1BSHA

Solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
138
structure length
138
Chain Sequence
AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (EPSILON SUBUNIT)
publication title Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 138
sequence length 138
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1998-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1bshA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1bshA01
2WSSH 4DJGA 4YXWH 1FS0E 3EFFK 3FKSH 5FL7H 1H8EH 4ASUH 2E5YA 2XNDH 2CK3H 1E79H 2HLDH 1JEKA 3OFNH 4WVZA 4QMAA 2W6JH 3OE7H 3OAAH 3USSA 2JDIH 2RQ7A 1BSNA 3PJSK 1AQTA 1IFPA 3OEHH 2XOKH 4TLFA 5DN6I 2QE7H 2V7QH 2RQ6A 2E5TA 1BSHA
chains in the Genus database with same CATH superfamily
1KQLA 1GZLA 4WY4A 3H1JD 3RK3E 2E76B 2XNDH 1NJIQ 1X22A 4H44D 1YTZT 3L75D 1CZQA 3CX5H 2W90A 3B5NC 3AE7C 3H1JG 3JC22 3PJSK 4OGQB 2E42A 5KLVD 2LR2A 1FDOA 4GODA 3CC4P 5CBOA 3G9RA 3H1LJ 3QH9A 4PJ0H 2W6JH 1L4AB 3SWKA 5KLVG 1L0ND 4TT3H 2O1KA 1KQSO 3H1JJ 1ZLLA 1YHQP 3OEHH 2YO2A 4W7ZA 2RQ6A 3L75J 2WTYA 4Y99C 2IDBA 4D6TG 4ZKPA 2Q6QA 2YIUC 1LGHB 3CI9A 3AEDC 1VQLP 1JTHB 2KYVA 5KLVJ 1BE3D 1S3JA 5B66H 3V2PA 3H6PA 5AW8B 1NTZE 1XTCC 2IZ1A 5APXA 1DEBA 1L0NJ 1BE3G 1OVUA 3NFQA 2QEXP 1NWQA 2RMZA 2KS1A 2WPSA 4PV1B 2QM8A 1PV3A 1H0TB 5APWA 1IJDB 3WU2H 1X9VA 1NKZB 2AEMA 5H2FH 2ITAA 3L72D 1IC2A 1FU1A 2WSEJ 3CCQP 1NTMG 1NYHA 1BE3J 3SWYA 1CI6B 1GK4A 3L72G 1VQ5P 1LWUA 3AE6C 2J59M 1DIPA 1VDFA 4AYCA 2WMMA 2E74C 3P8MC 1EXIA 1FJPA 2HLOA 3CMEP 1YIJP 2FYUE 3D71A 1URQC 2Z5HA 4HJGH 4C7RA 1DEEG 3L72J 1JCCA 3BCCD 3H1KD 1M56D 3CXHI 2KI7B 1LTJC 1FZEA 3H1HE 1LT9C 1GDTA 3A0HE 1N7LA 3O6QB 1JB0J 3BCCG 3H1KG 2QSIA 4RJTA 1VQMP 4NPEA 3A0BE 1RHZB 4XA4A 2IBZE 5TJHA 1LTIC 1FZCB 2H89C 3UIAA 4IL6X 3CCLP 2XDJA 1OW7A 1PGQA 3BCCJ 3H1KJ 2BASA 1SQPD 4XFJA 2YO3A 3CXHD 4OVNF 1DH3A 1M90Q 1L0LK 1KFMA 3WUUA 