1BSNA

Solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EPSILON SUBUNIT)
publication title Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 31
structure length 138
sequence length 138
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1998-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1bsnA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1bsnA01
3OFNH 2W6JH 1FS0E 2JDIH 1JEKA 3EFFK 1BSNA 2V7QH 2CK3H 2RQ6A 3OAAH 2RQ7A 1H8EH 3OEHH 2XOKH 5DN6I 4WVZA 4DJGA 1BSHA 1IFPA 4YXWH 2E5YA 4QMAA 2WSSH 3USSA 5FL7H 2XNDH 2E5TA 2QE7H 4ASUH 1AQTA 3FKSH 4TLFA 3OE7H 1E79H 2HLDH 3PJSK
chains in the Genus database with same CATH superfamily
1AA0A 2QJKB 4ASVA 1JY2N 1HH0A 2C0WA 3AE6C 1YJNP 3V4WA 1S4XA 1D7MA 4OVNF 1EDJA 1BGYG 2ZFCA 3E1IA 2P58A 2W6JH 1NTME 1SQVK 2RQ6A 1KORA 1OMIA 1PP9E 1YJWP 3HRNA 3L37A 2PRRA 1HWTC 1OFCX 3A0HH 1HVVA 2KXPB 4HB1A 3AE5C 2GM4A 1RE3A 3AEEC 2RMZA 2E75C 2NPSD 2HODB 4W7ZA 3OAKA 4PJ0E 3ZDMA 2I8DA 1X79B 2K1AA 4H44B 1SQXE 3VN0A 3IFMA 1PP9G 3VP9A 1SS1A 3TGUJ 5GTIE 3MD0A 2BCCE 3WUUA 3HD7A 2AXTH 2JEEA 2ZXXA 3L72E 3AE2C 1YIJP 1L0LK 3BCCE 3V2RA 2XU6A 1FE6A 2OTKE 2A06D 1T2KC 2E76D 4UB8H 3KHUA 3B5NB 2W8ZA 3USSA 2E42A 2BCCG 2M8RA 3CXHI 3B5ND 2GUVA 1KYOH 3L72G 3M91A 3FWNA 2A45H 1M1JA 1MKMA 1KQGB 2Q9IA 4IL6X 5DN6I 3C8VA 4GOEA 4YXDC 4PV1B 1NU1D 1FJKA 3SSUA 2IPPA 3L71D 3G4SP 1RE4C 2KNCB 3AEBC 4ASUH 3KDPB 1L4AD 1YJ9P 4MN4C 3RK3C 2OGUA 2C9LY 2CK3H 1VQ4P 1DEBA 2YXQB 1SQVE 5E79E 1J2JB 4WWIA 1KV4A 1URQA 3CWBD 4DZOA 1NHLA 1NTZD 3L73E 1JOCA 2WSCJ 2JO1A 2GA1A 3U59A 1KYOD 3H1JE 5DJTB 3RL0B 1YI2P 3AE7C 1GU5A 4JYBA 3RL0D 4PJ0H 2E74C 3RK2B 5KKZC 5AVSB 3Q5RA 3EWKA 1L0LE 1SP4A 3HE4A 5TISE 3H1KE 3V4QA 3H1IE 4W7YA 5KJ7A 1P84E 1YTZT 1SQPJ 2J5UA 4LLHA 2ZT9B 1IZNB 1Q90D 3N7NA 4IFDK 1NTMD 1K73Q 1EDKA 1JCDA 1PP9D 1L0LG 4GT1A 3H1KG 3H1IG 1L4AC 4LC1A 2P2UA 1AJYA 3NTNA 1KILB 1NVOA 1M7LA 5CJ0A 3PJSK 2VRSA 3W68A 3H1LE 2B89A 2R44A 3MGNA 4L76A 5BU5A 1SQXD 3CCEP 2Q5UA 1VF5C 2QE7H 3L72D 2B87A 2GUSA 3I5CA 3BCCD 1YITP 5KTBA 2MKVA 2YO2A 2YIUC 1CZQA 3C1LA 2RKLA 3HTKA 3HE5B 5APWA 5AW6B 2KIKA 1NYHA 5AVXB 2FYUJ 2LXCB 1RQVA 2H89C 2KS1A 3OE7H 1SQPK 1FZCC 2IYPA 2OYOA 5APTA 3Q5SA 1JNMA 2JP3A 1MFTA 2QJPC 1DD4A 4C7NA 1OW8A 1M57D 1IFIA 4UB6E 1YBKA 3CC7P 2OARA 1FBMA 5TISH 3HD7B 1QGKB 2V7QJ 2HG5D 1ZR2A 3HD7D 1SQVD 2IBZE 5KAFE 2MJZA 4H0LD 5KLVD 1SQQK 1JY3N 5B66E 5APVA 3CD6P 1TU3F 3K5BA 5CJ4A 5AVZB 3L73D 2WT7A 4EIJA 1AFOA 4IFFA 3H1JD 4JF7A 5AW9B 1OVRA 5AW4B 2NPSA 2IBZG 1M1JB 1FU1A 3BRVB 3V2NA 5CBOA 4OGQD 2IYOA 5AW1B 2Y0CA 3V5BA 3R2PA 2KLUA 3A0BH 2FYUK 5GTHE 4CPGA 1L0LD 5BVZA 1ZN5A 3H1KD 1X22A 1VQ7P 4XE5B 2CPSA 1P84D 3RBXA 2KLVA 2FXMA 1FZFA 2KZJA 1RQUA 1QEXA 4I6MC 4D6TJ 3IR9A 1NOHA 3MUDA 1SQPE 1LTIC 1SFCD 1URQB 2HR3A 5APYA 1RY3A 1URQD 2LXBA 1BDCA 1R5LA 2KSEA 1OX3A 3RK3E 1ZXGA 3FGAD 2H7HA 2LR2A 3E7KA 