 1H88A 1NKZB 4W80A 3AE6C 1PGPA 1SQBK 3HE4B 2CPSA 1PGOA 3C1LA 4U3FG 2KNCA 3L70D 1WT6A 4RO0A 2Z4EA 2Q3IA 1IC2A 3CX5E 1GDTA 1UIIA 1K9MQ 4ZMDA 2XU6A 2XDJA 4H13C 2RQ6A 3T97B 5H2FE 4H44B 3MUDA 2LXBA 3H1JG 2GM4A 1PGJA 1GU4A 2JJLA 1S72P 2YKPA 1S1CX 3L36A 3OAKA 1M1JC 3CCSP 3NTNA 1PV3A 3HTKB 4I1LA 4LC1A 4D6TD 1HGZA 4EYYQ 2KSEA 4WWIA 2ZT9B 1SFCC 1PP9G 4YPCA 4DZOA 2K88A 4U3FD 1QEXA 5DJTB 1A02F 1NU1J 1L0LJ 3KZIE 3L4FA 1VQLP 4L75A 2W27A 3M91A 4PV1C 1VQ6P 1IO4A 2HODA 2QJKB 1FZFA 5APXA 3H1JD 3C8VA 2JP3A 3A3YB 1PP9E 5L8RJ 2IX7C 2MJZA 2W6JH 2Y0EA 3E7KA 1GW4A 4DJGA 1M8OB 2YNYA 2BEZF 1NVOA 3JCUH 3CXHE 3CCVP 5APWA 3CCJP 2YKQA 3Q5PA 1KFNA 3L71G 2OYIA 3I55P 3H1IJ 3WMM0 1EQ7A 1IFPA 1YTZI 1PP9D 1OVVA 4A7PA 1DH3A 1KC8Q 3SWYA 5CCHA 3TDKA 2A06E 4XFJA 1YITP 2FYNC 4QMAA 3CCLP 3L71E 1N7SA 1LWUA 1OWAA 2G8YA 5CBNA 3B8EB 4OGQC 5KJ7D 3Q5RA 1SQQG 3ABVC 1X79B 3G6EP 3Q2YA 3GF7A 1NO4A 3L72J 1FDIA 1SQPE 3FXDA 1ZLLA 1LTBC 1SQXG 1NTZK 1JNMA 4W7YA 2WVRA 3UIAA 3OAAH 2GA1A 2XKMA 1HWTC 2WPVB 2Y0DA 1CZQA 3RL0C 1IFDA 2R44A 3FGAD 4C7NB 3G4SP 1IFNA 1URQC 3L37A 3K5BA 1L0NK 3E1RA 4IFFA 2FFDA 3U1AA 2ITAA 3L75D 2BEQD 2E5YA 1SQQD 1URQB 1T8ZA 1NTMJ 1VL2A 2Q9IA 3RK2C 1RF1B 2KSJA 2O01N 2ZYAA 1ZP0C 1H8AA 1FU1A 3OJAB 2QA4P 1SQXD 3GF3A 4UB8E 2JWDA 4GOEA 2JWAA 1ZV8A 2WPRA 5AW8B 4Z1MH 3BATA 3QH9A 3CX5I 5C39A 2IZ0A 3HUSC 1R5SA 1HF9A 1BCCE 3P32A 3KZIH 3A5TA 2M8RA 4KT0J 3TNUB 1XTGB 2M5AA 1LTJC 4I7ZC 3PH0A 2RKLA 3LIEA 1L2PA 1Q90D 1E5WA 1OIPA 1AA0A 3CXHH 1N73A 1HUCA 5AVUB 3L73J 1H89A 3AEDC 3B5ND 3OEHH 3C9IA 5AVTB 1HBWA 1Y8AA 4XA4A 1W2EA 3HD7A 1VF5B 1JY2O 4WY4A 2Q7CA 5AW6B 3GMAA 1VQ7P 2E74D 2IBZG 5CCGD 3KHUA 2W83C 3VMAA 1N8RQ 2WSEH 4TT3H 1GL2D 4H0LD 2WT7B 3CXHI 2FYUG 4N78E 4IL6E 1WMKA 1QL1A 4JYBA 2IBZE 3IF4A 1JTHA 1Q81Q 2E76B 4B86A 1KYOD 3PTZA 3A0BE 4AUWA 1LT9C 4IL6X 2FYUE 3H1HD 2LKMA 1FOSE 1JEKA 2FXOA 1S3JA 1L4AB 3H1LJ 2IBZD 2O01J 1BDDA 3FX0A 2R3CA 2YO2A 1BSNA 1KILC 2FYUD 1EDKA 1YHQP 2KIKA 3T97A 5TJHA 2ZVNB 3H32B 4EOTA 4RESB 1SQQK 4UB8H 1U7JA 3NFQA 3OFNH 2AXTE 1KQFB 1SQXK 1SQVJ 1M7LA 2Q3EA 1FBMA 2Q6QA 3HTKA 1QLED 4L73A 2I1KA 1BE3J 1YYCA 2YIUB 3CC2P 2K9JA 1KMIZ 3I5CA 1H8EH 1M1JA 3N7NA 4CPGA 1S4XA 1NU1G 3CWBG 1L0LG 2IYOA 1NJIQ 4ASWA 1SFCA 1EZVE 2Z5IA 2IFMA 1JB0J 4OVNF 1PPJE 1AQ5A 1NTKD 4LGDE 1RE3A 3MTUE 4NPFX 3F5HA 1NU1E 4JF7A 1L0LE 1KTMA 3H1KJ 3AE2C 3RK3D 2Y9ZA 4O9BA 1J1DC 5B66E 3PRJA 1R8EA 2V7QH 3WU2H 