3M91A 3L36A 2E76D 1FDMA 1KYOI 2IX7C 1S1CX 1R5SA 1URQA 3HE5B 2RH0A 1JM0A 1NOHA 3CCSP 1K73Q 1VQOP 1BGYE 2SPZA 3LIDA 1SQPJ 1BCCE 1NO4A 1LT9A 1QLED 2JEEA 2HPCB 3HD7C 3RL0B 1L4AD 1S72P 1NU1D 2HR3A 1FAVA 1SQQD 1IK9A 2A45I 2WT7B 3FXDA 2N1TB 2WWWA 4CPGA 1KYOD 1JCDA 1JY2O 1SQBG 5KAFE 2QJPB 4UB8E 4I1LA 4GIFA 5CJ4A 1RE3C 1OX3A 3MD0A 3RK2C 4K35A 2E75C 3CC7P 2P10A 2E43A 3U1CA 1M1JB 4LLHA 3MUDA 4L73A 1NU1J 3L70J 1SQQJ 2R5DA 5E79E 1FJKA 1L4AA 1EDLA 4BXLA 3H25A 3AEAC 5DN6I 4PV1D 1HUCA 3B4SA 3G6EP 1VQ6P 1NH4A 4JF7A 5BU8B 1GL2C 1JTHA 1PP9D 3FWNA 3E1IA 5KJ7D 4JQ0D 1NTKE 1QL2A 2C0WA 1YITP 2WITA 3RBZA 1PZQA 3CWBE 2J58A 1M1KQ 3CX5E 4KT0J 4BRYB 2AXTH 4U3FG 2Z5IA 1FZGA 1FC2C 1RE3A 4RESB 1H0TA 2B87A 5CHXA 1PP9J 3VN0A 1MUUA 1YQ3C 3VOPA 3GLMA 1OVVA 1KQGB 3L37A 1UIIA 4PJ0E 2OYIB 4RKUJ 1M7LA 1Z56A 2OGUA 4M3LA 2XV5A 1PGPA 3HRNA 5AW3B 2V4HA 2WSCJ 1L0LE 2DW3A 4B86A 3VYIA 4GKGA 1GL2A 2CPBA 4L76A 1EC5A 2OARA 5B66E 4ZKUA 3O6QA 3AEGC 1OFCX 3RK3C 1FZAA 3ABVC 4N6JA 2M3BA 1KZUB 4JYBA 1AQ5A 3A3YB 3JCUH 1KB9E 1ZW0A 3B5NB 1FZCA 3WU2E 1MZ9A 4XE5B 5H2FE 5AW6B 3TGUG 4RO0A 2QM7A 4H13C 3RL0D 5FL7H 4WBAA 1VPCA 3L73D 1VQPP 2N1TD 1LTTC 1IFDA 1W5CE 1R5LA 2R3SA 1KILE 3HTKB 3NTNA 2BCCD 1NTZK 2V7QH 3HE5A 4Y99B 2NRGA 2YIUB 3WUTA 2LXBA 2WSFJ 3SFEC 1JEKA 2OYHC 4WVZA 2OTJP 2WSEH 3AEEC 4MN4C 2Y0DA 3CCMP 4W7YA 2Y9YA 1P84I 1ZP0C 1RQUA 3RL0g 4ASVA 2ZT9C 3L73J 3CL3D 3KHUA 2N9BA 1HTLC 2WT7A 1RE4C 2N1TA 3OAKA 4KJMA 2BCCJ 2B9BA 4Z1MH 3CMAP 3C1LA 2BEZF 2FYUK 3L71D 5B5EH 3H32B 1SQVD 5APUA 2ZVOB 2RN0A 2ZXEB 1KV4A 1ZR4A 3SFDC 3H1IE 3MHVA 3VMYA 3Q3DA 1T2KC 1M1JA 1P84D 1S9KE 2G3AA 3MZWB 1NTZG 2E74B 3AE1C 4LGDE 3E1RA 2P1JA 3OA7A 1SQXE 1K05A 5AW0B 4ASUH 3L71J 1PPJD 1SQVJ 2OYHA 4JYCA 3R4YA 1DX7A 3TNUA 1LTJB 3MGNA 2ZVNB 1LT9B 1G1IA 1N7SC 1EXJA 1N86A 2WPRA 2M5AB 1KD1Q 1AVOA 1NGMB 4IL6H 1RE4A 1H89A 2QJYC 2JWAA 1L0NK 3EQ2A 1OZHA 2B88A 2LXCB 