4ZKUA 3H1LD 1KFMA 1QX8A 1J1DB 1SQPG 3NMDA 3E1RA 4UB6H 4DJGA 3IAOA 2K88A 2WMMA 1L4AA 5KLIB 3HE4B 1SQQE 4ZMDA 1LT9C 1N2DC 1FZEA 4DT0A 1LP1A 2D2CB 5KAFH 1KQSO 3Q1MA 1Y8AA 5B66H 3PRJA 3CCRP 1N7SD 4OGQC 4HH2A 4C7RA 3CXHE 3B71A 2H8PD 3AEDC 3V2QA 4N6JA 2DW3A 3S9OA 2FYUE 1X0TA 1JM0A 2WWWA 2O01H 4Z1MH 3KPEA 3M0DC 1FZCA 2E75B 2WSEJ 2B87B 2YMYA 1Q2NA 2IBZD 2FYUG 3CLQA 1BE3D 2WITA 1N73C 3VMAA 3M0AA 1USDA 3AEAC 3VYIA 1GL2C 3HTKB 2ZJSE 5AVVB 2BASA 2KS1B 2M3BA 1MV8A 1K9MQ 4A7PA 3P8MC 3FWLA 3O8ZA 1VQ8P 1YTZI 1GU4A 1BCCD 2WSFH 3H6PA 1BGYE 1JUNA 1NTKK 3MZWB 3L75J 1PPJE 1JTHA 2K9JA 4ZKPA 2SPZA 1HJBA 3VTPC 3L74J 1RF0C 3M9BA 1T8ZA 2O1KA 1KD1Q 1SQPD 5BU8B 2FBWC 1PPJG 2XDJA 3JCUE 2BEZF 1OXZA 1DEEG 2QEXP 1XTCC 3T97A 2WT7B 2OYHC 3CXHH 3CCUP 1LNQA 4QMAA 3RK3D 1PGPA 3M9QA 3F5HA 4GODA 2NPSB 1KB9I 1LTAC 1GZLA 1Q86Q 4AYCA 1QVGO 2RH0A 3GG2A 1LTJA 4D6TG 5CCHC 1LTSC 3WMM0 2FXPA 1SQQD 1QL1A 4I7ZB 2H43A 2ZVNB 2M0BA 4Y99B 2I1KA 3WUTA 3OFNH 3F89A 2E74B 3MP7B 4EI2A 1VQMP 2V7QH 5KKZB 2P67A 2E74D 3GMAA 3GF7A 1IO4A 1FDOA 1EQ7A 2E76B 2OTLP 2QJYC 3V2PA 1DD3A 1JCCA 2QA4P 1FDMA 3CXHD 4WB4A 2R5BA 1K04A 1NTKE 2IZ0A 1NO4A 2POHA 1SQBJ 1USEA 2NZ2A 3L36A 3TSIA 5H2FH 1N86A 4YPCA 1L4AB 4ASWA 3LW5H 1NTKG 3L70J 5AVUB 1EZVG 1KZUB 3N4XA 1LP1B 3HUSA 4KHXA 4IFMA 1KQFB 1OIPA 2WPRA 3I56P 1SFCA 3SWYA 4RKUJ 1RF1A 5AVTB 3B8EB 1VF5B 2R3CA 2XV5A 1VF5D 1L0NJ 3BATA 1PZQA 4KJMA 3TNUB 3CCLP 1YQ4C 3CMEP 1N73A 2C9NY 3VP8A 2YIUB 1BGYD 1ZV8A 5CMZA 1PPJD 2YKOA 3P7KA 1HGZA 3O6QA 4H44C 2N9BA 3I55P 1GMJA 5CCGC 1FZCB 5GTIH 3H32A 3PHLA 2IFNA 3D70A 2A45I 1HGVA 1SQBK 2QJPB 3PTZA 1K05A 2LKMA 1N7SA 3QWOC 2PGDA 1LWUC 1KMIZ 4TLFA 3ABVC 1CW5A 3L74E 3L75G 5C39A 4IOIH 4BWNA 2WPVB 2JJLA 1S3JA 2NRGA 3CX5I 1NGMB 1JEKA 4K35A 1NH4A 3GW6A 3L74G 1SLQA 1EC5A 4YTPC 2YKPA 1JTHB 3GHGC 1OVUA 2K9JB 1M1KQ 2ZYDA 2BCCD 4DOJA 5E79H 1SVFA 3TGUE 3VMYA 1FDIA 1MZ9A 4Y28J 5CCHA 1R5SA 3T97B 1R8EA 1KFNA 5AW7B 2K3RA 2KK7A 2OYIC 1NTKD 1GW4A 2AEFA 1S5LE 1E79H 2HLDH 2PAJA 3FXEA 3WU2E 1EZVI 3TGUG 2HFED 1WRGA 5AW3B 1ZP0C 2JR8A 2N1TD 1K8AQ 1FOSF 3RK2C 1IFJA 1LTJB 1SQBE 4WY4D 3VMZA 4XFJA 1IFMA 4L73A 1NU1J 3NXSA 3L71J 1P84H 4H0LB 3D6ZA 2P1JA 3KZIE 3M06A 3UIAA 2W83C 1N7LA 3LIDA 2FYZA 1RE4A 4BRYA 3AE9C 1PV3A 1SQBG 2KP8A 3A5TA 2B88A 4C46A 2ZVOB 3CWBJ 1VQOP 4EYYQ 1W2EA 4U3FJ 2W27A 1NTZJ 4U7JA 4OGQB 1KILC 2IFMA 3D6YA 4JYCA 1FAVA 4NPEA 5M1BA 1Q7YQ 2QSIA 2L91A 3H1ID 3BASA 4PD4I 3TF5A 1T3JA 3HUSB 3W67A 1L0NG 1HF9A 1ZOYC 3KXDA 1PFIA 1SFCB 2M3EA 4O9BA 2WQYC 1RF1B 2N1TC 1BDDA 1PGJA 5CCGA 1HTLC 1KTMA 1LT1A 3L74D 3OJAB 1FZGA 1HUCA 3LIEA 2FYNC 1OW6A 4WY4C 4RJTA 4YXWH 1S5LH 5B5EE 1QLED 1KB9E 1N73B 1NTMJ 2WPQA 2FKWB 1LWUA 1VPCA 1EXIA 3M9HA 3RL0g 1U57A 3KQGA 4I1LA 5L8RJ 1X8YA 3WUVA 1S2EA 3MIWA 1GL2D 2AEJA 2IDBA 2O3JA 3O6QB 1VQKP 4H13C 1Y47A 3H32B 2HPCA 3CCMP 3FXDA 2I1JA 5KAIE 3P32A 2P10A 1SQXJ 1NTZK 