2E75D 2JDIH 1L4AD 1NU1D 3CWBD 1L0LD 4IFDK 2PP6A 4I6MC 2W6BA 2XNDH 4IL6H 1U57A 2B87A 2N1TD 3H1IE 1WRGA 1LP1B 1N7SD 3NMDA 1K04A 3Q5SA 2KS1A 1DIPA 3A0BH 3L72G 4WBAA 1KILE 2P10A 1MKMA 3AE9C 3VMXA 2KOGA 4U7JA 5BVZA 2RMZA 2YMKA 1G2CB 1BGYD 1LGHB 1E79H 2KZIA 3MGNA 3IN6A 3LW5J 4RJTA 4C7NA 3IR9A 3L72E 3TSIA 2BCCD 3KXDA 4WVZA 2WPSA 1VQKP 1URQA 2KLUA 3BVHA 2WITA 2AXTH 4Y28J 1NTMG 1SQBJ 3L72D 1MFZA 3KDPB 4HB1A 4PJ0E 1QX8A 2H8PD 4H44C 1XTCC 2HYNA 2HFED 3A0HE 1EDIA 1X9VA 5AVXB 3MD0A 4GKGA 1T2KD 2R5DA 1JY2P 3II6A 2JKVA 5APYA 2W8ZA 1OMIA 1QVFO 1NTME 1AV1A 2CK3H 2B89A 3HE5B 5GTHE 3M0DC 3V4WA 2D2CB 3L35A 3TNUA 3HUSA 2ZJSE 1IJDB 5AW2B 2ZT9C 2V4HA 3CX5D 2UWJE 5M1BA 5B5EE 3N4XA 1FAVA 1FOSF 4R4MA 1NGMB 1NTKK 1LTJA 4GDOA 3O8ZA 4HYTB 1KN7A 5APVA 2QJKC 3L73G 3D70A 3CCUP 4JYCA 2ZXEB 3AE7C 2Y9YA 5B66H 4JQ0D 3H25A 5AW5B 1RE3C 1VQPP 1KQGB 1EZVI 5AW1B 2QIWA 1SP4A 1YIJP 4XE5B 1VQOP 2FBWC 3L73E 5CJ0A 3TF5A 3EWKA 5APQA 3V2RA 3GHGB 4GOFA 2P58A 1SS1A 4BRYA 2A06G 1PZQA 1YQ3C 1FS0E 1MV8A 3A7OA 1ZRTE 4ZKUA 5CHXA 1CI6A 3GW6A 3VN0A 1JY3P 3L73D 1LNQA 3EFFK 2QM7A 3CL3D 3CXHD 1SQPG 2HPCB 1FZGA 2N9YB 1VQ4P 1GW3A 3CCEP 3H1LG 5KLIB 1LT9A 2OTJP 3FKSH 3B5NB 5TISH 2NPSD 2A06D 2QG4A 2D2CD 1NTZJ 2KB7P 3L71D 3A2AA 1ZR2A 1NYHA 4H0LC 2E74B 3H1LE 3MHVA 1IFIA 2PFXA 4PJ0H 1KILA 5EFWB 5AVWB 1MZ9A 2C9NY 3CLQA 1SQPD 3L70J 3CX5H 1GL2B 1SQVG 4H0LB 1FDMA 1S2EA 3V4QA 1CSBA 2FXPA 1RF1C 1L0NJ 4UB6E 4C7RA 1K8AQ 2KI7B 5H2FH 1BE3G 1EXJA 4NPEA 3H1LD 1ZOYC 3O6QA 1SVFA 5GTHH 3V2PA 1PFIA 1Y9BA 1BCCG 3SFDC 2O1JA 5KKZB 2JO1A 2H43A 1SQVE 1FJPA 1HJBA 5B5EH 2C9LY 4JPZB 1BE3E 3AE1C 4D6TJ 1SFCD 1FZEA 1IK9A 1OW8A 5KLVJ 2RQ7A 4U3FJ 3H1KG 3VMZA 1OVUA 4HJGH 4PV1D 1RHZB 3OE7H 1FZAA 1RQUA 1BE3D 1OVRA 5BU8B 3EQ2A 5AVYB 2C0XA 5AVSB 2KUBA 3WUTA 1BCCD 3H1JJ 3WUUA 1VF5C 2QSIA 2ZAEB 3H1KE 5AVZB 1JMBA 2IYPA 5AW0B 3AEGC 3JC22 1LTTC 2KZJA 4BXLA 1PP9J 5K5GB 2O1KA 3H1KD 1DEBA 2B9BA 5AW9B 1MFTA 1AFOA 2OQQA 2E76C 4N6JA 2K37A 4OGQD 1KD1Q 1T6AA 2HODB 3CCMP 2K1AA 3RK3B 1KQLA 2B88A 2HLDH 2IPPA 1USEA 1L4AC 1LJ2A 3CCQP 3F89A 4K35A 2LR2A 1M57D 1RF0A 2O3JA 2GUSA 2OYIB 2E75B 4N78D 5AVVB 4PD4I 3P8MC 3RL0D 3HE4A 3AEFC 4OH8B 2W90A 3IFMA 3CPWO 3P8CE 5GTIE 2K3RA 1SQPK 1EDJA 4UB6H 1UIXA 2SPZA 4W7ZA 1FZCB 2N1TB 2WWWA 4EI2A 3E1IA 3OW2O 3L74J 1FDOA 2P2UA 3G9RA 1N7SB 1KB9E 1LWUB 3L75J 1X8YA 2FKWB 1W2BO 3RK2D 1DEEG 3EFGA 1S5LE 1X22A 1SQQJ 1SQBE 4ASVA 