1Q81Q 2B89A 4BRYA 3P8CD 1M8OB 5EFWB 1Y47A 2O01N 3CXHH 5AVRB 1YBKA 5AW9B 2YKQA 2OYIA 1KORA 4D6TD 2JJLA 2OTKE 2UWJE 2QIWA 2IBZG 3CCVP 1S2EA 1ZOYC 3O8ZA 3FKSH 3G71P 1JMBA 2CK3H 1S5LH 3L74E 4BWNA 2Q9IA 1ZMEC 1G2CB 2NPSC 1N7SA 3HD7B 1D7MA 1X0TA 3GHGC 2KZIA 5CCGA 2RKLA 4D6TJ 1KYOH 4IFMA 3U59A 2JO1A 2ZYAA 3Q1MA 5DJTB 3FX0A 2AXTE 2V7QJ 3B5NA 1NTMD 1NAYA 2P67A 2ZAEB 2BEQD 2ZFCA 1FZBA 2QJKC 3RK2B 2E75B 2B87B 1BGYG 3K5BA 1BCCG 3A7OA 2WPVB 1GK6A 3V2QA 2P58A 2A45H 1YQ4C 3WMM0 1KILB 1K8AQ 1SS1A 1NTKK 3W68A 1DD4A 2IFMA 4UB6H 1VQKP 3HTKA 1AFOA 1EZVE 1WT6A 3SWFA 1NTMJ 2L5GB 3T97B 1ZXGA 1PL5A 2KLVA 1GL2B 2Y9ZA 1VL2A 1GU5A 3H1LE 3A2AA 2E74D 2IYPA 4I7ZC 1SFCC 1BSHA 3H1JE 3IR9A 1EDIA 1URQD 3JCUE 4EI2A 3L75E 1GW4A 5BVZA 1AJYA 2WSCH 1IK7A 2K1AA 5KLVE 3H32A 4N78D 3VP9A 2D2CC 3TDKA 3G3ZA 2KSEA 1KN7A 1QX8A 4GOEA 5C39A 1NTKG 4LC1A 1L0NE 3U1AA 1EQ7A 3KQGA 2CPSA 4HB1A 3IAOA 1NU1K 3CWBG 1SQQK 1N8RQ 2KIKA 1N73C 2Y0EA 4ZNCA 1IFJA 5AW1B 2KNCA 2Z4EA 1X79B 2C9NY 2R44A 5AVYB 5APTA 4OGQD 4PD4D 1BE3E 1FDIA 1LTJA 4GOFA 1S5LX 3RBXA 2M5AA 4H0LC 3RK3B 1SQBD 1SFCA 3KZIE 2H88C 2VRSA 3GG2A 3TSIA 1MFTA 5GTHH 2H7HA 3AECC 1NAFA 1WRGA 2WSFH 1MV8A 3VTPC 5B5EE 1L0LG 3L72E 2K9JA 4JBZA 4H13B 3HD7D 4U7JA 1ZRTD 3HUSC 1SQBJ 2FY8A 1PIXA 1KILC 3M9QA 2JKVA 1N73A 3S4RA 5APQA 2ZXXA 1LT1A 2KXPB 1J1EC 2E75D 3V2NA 2OYHB 3BCCE 3H1KE 5KAIH 3TNUB 1G2CA 1SLQA 1E5WA 3ITKA 1R8EA 3MP7B 3HD7A 3D6YA 2ZT9B 3GW6A 3M0AA 4YPCA 4IOIH 3Q2YA 3PTZA 5AW5B 4IL6E 4U3FD 1KTMA 3GF3A 2W27A 1VF5C 3M9HA 3V5BA 2GM4A 4YTPC 3AE2C 1GL2D 1SQPE 2K88A 1USEA 3CXHE 2Q7CA 1SQXK 2K3RA 2H43A 2MKVA 1P84H 1L2PA 5CBNA 2I8DA 3MIWA 1MFZA 1HVVA 4HH2A 2C9LY 5APSA 1KILA 4U3FJ 2W8ZA 1ZV8A 2K9YA 1HBWA 2WSSH 3AE9C 1EDJA 1FS0E 3GMAA 1S5LE 4HKZH 2C0XA 3T97A 1N7SB 3H1IG 1NU1E 3L70E 4L74A 1SQQE 3BATA 2O3JA 5CCHC 1KQFB 1GD2E 2QJYB 1KYOE 1U7JA 3KDPB 1Y8AA 3EFGA 3TGUD 3A0HH 