3KZIH 3RGUA 2ZYAA 3TGUD 1N7SB 1PGOA 2RQ7A 3QH9A 1BSHA 3H25A 3Q2YA 3GHGA 3CPWO 3BCCJ 1J1EC 1OWAA 4DCKA 2ZXEB 2QVAA 4HKZH 4ZNCA 1KC8Q 2KOGA 1MFZA 4HYTB 1G1IA 3G71P 1M1JC 5AVWB 2WSCH 3V6IA 3AECC 3AE1C 2E5YA 3CCVP 1KQLA 4RESB 2OYIA 1T6AA 5GTHH 1AVYA 1VDFA 3A0HE 4RO0A 3Q3DA 1U7MA 2YKQA 2ITAA 5AW5B 3AE4C 4JQ0D 1H8AA 4K3AA 3L71E 4EOTA 1SQVJ 5CCHD 1A02J 5KLVJ 1DH3A 2AXTE 2N9YB 3G3ZA 1BSNA 5B5EH 5CHXA 2FXOA 3P8CE 2ZYGA 3L73J 1NU1G 1EDLA 2QJYB 3L71G 2J58A 3H1JJ 1AQTA 2QIWA 4U3FE 3MHVA 4C7NB 1NTZE 3GF3A 1JMBA 1JY2P 3RBZA 2FFDC 4NPDA 1KYOE 2XOKH 5KAIH 1W5CE 2FY8A 2PP6A 5KJ7C 1N8RQ 3Q5PA 2KI7B 5AVYB 1GD2E 1IK7A 3OA7A 4BRYB 4U3FG 1NTZG 4R4MA 1VQ5P 4N3YB 4D6TE 3SWKA 3RK3B 1VQNP 3JC22 5AVRB 1PL5A 1EDIA 1OZHA 1S5LX 2A45G 1KB9D 1IC2A 1VQLP 2K9YA 1LTBC 1X9VA 2R5DA 3FKSH 1HJ0A 3CX5E 1VQPP 1NAFA 2N1TA 3D71A 2Q7CA 1FS0E 2R3SA 3PP5A 3HE5A 4AUWA 5DJUB 3OEHH 2XNXA 5KLVK 4WY4A 1PGQA 3PLNA 2KUBA 3H1LJ 1H88A 5CBNA 1KILE 1H0TA 2JWDA 3AEFC 2Q1KA 1NTMG 2QM8A 3CCJP 2WVRA 4H44D 2QM7A 1KN7A 5CCGD 1LT9A 4GIFA 1EZVE 1YQ3C 1LWUB 1NKZB 4KT0J 1MUUA 2FYUD 4HJGH 3OAAH 1CI6A 2Z5IA 2CPBA 1SQXG 1ZRTE 2W6AA 1M8OB 2JKVA 1LTTC 4EDFA 3G9RA 1AVOA 2HPCB 1FOSE 2Q3IA 2QJKC 1XTGB 2YNYA 3TDKA 1WMKA 1GTWA 3BCCG 3H1HJ 2XZRA 3VOPA 4PV1D 3BRTB 4XA4A 1L2PA 3GHGB 1S1CX 2Z4EA 3JCUH 1BE3J 3M0DA 4BXLA 3G6EP 3EQ2A 3C9IA 4R4LA 1QL2A 1VQ6P 4L74A 1AQ5A 2YMKA 1JB0J 1OVVA 3NFQA 3P8CD 2NPSC 5KLVE 3CX5H 1JY2O 4OWFA 3CCQP 1GL2A 1GDTA 4U3FD 2O01N 2OYIB 1BCCJ 3TYYA 1JO5A 2WTYA 1E5WA 1IJDB 4I7ZC 2E43A 4PD4E 1SQVG 3L75E 2O01J 1KYOI 4TT3H 4Y99C 5KLVG 2HYNA 1Z56A 1JMMA 3L4FA 4AQRD 4I2LC 3RK2D 3MUDC 4JBZA 2M5AA 3L73G 5APQA 1S72P 1IFNA 1YHQP 2E76C 2FFDA 1M56D 2B9BA 1DIPA 4GKGA 4D6TD 4L75A 2WZ7A 3H1JG 3B5NC 3GLMA 2WSSH 1CSBA 3IN6A 1RF0A 3CX5D 2ZT9D 2JWAA 2AXCA 4PV1C 4JPZB 2OYHA 2WSFJ 3FX0A 1L0NK 2J59M 3ITKA 1KILD 1G2CA 1UIIA 1SQQJ 1M90Q 2G8YA 2WSEH 2Y0EA 3SWFA 1LTGC 3A0BE 1WT6A 4WVZA 3U1AA 2XKMA 2IZ1A 2UWJE 1FZAA 1EZVD 1ZMEC 3TK1A 3H1LG 3RL0C 3A7OA 1Q82Q 2N1TB 3SFEC 4W80A 3R4YA 3EFGA 1ZRTD 2Z5HA 2FYNB 2OTJP 2KZIA 4WY4B 1Q81Q 3KYQA 3CC4P 4PD4H 2Y0DA 3EFFK 2ZAEB 1DX7A 1H0TB 1JY3P 2KB7P 3A2AA 2Y9YA 3PH0A 3L70E 2ZT9C 1ZR4A 3H1HE 4H13B 4H13D 1LT9B 4NPFX 2R32A 1A02F 1VL2A 2P7JA 2Y9ZA 2L5GB 3B4SA 3AE8C 1YYCA 3CI9A 1BE3E 2K37A 1IFPA 3JSVC 1H89A 1CI6B 3L70G 1L0NE 2C0XA 3H1HG 1FZBA 1J1EB 4B86A 1NJIQ 1BGYJ 4PD4D 5EFWB 3L75D 1BE3G 5AVQB 1BCCE 2Q3EA 2AEMA 2HODA 3AEGC 4IL6E 4N78E 3LW5J 1RH5B 1S9KE 1H8EH 1G1JA 4GDOA 1NU1K 1VQ9P 1BCCG 1RE3C 1ZLLA 1P84I 4M3LA 1ZW0A 2RN0A 2IX7C 3WU2H 1PP9J 1FC2C 3SFDC 2OQQA 1GL2B 5AW8B 1NWQA 3S1KA 1T3UA 1LTJC 3B5NA 1QVFO 2KYVA 3HD7C 1GK6A 4OH8B 3U1CA 3VMXA 4H0LC 3AE3C 2H88C 2BCCJ 2M5AB 3L72J 2KNCA 2FFDB 5TJHA 2QRXA 2YXRB 3II6A 1UIXA 2Q6QA 5K5GB 5KJ7D 2W6BA 1LJ2A 2D2CD 2HLOA 3MTUE 5AW0B 1OW7A 1FJPA 1NTKJ 2BEQD 2A06E 2OYHB 1SQQG 