1JCDA 1KQSO 1N86A 1P84E 2YIUC 1SQXJ 1T3JA 1OFCX 1U7MA 3CI9A 1OW7A 3FWLA 2N9BA 5FL7H 1S5LX 3AEBC 3M0DA 1YI2P 1EZVG 3AE5C 2QJPB 1PPJG 1R5LA 3P7KA 4DT0A 3M06A 2J5UA 2HR3A 1Z56A 2FFDB 1K73Q 1H0TB 2DW3A 3BCCJ 1Q86Q 3JSVC 2J58A 1RQVA 2PRRA 3FWNA 1IFMA 2OTKE 2OARA 1EZVD 5DJUB 1GMJA 1IZNB 3VP9A 2OYHB 1AJYA 3TGUJ 2Q5UA 3H1IG 1PPJD 1KFMA 1M1KQ 1J1EB 3SWFA 4GT1A 5APUA 1AVOA 1M90Q 3D6ZA 5CCHD 1NKNA 2P1JA 1DX7A 4R4LA 1GK4A 1VQ9P 1HGVA 2KXPB 4M3LA 4TLFA 3OA7A 1QVGO 1OXZA 2VRSA 1YJWP 3S1KA 3LIDA 1N73B 3PHLA 1DD4A 1OW6A 1TU3F 3H1HJ 3H1ID 5GTIH 4WY4B 4I2LC 4YTPC 2WSFH 1GL2A 3U59A
chains in the Genus database with same CATH topology
1BSHA 2XOKH 1FS0E 2CK3H 2XNDH 1IFPA 3OAAH 4WVZA 2HLDH 2W6JH 3OE7H 1AQTA 3PJSK 1E79H 4DJGA 2E5YA 1H8EH 3FKSH 3OEHH 2V7QH 3OFNH 4TLFA 3EFFK 4YXWH 2E5TA 1BSNA 2JDIH 4ASUH 2QE7H 3USSA 2RQ7A 2RQ6A 2WSSH 5FL7H 4QMAA 1JEKA 5DN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSH A;  2XOK H;  1FS0 E;  2CK3 H;  2XND H;  1IFP A;  3OAA H;  4WVZ A;  2HLD H;  2W6J H;  3OE7 H;  1AQT A;  3PJS K;  1E79 H;  4DJG A;  2E5Y A;  1H8E H;  3FKS H;  3OEH H;  2V7Q H;  3OFN H;  4TLF A;  3EFF K;  4YXW H;  2E5T A;  1BSN A;  2JDI H;  4ASU H;  2QE7 H;  3USS A;  2RQ7 A;  2RQ6 A;  2WSS H;  5FL7 H;  4QMA A;  1JEK A;  5DN6 I; 
#chains in the Genus database with same CATH topology
 1RF0 C;  1HH0 A;  1KIL D;  1KB9 H;  1LTI C;  1NTZ E;  1L0N G;  3PJS K;  2FYU K;  1S5L H;  2A45 H;  3V2N A;  1VQN P;  3W68 A;  4BWN A;  1P84 H;  2ZVO B;  1RF1 A;  3GLM A;  3G3Z A;  2QEX P;  3CC7 P;  5KJ7 C;  1A02 J;  3BRT B;  3FXE A;  1JTH B;  3L70 E;  1VQ5 P;  5KAI E;  1L0N E;  2JR8 A;  2WSC J;  3HRN A;  5AW7 B;  1ZXG A;  2D2C C;  4AYC A;  4D6T G;  1EC5 A;  1PGQ A;  4C46 A;  1KB9 I;  4Y99 B;  2NPS B;  1YJ9 P;  3SWK A;  3MZW B;  1JCC A;  5KLV G;  2ZFC A;  2A45 I;  2M3E A;  1JOC A;  1L0N D;  1P84 I;  2ZYG A;  3KPE A;  2NZ2 A;  2OGU A;  1NWQ A;  3TK1 A;  4D6T E;  2QM8 A;  3USS A;  2WZ7 A;  1NTM D;  1RE4 C;  1JY2 N;  2HG5 D;  1NTK J;  2FYZ A;  5KLV E;  4U3F E;  1USD A;  2W6A A;  1IFJ A;  1YJN P;  3B71 A;  4H13 B;  3KQG A;  2QE7 H;  1S9K E;  3VTP C;  3GHG C;  3CC4 P;  3H1J E;  2K9J B;  5KLV D;  4YXD C;  1OZH A;  4DCK A;  1M1J B;  3HD7 D;  3NXS A;  4WY4 D;  1NU1 K;  3CWB J;  5CMZ A;  3ZDM A;  1L0L K;  1G1I A;  1NOH A;  5AW4 B;  3VYI A;  3RBX A;  2WT7 A;  1YQ4 C;  5E79 E;  1S9K D;  1SFC