3FXEA 1H88A 3II6A 4HYTB 4EDFA 1LP1B 1T8ZA 1LTAC 2PGDA 3RK3D 1VQ7P 2AEFA 4K3AA 2OQQA 4DOJA 3AE8C 1JNMA 3F89A 4EYYQ 1BDCA 2E5TA 1OIPA 3TGUJ 1Q2NA 2ZJSE 2KOGA 3IN6A 4QMAA 1PP9E 4H13D 1LJ2A 2NPSB 1K04A 3RGUA 1OMIA 1SQVK 2YKOA 2GUVA 2W6BA 3CPWO 3GHGB 5CCHA 5AVUB 3CC2P 2A06E 2FBWC 1NVOA 3L35A 3Q5PA 2P2UA 1RF1C 3C8VA 1OXZA 2FFDB 2QJKB 3V4QA 1SP4A 1YI2P 1CW5A 5AVSB 1NTZD 4WY4C 2ZT9D 2O01J 4AUWA 3CCJP 1H8AA 3OFNH 4UB8H 2R32A 3OW2O 1J2JB 2KP8A 5KKZC 3PH0A 1N2DC 5K5GB 5CMZA 4TLFA 1WMKA 2KNCB 1PGJA 2OTLP 5AVVB 1W2EA 4DCKA 1W2BO 1JY3O 1T2KD 3D6ZA 1T6AA 1NTZJ 2FYUD 4I7ZB 5KLVK 4R4LA 2Q1KA 1J1DC 1SFCB 2IBZI 3VP8A 4H44C 4I6MC 1QL1A 2XU6A 1HF9A 3JSVC 2FYUG 5GTHE 4IFDK 2YNYA 1PFIA 5APVA 1HJBA 1EZVG 2H8PD 3EWKA 3H1HD 2R5BA 2ZYGA 1N7SD 2K9JB 2D2CB 1PGOA 4R4MA 2OYOA 3N7NA 2G8YA 3E7KA 3H1HG 3H1LG 5AW4B 2FYUJ 3L73E 5CCGD 2W6AA 2IBZD 2BCCE 1N73B 3F5HA 1GW3A 3L75G 3B5ND 4GDOA 1NHLA 5KTBA 5GTIH 4WWIA 3S1KA 2PP6A 3H1HJ 2I1KA 4PD4H 1HWTC 5KAIE 1CSBA 1NTMK 4ASWA 1LWUC 2K37A 2KLUA 5TISH 3VMZA 4H0LB 1L0NG 1JY2P 1LTSC 1HGZA 3HE4A 4NPDA 4I2LC 1JOCA 1JY2N 1OWAA 5BU5A 2WPQA 3IF4A 2LKMA 1BGYD 2KUBA 1OVRA 3L71E 4IFFA 1BCCD 4ZMDA 1SQVE 2Q5UA 2HODA 3PRJA 2NPSD 1G1JA 2FFDC 4Y28J 3B8EB 4YXDC 4OH8B 1HGVA 1T3JA 4DJGA 3HUSB 1P84E 3NXSA 1LP1A 2IFNA 2ZYDA 1VQ4P 1KB9H 2HG5D 2M0BA 1T3UA 1ZN5A 4C7NA 5AW7B 3A5TA 1J1EB 1BGYJ 1YTZI 1PPJE 1FBMA 1BCCJ 2E5YA 3Q5SA 2R3CA 1E79H 2KK7A 3M9BA 2NPSA 3I55P 1GMJA 1SQPK 4EIJA 5KLIC 3CCUP 2GA1A 3GHGA 1ZR2A 2FYNC 2WQYC 3CX5I 1M57D 2N9YB 3QWOC 5AVTB 2YMYA 1RQVA 3VMAA 1VF5B 1QGKB 3P8CE 1TU3F 3Q5RA 2Y0CA 1VQ8P 4N3YB 3LW5J 2FFDA 1NTKD 1IFMA 4PD4I 1Y9BA 2WVRA 3P32A 2HYNA 1XTGB 3CWBD 2E76C 3I56P 1SFCD 2FYZA 3P7KA 2W83C 4D6TE 2FXPA 2QRXA 3CX5D 1BSNA 2YKPA 1FOSF 1SQBK 3W67A 2XOKH 4OGQC 3C9IA 2QG4A 1AV1A 3MUDC 5AVQB 1NTKJ 2D2CD 2QA4P 4O9BA 1SQPG 1L4AC 2JDIH 1RY3A 1NKNA 3CWBJ 3SSUA 