2KSJA 5FL7H 1SQBD 1JY3O 3CC2P 3TNUA 1GW3A 1NTMK 1GK4A 4IL6H 3HUSC 1G2CB 3IF4A 3L70D 1IFDA 1NU1E 1SFCC 1IK9A 2A06G 1AV1A 3H1HD 1RF1C 2PFXA 1URQC 2O1JA 1W2BO 1RHZB 1PIXA 3S4RA 2YO3A 5APUA 2E75D 3OW2O 1SQXK 1KB9H 3A3YB 1HBWA 2IBZI 3BVHA 5AW2B 2W90A 1L0ND 5APSA 4GOFA 2E5TA 3CWBE 3L35A 1J1DC 2V4HA 3CCSP 2G3AA 1EXJA 4UB8E 2JDIH 5APXA 1NKNA 5KLIC 1U7JA 1NAYA 1KILA 1Y9BA 2QG4A 4N78D 3CMAP 2D2CC 3CL3D 1L0LJ 4LGDE 1N7SC 2XNDH 3H1KJ 3H1IJ 1S9KD 5H2FE 2WPSA 1LGHB 1T2KD 3CWBG 4WBAA
chains in the Genus database with same CATH topology
3OFNH 2W6JH 1FS0E 2JDIH 1JEKA 3EFFK 1BSNA 2V7QH 2CK3H 2RQ6A 3OAAH 2RQ7A 1H8EH 3OEHH 2XOKH 5DN6I 4WVZA 4DJGA 1BSHA 1IFPA 4YXWH 2E5YA 4QMAA 2WSSH 3USSA 5FL7H 2XNDH 2E5TA 2QE7H 4ASUH 1AQTA 3FKSH 4TLFA 3OE7H 1E79H 2HLDH 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OFN H;  2W6J H;  1FS0 E;  2JDI H;  1JEK A;  3EFF K;  1BSN A;  2V7Q H;  2CK3 H;  2RQ6 A;  3OAA H;  2RQ7 A;  1H8E H;  3OEH H;  2XOK H;  5DN6 I;  4WVZ A;  4DJG A;  1BSH A;  1IFP A;  4YXW H;  2E5Y A;  4QMA A;  2WSS H;  3USS A;  5FL7 H;  2XND H;  2E5T A;  2QE7 H;  4ASU H;  1AQT A;  3FKS H;  4TLF A;  3OE7 H;  1E79 H;  2HLD H;  3PJS K; 
#chains in the Genus database with same CATH topology
 1AA0 A;  2QJK B;  4ASV A;  1JY2 N;  1HH0 A;  2C0W A;  3AE6 C;  1YJN P;  3V4W A;  1S4X A;  1D7M A;  4OVN F;  1EDJ A;  1BGY G;  2ZFC A;  3E1I A;  2P58 A;  2W6J H;  1NTM E;  1SQV K;  2RQ6 A;  1KOR A;  1OMI A;  1PP9 E;  1YJW P;  3HRN A;  3L37 A;  2PRR A;  1HWT C;  1OFC X;  3A0H H;  1HVV A;  2KXP B;  4HB1 A;  3AE5 C;  2GM4 A;  1RE3 A;  3AEE C;  2RMZ A;  2E75 C;  2NPS D;  2HOD B;  4W7Z A;  3OAK A;  4PJ0 E;  3ZDM A;  2I8D A;  1X79 B;  2K1A A;  4H44 B;  1SQX E;  3VN0 A;  3IFM A;  1PP9 G;  3VP9 A;  1SS1 A;  3TGU J;  5GTI E;  3MD0 A;  2BCC E;  3WUU A;  3HD7 A;  2AXT H;  2JEE A;  2ZXX A;  3L72 E;  3AE2 C;  1YIJ P;  1L0L K;  3BCC E;  3V2R A;  2XU6 A;  1FE6 A;  2OTK E;  2A06 D;  1T2K C;  2E76 D;  4UB8 H;  3KHU A;  3B5N B;  2W8Z A;  3USS A;  2E42 A;  2BCC G;  2M8R A;  3CXH I;  3B5N D;  2GUV A;  1KYO H;  3L72 G;  3M91 A;  3FWN A;  2A45 H;  1M1J A;  1MKM A;  1KQG B;  2Q9I A;  4IL6 X;  5DN6 I;  3C8V A;  4GOE A;  4YXD C;  4PV1 B;  1NU1 D;  1FJK A;  3SSU A;  2IPP A;  3L71 D;  3G4S P;  1RE4 C;  2KNC B;  3AEB C;  4ASU H;  3KDP B;  1L4A D;  1YJ9 P;  4MN4 C;  3RK3 C;  2OGU A;  2C9L Y;  2CK3 H;  1VQ4 P;  1DEB A;  2YXQ B;  1SQV E;  5E79 E;  1J2J B;  4WWI A;  1KV4 A;  1URQ A;  3CWB D;  4DZO A;  1NHL A;  1NTZ D;  3L73 E;  1JOC A;  2WSC J;  2JO1 A;  2GA1 A;  3U59 A;  1KYO D;  3H1J E;  5DJT B;  3RL0 B;  1YI2 P;  3AE7 C;  1GU5 A;  4JYB A;  3RL0 D;  4PJ0 H;  2E74 C;  3RK2 B;  5KKZ C;  5AVS B;  3Q5R A;  3EWK A;  1L0L E;  1SP4 A;  3HE4 A;  5TIS E;  3H1K E;  3V4Q A;  3H1I E;  4W7Y A;  5KJ7 A;  1P84 E;  1YTZ T;  1SQP J;  2J5U A;  4LLH