B;  5DN6 I;  3AE8 C;  1GD2 E;  3V2Q A;  2RN0 A;  2IDB A;  2GUV A;  4GOD A;  2ZXX A;  4PV1 B;  3U1C A;  5KLI C;  4ASU H;  2L5G B;  3B5N C;  3SFE C;  1MUU A;  1BGY J;  2XOK H;  4PD4 E;  3AEE C;  1OX3 A;  4NPD A;  3VMY A;  1JUN A;  1L4A A;  1RY3 A;  1ZRT D;  1ZR4 A;  3QWO C;  5CJ4 A;  5AVQ B;  3Q3D A;  1ZME C;  2MKV A;  4EIJ A;  2E74 C;  1FZC A;  2N1T A;  1JY3 N;  2BCC J;  2E43 A;  1ZW0 A;  3RGU A;  5CCG C;  2H89 C;  1LTA C;  3L74 G;  4PD4 D;  3H32 A;  2POH A;  3L75 G;  2B87 B;  1GL2 C;  2E42 A;  5KTB A;  1G1J A;  3RBZ A;  2R3S A;  3SSU A;  3GG2 A;  5KAI H;  2FYN B;  4YXW H;  1YTZ T;  2KS1 B;  4OWF A;  4H44 D;  4L76 A;  3BRV B;  4IFM A;  3A0H H;  2QRX A;  4OGQ B;  3L74 E;  4N3Y B;  5KKZ C;  1FZB A;  4H13 D;  3L75 E;  1N7L A;  5APS A;  1SQQ E;  1LTS C;  1FE6 A;  1GZL A;  1D7M A;  2ZT9 D;  3M9B A;  1SQX E;  3W67 A;  3L74 D;  3KYQ A;  2IZ1 A;  1H0T A;  2HLO A;  3RL0 B;  1AQT A;  1HVV A;  1LT1 A;  3BCC G;  1BDC A;  1NTM K;  1VDF A;  1FC2 C;  4HH2 A;  1JMM A;  1GTW A;  1SQV D;  2YXQ B;  2G3A A;  5KAF E;  2KNC B;  3MP7 B;  2AEJ A;  3MUD C;  2OYH A;  3RK2 B;  2R32 A;  4ZNC A;  1Q82 Q;  3BCC E;  2J59 M;  3TGU G;  2E5T A;  3I56 P;  5KLV K;  4GIF A;  2KK7 A;  2P67 A;  1N2D C;  1HJ0 A;  3G71 P;  3AEC C;  3D6Y A;  5E79 H;  3HUS B;  3VP8 A;  2P7J A;  3BCC D;  3TGU E;  3CD6 P;  1LP1 A;  4KHX A;  1VQM P;  2KYV A;  3CMA P;  1LTJ B;  2L91 A;  4I7Z B;  4PD4 H;  3R2P A;  5CBO A;  1G2C A;  1K05 A;  3RK3 C;  2WQY C;  1CW5 A;  3H1H G;  3TGU D;  4KJM A;  1LTG C;  3PLN A;  3AE3 C;  3S9O A;  1PL5 A;  2XV5 A;  3ITK A;  1X0T A;  2OYI C;  3WU2 E;  2E75 C;  1KYO E;  3IAO A;  4HKZ H;  4BRY B;  3D71 A;  2LXC B;  3L71 J;  3H1H E;  3CCR P;  1EXI A;  2NRG A;  5CCH C;  2WSE J;  2O01 H;  1FZC C;  2N1T C;  1HTL C;  1GU5 A;  1CI6 B;  2A45 G;  1N7S C;  1SQB G;  3WUV A;  1LWU C;  3CME P;  1URQ D;  1J2J B;  5AW3 B;  1T3U A;  1SQP J;  3AEA C;  2KP8 A;  4L74 A;  2OTL P;  2Y0C A;  2AEM A;  1YBK A;  2I8D A;  5KJ7 A;  2JEE A;  4RKU J;  2AXC A;  3B4S A;  4LLH A;  1QL2 A;  2NPS A;  3PP5 A;  3AE4 C;  2AEF A;  3RL0 g;  3HE5 A;  1LT9 B;  4AQR D;  3P8C D;  2R5B A;  3V5B A;  4JBZ A;  4K3A A;  2QJP C;  2H88 C;  3M0A A;  1KB9 D;  5APT A;  1W5C E;  1SQB D;  1JY3 O;  1ZN5 A;  1NTK G;  2FFD C;  5KAF H;  1KIL B;  5AVR B;  1P84 D;  1SQV K;  2YMY A;  1GK6 A;  2Q1K A;  1RE4 A;  2M0B A;  1SLQ A;  2YO3 