A;  2ZT9 B;  1IZN B;  1Q90 D;  3N7N A;  4IFD K;  1NTM D;  1K73 Q;  1EDK A;  1JCD A;  1PP9 D;  1L0L G;  4GT1 A;  3H1K G;  3H1I G;  1L4A C;  4LC1 A;  2P2U A;  1AJY A;  3NTN A;  1KIL B;  1NVO A;  1M7L A;  5CJ0 A;  3PJS K;  2VRS A;  3W68 A;  3H1L E;  2B89 A;  2R44 A;  3MGN A;  4L76 A;  5BU5 A;  1SQX D;  3CCE P;  2Q5U A;  1VF5 C;  2QE7 H;  3L72 D;  2B87 A;  2GUS A;  3I5C A;  3BCC D;  1YIT P;  5KTB A;  2MKV A;  2YO2 A;  2YIU C;  1CZQ A;  3C1L A;  2RKL A;  3HTK A;  3HE5 B;  5APW A;  5AW6 B;  2KIK A;  1NYH A;  5AVX B;  2FYU J;  2LXC B;  1RQV A;  2H89 C;  2KS1 A;  3OE7 H;  1SQP K;  1FZC C;  2IYP A;  2OYO A;  5APT A;  3Q5S A;  1JNM A;  2JP3 A;  1MFT A;  2QJP C;  1DD4 A;  4C7N A;  1OW8 A;  1M57 D;  1IFI A;  4UB6 E;  1YBK A;  3CC7 P;  2OAR A;  1FBM A;  5TIS H;  3HD7 B;  1QGK B;  2V7Q J;  2HG5 D;  1ZR2 A;  3HD7 D;  1SQV D;  2IBZ E;  5KAF E;  2MJZ A;  4H0L D;  5KLV D;  1SQQ K;  1JY3 N;  5B66 E;  5APV A;  3CD6 P;  1TU3 F;  3K5B A;  5CJ4 A;  5AVZ B;  3L73 D;  2WT7 A;  4EIJ A;  1AFO A;  4IFF A;  3H1J D;  4JF7 A;  5AW9 B;  1OVR A;  5AW4 B;  2NPS A;  2IBZ G;  1M1J B;  1FU1 A;  3BRV B;  3V2N A;  5CBO A;  4OGQ D;  2IYO A;  5AW1 B;  2Y0C A;  3V5B A;  3R2P A;  2KLU A;  3A0B H;  2FYU K;  5GTH E;  4CPG A;  1L0L D;  5BVZ A;  1ZN5 A;  3H1K D;  1X22 A;  1VQ7 P;  4XE5 B;  2CPS A;  1P84 D;  3RBX A;  2KLV A;  2FXM A;  1FZF A;  2KZJ A;  1RQU A;  1QEX A;  4I6M C;  4D6T J;  3IR9 A;  1NOH A;  3MUD A;  1SQP E;  1LTI C;  1SFC D;  1URQ B;  2HR3 A;  5APY A;  1RY3 A;  1URQ D;  2LXB A;  1BDC A;  1R5L A;  2KSE A;  1OX3 A;  3RK3 E;  1ZXG A;  3FGA D;  2H7H A;  2LR2 A;  3E7K A;  4ZKU A;  3H1L D;  1KFM A;  1QX8 A;  1J1D B;  1SQP G;  3NMD A;  3E1R A;  4UB6 H;  4DJG A;  3IAO A;  2K88 A;  2WMM A;  1L4A A;  5KLI B;  3HE4 B;  1SQQ E;  4ZMD A;  1LT9 C;  1N2D C;  1FZE A;  4DT0 A;  1LP1 A;  2D2C B;  5KAF H;  1KQS O;  3Q1M A;  1Y8A A;  5B66 H;  3PRJ A;  3CCR P;  1N7S D;  4OGQ C;  4HH2 A;  4C7R A;  3CXH E;  3B71 A;  2H8P D;  3AED C;  3V2Q A;  4N6J A;  2DW3 A;  3S9O A;  2FYU E;  1X0T A;  1JM0 A;  2WWW A;  2O01 H;  4Z1M H;  3KPE A;  3M0D C;  1FZC A;  2E75 B;  2WSE J;  2B87 B;  2YMY A;  1Q2N A;  2IBZ D;  2FYU G;  3CLQ A;  1BE3 D;  2WIT A;  1N73 C;  3VMA A;  3M0A A;  1USD A;  3AEA C;  3VYI A;  1GL2 C;  3HTK B;  2ZJS E;  5AVV B;  2BAS A;  2KS1 B;  2M3B A;  1MV8 A;  1K9M Q;  4A7P A;  3P8M C;  3FWL A;  3O8Z A;  1VQ8 P;  1YTZ I;  1GU4 A;  1BCC D;  2WSF H;  3H6P A;  1BGY E;  1JUN A;  1NTK K;  3MZW B;  3L75 J;  1PPJ E;  1JTH A;  2K9J A;  4ZKP A;  2SPZ A;  1HJB A;  3VTP C;  3L74 J;  1RF0 C;  3M9B A;  1T8Z A;  2O1K A;  1KD1 Q;  1SQP D;  5BU8 B;  2FBW C;  1PPJ G;  2XDJ A;  3JCU E;  2BEZ F;  1OXZ A;  1DEE G;  2QEX P;  1XTC C;  3T97 A;  2WT7 B;  2OYH C;  3CXH H;  3CCU P;  1LNQ A;  4QMA A;  3RK3 D;  1PGP A;  3M9Q A;  3F5H A;  4GOD