A;  2WTY A;  1BSH A;  1JO5 A;  1QGK B;  1NHL A;  1T2K C;  3O6Q B;  1JM0 A;  1NAY A;  1NTK E;  1BCC J;  2WMM A;  1VF5 D;  1KV4 A;  4DOJ A;  3VOP A;  2OYH C;  3GHG A;  2FY8 A;  4EDF A;  3RK3 E;  2WSS H;  1Y47 A;  1J1E C;  2WPQ A;  3BAS A;  3M9H A;  5BU5 A;  2Z5H A;  3MIW A;  1NAF A;  3CWB E;  1VPC A;  2C0W A;  3H6P A;  2HPC A;  2E76 D;  1IK7 A;  1AVY A;  2I1J A;  2PAJ A;  1BGY G;  1RH5 B;  1N73 C;  2M5A B;  2H7H A;  2YXR B;  1KYO H;  4MN4 C;  3B5N A;  2IFN A;  3M9Q A;  1J1D B;  2V7Q J;  4WB4 A;  3HD7 C;  2BCC G;  4WY4 C;  3V6I A;  2FXM A;  2RH0 A;  1PIX A;  1BGY E;  2KLV A;  1NTZ G;  2XZR A;  3LW5 H;  3JCU E;  1FJK A;  1NH4 A;  2CPB A;  5CCG A;  1EDL A;  3HD7 B;  3Q1M A;  2OYO A;  3S4R A;  2BCC E;  2YKO A;  3L70 G;  1VQ8 P;  1KYO I;  2FYU J;  2K9Y A;  2QJY C;  4ZKP A;  1Q7Y Q;  1KZU B;  1DD3 A;  2BAS A;  4IOI H;  1Q2N A;  2XNX A;  2ZYD A;  2IBZ I;  3TYY A;  2WSC H;  1M56 D;  2QJY B;  2WSF J;  5TIS E;  1KOR A;  3R4Y A;  4Y99 C;  2NPS C;  1NTZ D;  2PGD A;  2M3B A;  2QVA A;  1H88 A;  1NKZ B;  4W80 A;  3AE6 C;  1PGP A;  1SQB K;  3HE4 B;  2CPS A;  1PGO A;  3C1L A;  4U3F G;  2KNC A;  3L70 D;  1WT6 A;  4RO0 A;  2Z4E A;  2Q3I A;  1IC2 A;  3CX5 E;  1GDT A;  1UII A;  1K9M Q;  4ZMD A;  2XU6 A;  2XDJ A;  4H13 C;  2RQ6 A;  3T97 B;  5H2F E;  4H44 B;  3MUD A;  2LXB A;  3H1J G;  2GM4 A;  1PGJ A;  1GU4 A;  2JJL A;  1S72 P;  2YKP A;  1S1C X;  3L36 A;  3OAK A;  1M1J C;  3CCS P;  3NTN A;  1PV3 A;  3HTK B;  4I1L A;  4LC1 A;  4D6T D;  1HGZ A;  4EYY Q;  2KSE A;  4WWI A;  2ZT9 B;  1SFC C;  1PP9 G;  4YPC A;  4DZO A;  2K88 A;  4U3F D;  1QEX A;  5DJT B;  1A02 F;  1NU1 J;  1L0L J;  3KZI E;  3L4F A;  1VQL P;  4L75 A;  2W27 A;  3M91 A;  4PV1 C;  1VQ6 P;  1IO4 A;  2HOD A;  2QJK B;  1FZF A;  5APX A;  3H1J D;  3C8V A;  2JP3 A;  3A3Y B;  1PP9 E;  5L8R J;  2IX7 C;  2MJZ A;  2W6J H;  2Y0E A;  3E7K A;  1GW4 A;  4DJG A;  1M8O B;  2YNY A;  2BEZ F;  1NVO A;  3JCU H;  3CXH E;  3CCV P;  5APW A;  3CCJ P;  2YKQ A;  3Q5P A;  1KFN A;  3L71 G;  2OYI A;  3I55 P;  3H1I J;  3WMM 0;  1EQ7 A;  1IFP A;  1YTZ I;  1PP9 D;  1OVV A;  4A7P A;  1DH3 A;  1KC8 Q;  3SWY A;  5CCH A;  3TDK A;  2A06 E;  4XFJ A;  1YIT P;  2FYN C;  4QMA A;  3CCL P;  3L71 E;  1N7S A;  1LWU A;  1OWA A;  2G8Y A;  5CBN A;  3B8E B;  4OGQ C;  5KJ7 D;  3Q5R A;  1SQQ G;  3ABV C;  1X79 B;  3G6E P;  3Q2Y A;  3GF7 A;  1NO4 A;  