A;  2NPS B;  1KB9 I;  1LTA C;  1GZL A;  1Q86 Q;  4AYC A;  1QVG O;  2RH0 A;  3GG2 A;  1LTJ A;  4D6T G;  5CCH C;  1LTS C;  3WMM 0;  2FXP A;  1SQQ D;  1QL1 A;  4I7Z B;  2H43 A;  2ZVN B;  2M0B A;  4Y99 B;  2I1K A;  3WUT A;  3OFN H;  3F89 A;  2E74 B;  3MP7 B;  4EI2 A;  1VQM P;  2V7Q H;  5KKZ B;  2P67 A;  2E74 D;  3GMA A;  3GF7 A;  1IO4 A;  1FDO A;  1EQ7 A;  2E76 B;  2OTL P;  2QJY C;  3V2P A;  1DD3 A;  1JCC A;  2QA4 P;  1FDM A;  3CXH D;  4WB4 A;  2R5B A;  1K04 A;  1NTK E;  2IZ0 A;  1NO4 A;  2POH A;  1SQB J;  1USE A;  2NZ2 A;  3L36 A;  3TSI A;  5H2F H;  1N86 A;  4YPC A;  1L4A B;  4ASW A;  3LW5 H;  1NTK G;  3L70 J;  5AVU B;  1EZV G;  1KZU B;  3N4X A;  1LP1 B;  3HUS A;  4KHX A;  4IFM A;  1KQF B;  1OIP A;  2WPR A;  3I56 P;  1SFC A;  3SWY A;  4RKU J;  1RF1 A;  5AVT B;  3B8E B;  1VF5 B;  2R3C A;  2XV5 A;  1VF5 D;  1L0N J;  3BAT A;  1PZQ A;  4KJM A;  3TNU B;  3CCL P;  1YQ4 C;  3CME P;  1N73 A;  2C9N Y;  3VP8 A;  2YIU B;  1BGY D;  1ZV8 A;  5CMZ A;  1PPJ D;  2YKO A;  3P7K A;  1HGZ A;  3O6Q A;  4H44 C;  2N9B A;  3I55 P;  1GMJ A;  5CCG C;  1FZC B;  5GTI H;  3H32 A;  3PHL A;  2IFN A;  3D70 A;  2A45 I;  1HGV A;  1SQB K;  2QJP B;  3PTZ A;  1K05 A;  2LKM A;  1N7S A;  3QWO C;  2PGD A;  1LWU C;  1KMI Z;  4TLF A;  3ABV C;  1CW5 A;  3L74 E;  3L75 G;  5C39 A;  4IOI H;  4BWN A;  2WPV B;  2JJL A;  1S3J A;  2NRG A;  3CX5 I;  1NGM B;  1JEK A;  4K35 A;  1NH4 A;  3GW6 A;  3L74 G;  1SLQ A;  1EC5 A;  4YTP C;  2YKP A;  1JTH B;  3GHG C;  1OVU A;  2K9J B;  1M1K Q;  2ZYD A;  2BCC D;  4DOJ A;  5E79 H;  1SVF A;  3TGU E;  3VMY A;  1FDI A;  1MZ9 A;  4Y28 J;  5CCH A;  1R5S A;  3T97 B;  1R8E A;  1KFN A;  5AW7 B;  2K3R A;  2KK7 A;  2OYI C;  1NTK D;  1GW4 A;  2AEF A;  1S5L E;  1E79 H;  2HLD H;  2PAJ A;  3FXE A;  3WU2 E;  1EZV I;  3TGU G;  2HFE D;  1WRG A;  5AW3 B;  1ZP0 C;  2JR8 A;  2N1T D;  1K8A Q;  1FOS F;  3RK2 C;  1IFJ A;  1LTJ B;  1SQB E;  4WY4 D;  3VMZ A;  4XFJ A;  1IFM A;  4L73 A;  1NU1 J;  3NXS A;  3L71 J;  1P84 H;  4H0L B;  3D6Z A;  2P1J A;  3KZI E;  3M06 A;  3UIA A;  2W83 C;  1N7L A;  3LID A;  2FYZ A;  1RE4 A;  4BRY A;  3AE9 C;  1PV3 A;  1SQB G;  2KP8 A;  3A5T A;  2B88 A;  4C46 A;  2ZVO B;  3CWB J;  1VQO P;  4EYY Q;  1W2E A;  4U3F J;  2W27 A;  1NTZ J;  4U7J A;  4OGQ B;  1KIL C;  2IFM A;  3D6Y A;  4JYC A;  1FAV A;  4NPE A;  5M1B A;  1Q7Y Q;  2QSI A;  2L91 A;  3H1I D;  3BAS A;  4PD4 I;  3TF5 A;  1T3J A;  3HUS B;  3W67 A;  1L0N G;  1HF9 A;  1ZOY C;  3KXD A;  1PFI A;  1SFC B;  2M3E A;  4O9B A;  2WQY C;  1RF1 B;  2N1T C;  1BDD A;  1PGJ A;  5CCG A;  1HTL C;  1KTM A;  1LT1 A;  3L74 D;  3OJA B;  1FZG A;  1HUC A;  3LIE A;  2FYN C;  1OW6 A;  4WY4 C;  4RJT A;  4YXW H;  1S5L H;  5B5E E;  1QLE D;  1KB9 E;  1N73 B;  1NTM J;  2WPQ A;  2FKW B;  1LWU A;  1VPC A;  1EXI A;  3M9H A;  3RL0 g;  1U57 A;  3KQG A;  4I1L A;  5L8R J;  1X8Y A;  3WUV A;  1S2E A;  3MIW A;  1GL2 D;  2AEJ A;  2IDB A;  2O3J A;  3O6Q B;  1VQK P;  4H13 C;  1Y47 A;  3H32 B;  2HPC A;  3CCM P;  3FXD A;  2I1J A;  5KAI E;  3P32 A;  2P10 A;  1SQX J;  1NTZ K;  3KZI H;  3RGU A;  2ZYA A;  3TGU D;  1N7S B;  1PGO A;  2RQ7 A;  3QH9 A;  1BSH A;  3H25 A;  3Q2Y A;  3GHG A;  3CPW O;  3BCC J;  1J1E C;  1OWA A;  4DCK A;  2ZXE B;  2QVA A;  4HKZ H;  4ZNC A;  1KC8 Q;  2KOG A;  1MFZ A;  4HYT B;  1G1I A;  3G71 P;  1M1J C;  5AVW B;  2WSC H;  3V6I A;  3AEC C;  3AE1 C;  2E5Y A;  3CCV P;  1KQL A;  4RES B;  2OYI A;  1T6A A;  5GTH H;  1AVY A;  1VDF A;  3A0H E;  4RO0 A;  3Q3D A;  1U7M A;  2YKQ A;  2ITA A;  5AW5 B;  3AE4 C;  4JQ0 D;  1H8A A;  4K3A A;  3L71 E;  4EOT A;  1SQV J;  5CCH D;  1A02 J;  5KLV J;  1DH3 A;  2AXT E;  2N9Y B;  3G3Z A;  1BSN A;  5B5E H;  5CHX A;  2FXO A;  3P8C E;  2ZYG A;  3L73 J;  1NU1 G;  1EDL A;  2QJY B;  3L71 G;  2J58 A;  3H1J J;  1AQT A;  2QIW A;  4U3F E;  3MHV A;  4C7N B;  1NTZ E;  3GF3 A;  1JMB A;  1JY2 P;  3RBZ A;  2FFD C;  4NPD A;  1KYO E;  2XOK H;  5KAI H;  1W5C E;  2FY8 A;  2PP6 A;  5KJ7 C;  1N8R Q;  3Q5P A;  2KI7 B;  5AVY B;  1GD2 E;  1IK7 A;  3OA7 A;  4BRY B;  4U3F G;  1NTZ G;  4R4M A;  1VQ5 P;  4N3Y B;  4D6T E;  3SWK A;  3RK3 B;  1VQN P;  3JC2 2;  5AVR B;  1PL5 A;  1EDI A;  1OZH A;  1S5L X;  2A45 G;  1KB9 D;  1IC2 A;  1VQL P;  2K9Y A;  1LTB C;  1X9V A;  2R5D A;  3FKS H;  1HJ0 A;  3CX5 E;  1VQP P;  1NAF A;  2N1T A;  3D71 A;  2Q7C A;  1FS0 E;  2R3S A;  3PP5 A;  3HE5 A;  4AUW A;  5DJU B;  3OEH H;  2XNX A;  5KLV K;  4WY4 A;  1PGQ A;  3PLN A;  2KUB A;  3H1L J;  1H88 A;  5CBN A;  1KIL E;  1H0T A;  2JWD A;  3AEF C;  2Q1K A;  1NTM G;  2QM8 A;  3CCJ P;  2WVR A;  4H44 D;  2QM7 A;  1KN7 A;  5CCG D;  1LT9 A;  4GIF A;  1EZV E;  1YQ3 C;  1LWU B;  1NKZ B;  4KT0 J;  1MUU A;  2FYU D;  4HJG H;  3OAA H;  1CI6 A;  2Z5I A;  2CPB A;  1SQX G;  1ZRT E;  2W6A A;  1M8O B;  2JKV A;  1LTT C;  4EDF A;  3G9R A;  1AVO A;  2HPC B;  1FOS E;  2Q3I A;  2QJK C;  1XTG B;  2YNY A;  3TDK A;  1WMK A;  1GTW A;  3BCC G;  3H1H J;  2XZR A;  3VOP A;  4PV1 D;  3BRT B;  4XA4 A;  1L2P A;  3GHG B;  1S1C X;  2Z4E A;  3JCU H;  1BE3 J;  3M0D A;  4BXL A;  3G6E P;  3EQ2 A;  3C9I A;  4R4L A;  1QL2 A;  1VQ6 P;  4L74 A;  1AQ5 A;  2YMK A;  1JB0 J;  1OVV A;  3NFQ A;  3P8C D;  2NPS C;  5KLV E;  3CX5 H;  1JY2 O;  4OWF A;  3CCQ P;  1GL2 A;  1GDT A;  4U3F D;  2O01 N;  2OYI B;  1BCC J;  3TYY A;  1JO5 A;  2WTY A;  1E5W A;  1IJD B;  4I7Z C;  2E43 A;  4PD4 E;  1SQV G;  3L75 E;  2O01 J;  1KYO I;  4TT3 H;  4Y99 C;  5KLV G;  2HYN A;  1Z56 A;  1JMM A;  3L4F A;  4AQR D;  4I2L C;  3RK2 D;  3MUD C;  4JBZ A;  2M5A A;  3L73 G;  5APQ A;  1S72 P;  1IFN A;  1YHQ P;  2E76 C;  2FFD A;  1M56 D;  2B9B A;  1DIP A;  4GKG A;  4D6T D;  4L75 A;  2WZ7 A;  3H1J G;  3B5N C;  3GLM A;  2WSS H;  