3L72 J;  1FDI A;  1SQP E;  3FXD A;  1ZLL A;  1LTB C;  1SQX G;  1NTZ K;  1JNM A;  4W7Y A;  2WVR A;  3UIA A;  3OAA H;  2GA1 A;  2XKM A;  1HWT C;  2WPV B;  2Y0D A;  1CZQ A;  3RL0 C;  1IFD A;  2R44 A;  3FGA D;  4C7N B;  3G4S P;  1IFN A;  1URQ C;  3L37 A;  3K5B A;  1L0N K;  3E1R A;  4IFF A;  2FFD A;  3U1A A;  2ITA A;  3L75 D;  2BEQ D;  2E5Y A;  1SQQ D;  1URQ B;  1T8Z A;  1NTM J;  1VL2 A;  2Q9I A;  3RK2 C;  1RF1 B;  2KSJ A;  2O01 N;  2ZYA A;  1ZP0 C;  1H8A A;  1FU1 A;  3OJA B;  2QA4 P;  1SQX D;  3GF3 A;  4UB8 E;  2JWD A;  4GOE A;  2JWA A;  1ZV8 A;  2WPR A;  5AW8 B;  4Z1M H;  3BAT A;  3QH9 A;  3CX5 I;  5C39 A;  2IZ0 A;  3HUS C;  1R5S A;  1HF9 A;  1BCC E;  3P32 A;  3KZI H;  3A5T A;  2M8R A;  4KT0 J;  3TNU B;  1XTG B;  2M5A A;  1LTJ C;  4I7Z C;  3PH0 A;  2RKL A;  3LIE A;  1L2P A;  1Q90 D;  1E5W A;  1OIP A;  1AA0 A;  3CXH H;  1N73 A;  1HUC A;  5AVU B;  3L73 J;  1H89 A;  3AED C;  3B5N D;  3OEH H;  3C9I A;  5AVT B;  1HBW A;  1Y8A A;  4XA4 A;  1W2E A;  3HD7 A;  1VF5 B;  1JY2 O;  4WY4 A;  2Q7C A;  5AW6 B;  3GMA A;  1VQ7 P;  2E74 D;  2IBZ G;  5CCG D;  3KHU A;  2W83 C;  3VMA A;  1N8R Q;  2WSE H;  4TT3 H;  1GL2 D;  4H0L D;  2WT7 B;  3CXH I;  2FYU G;  4N78 E;  4IL6 E;  1WMK A;  1QL1 A;  4JYB A;  2IBZ E;  3IF4 A;  1JTH A;  1Q81 Q;  2E76 B;  4B86 A;  1KYO D;  3PTZ A;  3A0B E;  4AUW A;  1LT9 C;  4IL6 X;  2FYU E;  3H1H D;  2LKM A;  1FOS E;  1JEK A;  2FXO A;  1S3J A;  1L4A B;  3H1L J;  2IBZ D;  2O01 J;  1BDD A;  3FX0 A;  2R3C A;  2YO2 A;  1BSN A;  1KIL C;  2FYU D;  1EDK A;  1YHQ P;  2KIK A;  3T97 A;  5TJH A;  2ZVN B;  3H32 B;  4EOT A;  4RES B;  1SQQ K;  4UB8 H;  1U7J A;  3NFQ A;  3OFN H;  2AXT E;  1KQF B;  1SQX K;  1SQV J;  1M7L A;  2Q3E A;  1FBM A;  2Q6Q A;  3HTK A;  1QLE D;  4L73 A;  2I1K A;  1BE3 J;  1YYC A;  2YIU B;  3CC2 P;  2K9J A;  1KMI Z;  3I5C A;  1H8E H;  1M1J A;  3N7N A;  4CPG A;  1S4X A;  1NU1 G;  3CWB G;  1L0L G;  2IYO A;  1NJI Q;  4ASW A;  1SFC A;  1EZV E;  2Z5I A;  2IFM A;  1JB0 J;  4OVN F;  1PPJ E;  1AQ5 A;  1NTK D;  4LGD E;  1RE3 A;  3MTU E;  4NPF X;  3F5H A;  1NU1 E;  4JF7 A;  1L0L E;  1KTM A;  3H1K J;  3AE2 C;  3RK3 D;  2Y9Z A;  4O9B A;  1J1D C;  5B66 E;  3PRJ A;  1R8E A;  2V7Q H;  3WU2 H;  2E75 D;  2JDI H;  1L4A D;  1NU1 D;  3CWB D;  1L0L D;  4IFD K;  2PP6 A;  4I6M C;  2W6B A;  2XND H;  4IL6 H;  1U57 A;  2B87 A;  2N1T D;  3H1I E;  1WRG A;  1LP1 B;  1N7S D;  3NMD A;  1K04 A;  3Q5S A;  2KS1 A;  1DIP A;  3A0B H;  3L72 G;  4WBA A;  1KIL E;  2P10 A;  1MKM A;  3AE9 C;  3VMX A;  2KOG A;  4U7J A;  5BVZ A;  2RMZ A;  2YMK A;  1G2C B;  1BGY D;  1LGH B;  1E79 H;  2KZI A;  3MGN A;  3IN6 A;  3LW5 J;  4RJT A;  4C7N A;  3IR9 A;  3L72 E;  3TSI A;  2BCC D;  3KXD A;  4WVZ A;  2WPS A;  1VQK P;  1URQ A;  2KLU A;  3BVH A;  2WIT A;  2AXT H;  4Y28 J;  1NTM G;  1SQB J;  3L72 D;  1MFZ A;  3KDP B;  4HB1 A;  4PJ0 E;  1QX8 A;  2H8P D;  4H44 C;  1XTC C;  2HYN A;  2HFE D;  3A0H E;  1EDI A;  1X9V A;  5AVX B;  3MD0 A;  4GKG A;  1T2K D;  2R5D A;  1JY2 P;  3II6 A;  2JKV A;  5APY A;  2W8Z A;  1OMI A;  1QVF O;  1NTM E;  1AV1 A;  2CK3 H;  2B89 A;  3HE5 B;  5GTH E;  3M0D C;  3V4W A;  2D2C B;  3L35 A;  3TNU A;  3HUS A;  2ZJS E;  1IJD B;  5AW2 B;  2ZT9 C;  2V4H A;  3CX5 D;  2UWJ E;  5M1B A;  5B5E E;  3N4X A;  1FAV A;  1FOS F;  4R4M A;  1NGM B;  1NTK K;  1LTJ A;  4GDO A;  3O8Z A;  4HYT B;  1KN7 A;  5APV A;  2QJK C;  3L73 G;  3D70 A;  3CCU P;  4JYC A;  2ZXE B;  3AE7 C;  2Y9Y A;  5B66 H;  4JQ0 D;  3H25 A;  5AW5 B;  1RE3 C;  1VQP P;  1KQG B;  1EZV I;  5AW1 B;  2QIW A;  1SP4 A;  1YIJ P;  4XE5 B;  1VQO P;  2FBW C;  3L73 E;  5CJ0 A;  3TF5 A;  3EWK A;  5APQ A;  3V2R A;  3GHG B;  4GOF A;  2P58 A;  1SS1 A;  4BRY A;  2A06 G;  1PZQ A;  1YQ3 C;  1FS0 E;  1MV8 A;  3A7O A;  1ZRT E;  4ZKU A;  5CHX A;  1CI6 A;  3GW6 A;  3VN0 A;  1JY3 P;  3L73 D;  1LNQ A;  3EFF K;  2QM7 A;  3CL3 D;  3CXH D;  1SQP G;  2HPC B;  1FZG A;  2N9Y B;  1VQ4 P;  1GW3 A;  3CCE P;  3H1L G;  5KLI B;  1LT9 A;  2OTJ P;  3FKS H;  3B5N B;  5TIS H;  2NPS D;  2A06 D;  2QG4 A;  2D2C D;  1NTZ J;  2KB7 P;  3L71 D;  3A2A A;  1ZR2 A;  1NYH A;  4H0L C;  2E74 B;  3H1L E;  3MHV A;  1IFI A;  2PFX A;  4PJ0 H;  1KIL A;  5EFW B;  5AVW B;  1MZ9 A;  2C9N Y;  3CLQ A;  1SQP D;  3L70 J;  3CX5 H;  1GL2 B;  1SQV G;  4H0L B;  1FDM A;  1S2E A;  3V4Q A;  1CSB A;  2FXP A;  1RF1 C;  1L0N J;  4UB6 E;  4C7R A;  1K8A Q;  2KI7 B;  5H2F H;  1BE3 G;  1EXJ A;  4NPE A;  3H1L D;  1ZOY C;  3O6Q A;  1SVF A;  5GTH H;  3V2P A;  1PFI A;  1Y9B A;  1BCC G;  3SFD C;  2O1J A;  5KKZ B;  2JO1 A;  2H43 A;  1SQV E;  1FJP A;  1HJB A;  5B5E H;  2C9L Y;  4JPZ B;  1BE3 E;  3AE1 C;  4D6T J;  1SFC D;  1FZE A;  1IK9 A;  1OW8 A;  5KLV J;  2RQ7 A;  4U3F J;  3H1K G;  3VMZ A;  1OVU A;  4HJG H;  4PV1 D;  1RHZ B;  3OE7 H;  