1CSB A;  3IN6 A;  1RF0 A;  3CX5 D;  2ZT9 D;  2JWA A;  2AXC A;  4PV1 C;  4JPZ B;  2OYH A;  2WSF J;  3FX0 A;  1L0N K;  2J59 M;  3ITK A;  1KIL D;  1G2C A;  1UII A;  1SQQ J;  1M90 Q;  2G8Y A;  2WSE H;  2Y0E A;  3SWF A;  1LTG C;  3A0B E;  1WT6 A;  4WVZ A;  3U1A A;  2XKM A;  2IZ1 A;  2UWJ E;  1FZA A;  1EZV D;  1ZME C;  3TK1 A;  3H1L G;  3RL0 C;  3A7O A;  1Q82 Q;  2N1T B;  3SFE C;  4W80 A;  3R4Y A;  3EFG A;  1ZRT D;  2Z5H A;  2FYN B;  2OTJ P;  2KZI A;  4WY4 B;  1Q81 Q;  3KYQ A;  3CC4 P;  4PD4 H;  2Y0D A;  3EFF K;  2ZAE B;  1DX7 A;  1H0T B;  1JY3 P;  2KB7 P;  3A2A A;  2Y9Y A;  3PH0 A;  3L70 E;  2ZT9 C;  1ZR4 A;  3H1H E;  4H13 B;  4H13 D;  1LT9 B;  4NPF X;  2R32 A;  1A02 F;  1VL2 A;  2P7J A;  2Y9Z A;  2L5G B;  3B4S A;  3AE8 C;  1YYC A;  3CI9 A;  1BE3 E;  2K37 A;  1IFP A;  3JSV C;  1H89 A;  1CI6 B;  3L70 G;  1L0N E;  2C0X A;  3H1H G;  1FZB A;  1J1E B;  4B86 A;  1NJI Q;  1BGY J;  4PD4 D;  5EFW B;  3L75 D;  1BE3 G;  5AVQ B;  1BCC E;  2Q3E A;  2AEM A;  2HOD A;  3AEG C;  4IL6 E;  4N78 E;  3LW5 J;  1RH5 B;  1S9K E;  1H8E H;  1G1J A;  4GDO A;  1NU1 K;  1VQ9 P;  1BCC G;  1RE3 C;  1ZLL A;  1P84 I;  4M3L A;  1ZW0 A;  2RN0 A;  2IX7 C;  3WU2 H;  1PP9 J;  1FC2 C;  3SFD C;  2OQQ A;  1GL2 B;  5AW8 B;  1NWQ A;  3S1K A;  1T3U A;  1LTJ C;  3B5N A;  1QVF O;  2KYV A;  3HD7 C;  1GK6 A;  4OH8 B;  3U1C A;  3VMX A;  4H0L C;  3AE3 C;  2H88 C;  2BCC J;  2M5A B;  3L72 J;  2KNC A;  2FFD B;  5TJH A;  2QRX A;  2YXR B;  3II6 A;  1UIX A;  2Q6Q A;  5K5G B;  5KJ7 D;  2W6B A;  1LJ2 A;  2D2C D;  2HLO A;  3MTU E;  5AW0 B;  1OW7 A;  1FJP A;  1NTK J;  2BEQ D;  2A06 E;  2OYH B;  1SQQ G;  2KSJ A;  5FL7 H;  1SQB D;  1JY3 O;  3CC2 P;  3TNU A;  1GW3 A;  1NTM K;  1GK4 A;  4IL6 H;  3HUS C;  1G2C B;  3IF4 A;  3L70 D;  1IFD A;  1NU1 E;  1SFC C;  1IK9 A;  2A06 G;  1AV1 A;  3H1H D;  1RF1 C;  2PFX A;  1URQ C;  2O1J A;  1W2B O;  1RHZ B;  1PIX A;  3S4R A;  2YO3 A;  5APU A;  2E75 D;  3OW2 O;  1SQX K;  1KB9 H;  3A3Y B;  1HBW A;  2IBZ I;  3BVH A;  5AW2 B;  2W90 A;  1L0N D;  5APS A;  4GOF A;  2E5T A;  3CWB E;  3L35 A;  1J1D C;  2V4H A;  3CCS P;  2G3A A;  1EXJ A;  4UB8 E;  2JDI H;  5APX A;  1NKN A;  5KLI C;  1U7J A;  1NAY A;  1KIL A;  1Y9B A;  2QG4 A;  4N78 D;  3CMA P;  2D2C C;  3CL3 D;  1L0L J;  4LGD E;  1N7S C;  2XND H;  3H1K J;  3H1I J;  1S9K D;  5H2F E;  2WPS A;  1LGH B;  1T2K D;  3CWB G;  4WBA A; 
#chains in the Genus database with same CATH homology
 3OFN H;  2W6J H;  1FS0 E;  2JDI H;  1JEK A;  3EFF K;  1BSN A;  2V7Q H;  2CK3 H;  2RQ6 A;  3OAA H;  2RQ7 A;  1H8E H;  3OEH H;  2XOK H;  5DN6 I;  4WVZ A;  4DJG A;  1BSH A;  1IFP A;  4YXW H;  2E5Y A;  4QMA A;  2WSS H;  3USS A;  5FL7 H;  2XND H;  2E5T A;  2QE7 H;  4ASU H;  1AQT A;  3FKS H;  4TLF A;  3OE7 H;  1E79 H;  2HLD H;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...