1FZA A;  1RQU A;  1BE3 D;  1OVR A;  5BU8 B;  3EQ2 A;  5AVY B;  2C0X A;  5AVS B;  2KUB A;  3WUT A;  1BCC D;  3H1J J;  3WUU A;  1VF5 C;  2QSI A;  2ZAE B;  3H1K E;  5AVZ B;  1JMB A;  2IYP A;  5AW0 B;  3AEG C;  3JC2 2;  1LTT C;  2KZJ A;  4BXL A;  1PP9 J;  5K5G B;  2O1K A;  3H1K D;  1DEB A;  2B9B A;  5AW9 B;  1MFT A;  1AFO A;  2OQQ A;  2E76 C;  4N6J A;  2K37 A;  4OGQ D;  1KD1 Q;  1T6A A;  2HOD B;  3CCM P;  2K1A A;  3RK3 B;  1KQL A;  2B88 A;  2HLD H;  2IPP A;  1USE A;  1L4A C;  1LJ2 A;  3CCQ P;  3F89 A;  4K35 A;  2LR2 A;  1M57 D;  1RF0 A;  2O3J A;  2GUS A;  2OYI B;  2E75 B;  4N78 D;  5AVV B;  4PD4 I;  3P8M C;  3RL0 D;  3HE4 A;  3AEF C;  4OH8 B;  2W90 A;  3IFM A;  3CPW O;  3P8C E;  5GTI E;  2K3R A;  1SQP K;  1EDJ A;  4UB6 H;  1UIX A;  2SPZ A;  4W7Z A;  1FZC B;  2N1T B;  2WWW A;  4EI2 A;  3E1I A;  3OW2 O;  3L74 J;  1FDO A;  2P2U A;  3G9R A;  1N7S B;  1KB9 E;  1LWU B;  3L75 J;  1X8Y A;  2FKW B;  1W2B O;  3RK2 D;  1DEE G;  3EFG A;  1S5L E;  1X22 A;  1SQQ J;  1SQB E;  4ASV A;  1JCD A;  1KQS O;  1N86 A;  1P84 E;  2YIU C;  1SQX J;  1T3J A;  1OFC X;  1U7M A;  3CI9 A;  1OW7 A;  3FWL A;  2N9B A;  5FL7 H;  1S5L X;  3AEB C;  3M0D A;  1YI2 P;  1EZV G;  3AE5 C;  2QJP B;  1PPJ G;  1R5L A;  3P7K A;  4DT0 A;  3M06 A;  2J5U A;  2HR3 A;  1Z56 A;  2FFD B;  1K73 Q;  1H0T B;  2DW3 A;  3BCC J;  1Q86 Q;  3JSV C;  2J58 A;  1RQV A;  2PRR A;  3FWN A;  1IFM A;  2OTK E;  2OAR A;  1EZV D;  5DJU B;  1GMJ A;  1IZN B;  3VP9 A;  2OYH B;  1AJY A;  3TGU J;  2Q5U A;  3H1I G;  1PPJ D;  1KFM A;  1M1K Q;  1J1E B;  3SWF A;  4GT1 A;  5APU A;  1AVO A;  1M90 Q;  3D6Z A;  5CCH D;  1NKN A;  2P1J A;  1DX7 A;  4R4L A;  1GK4 A;  1VQ9 P;  1HGV A;  2KXP B;  4M3L A;  4TLF A;  3OA7 A;  1QVG O;  1OXZ A;  2VRS A;  1YJW P;  3S1K A;  3LID A;  1N73 B;  3PHL A;  1DD4 A;  1OW6 A;  1TU3 F;  3H1H J;  3H1I D;  5GTI H;  4WY4 B;  4I2L C;  4YTP C;  2WSF H;  1GL2 A;  3U59 A; 
#chains in the Genus database with same CATH homology
 1BSH A;  2XOK H;  1FS0 E;  2CK3 H;  2XND H;  1IFP A;  3OAA H;  4WVZ A;  2HLD H;  2W6J H;  3OE7 H;  1AQT A;  3PJS K;  1E79 H;  4DJG A;  2E5Y A;  1H8E H;  3FKS H;  3OEH H;  2V7Q H;  3OFN H;  4TLF A;  3EFF K;  4YXW H;  2E5T A;  1BSN A;  2JDI H;  4ASU H;  2QE7 H;  3USS A;  2RQ7 A;  2RQ6 A;  2WSS H;  5FL7 H;  4QMA A;  1JEK A;  5DN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...