3S9OA 3KYQA 1IO4A 2M3EA 1KB9I 3EFFK 1A02J 1L0LD 3G4SP 4DZOA 1NTME 1OW6A 1VQNP 3PP5A 3OJAB 5AVXB 3L70D 1JUNA 3BRTB 4YXWH 1NU1G 1YYCA 4H0LD 3LIEA 3L70G 1SQQG 1Q86Q 3N4XA 1KB9D 4PV1C 5APYA 1AQTA 1IFPA 2FXMA 3CD6P 1L0LJ 1RF0C 1OW8A 3TF5A 4JPZB 1MKMA 3RK2D 2HFED 5KJ7C 2AXCA 3ZDMA 3AE4C 2O01H 1U7MA 2RQ7A 5M1BA 2KZJA 2A45G 1KILD 1DD3A 1HJ0A 2AEJA 3TYYA 2KB7P 2FXOA 3KPEA 2POHA 1IZNB 3OE7H 1RF1B 2IYOA 2WZ7A 1KFNA 2P7JA 3AEFC 4AQRD 4A7PA 4DT0A 4N78E 1JMMA 4W80A 1PP9G 5AVZB 3CCEP 4WY4B 4L75A 3IFMA 1YJNP 3HUSA 1LTBC 2YXRB 2A06D 3M0DC 1K9MQ 5KKZB 1GTWA 1FZCC 2XKMA 2A06G 3GF7A 1VF5D 3BRVB 1RF0A 1Q90D 5GTIE 1JY3P 3V2RA 2J5UA 3M06A 4PD4E 3H1ID 1CI6A 5KJ7A 1JY3N 1JO5A 2YMKA 1Q82Q 1YJWP 1UIXA 2PAJA 1S9KD 3MTUE 2XZRA 2Q3EA 3KXDA 5TISE 1SQBE 1J1DB 1LTGC 4H44B 3V4WA 3HE4B 1SQXD 2I1JA 1QEXA 3I5CA 2QVAA 3NMDA 4NPFX 1SQXG 1X8YA 3WUVA 3H1IJ 2HODB 2IZ0A 1AA0A 3RL0C 2QE7H 1ZRTE 5AW2B 3A0BH 2N1TC 2O1JA 5CCHD 3M0DA 2KS1B 2QJPC 2MJZA 1SQXJ 4OWFA 1QVGO 4C7NB 4UB6E 2Q3IA 2KSJA 3FGAD 3TK1A 3B71A 1BDDA 1M1JC 2FKWB 1LWUB 3AE5C 4GT1A 1FE6A 1IFNA 3L73G 3VMXA 4U3FE 3V6IA 3CLQA 3CCRP 2BCCG 3D70A 1U57A 1GU4A 3L74D 3AE3C 5L8RJ 5CJ0A 3USSA 5DJUB 2HPCA 1LNQA 3L74G 2NZ2A 2JWDA 3KZIH 1USDA 1YJ9P 1H8EH 1S4XA 1EDKA 5KAFH 1HH0A 3OAAH 1SVFA 1Q7YQ 2PRRA 1EZVI 2PFXA 1QVFO 3L74J 4WB4A 2YXQB 2JP3A 2XNXA 3L71G 1RH5B 3LW5H 2JR8A 1SQVG 4WY4D 5E79H 2OYIC 2M8RA 3BVHA 4C46A 3AEBC 4KHXA 1URQB 1A02F 5KLIB 4EOTA 1AVYA 2FYNB 1KC8Q 2IPPA 2L91A 1EZVD 1FZFA 5AVWB 3L4FA 2HLDH 1KMIZ 3TGUE 3FWLA 3PHLA 1IFIA 3R2PA 1RF1A 1FOSE 1PPJG 2GUSA 3H1LD 3BASA 1VQ9P 3PLNA 5CCGC
chains in the Genus database with same CATH topology
2WSSH 4DJGA 4YXWH 1FS0E 3EFFK 3FKSH 5FL7H 1H8EH 4ASUH 2E5YA 2XNDH 2CK3H 1E79H 2HLDH 1JEKA 3OFNH 4WVZA 4QMAA 2W6JH 3OE7H 3OAAH 3USSA 2JDIH 2RQ7A 1BSNA 3PJSK 1AQTA 1IFPA 3OEHH 2XOKH 4TLFA 5DN6I 2QE7H 2V7QH 2RQ6A 2E5TA 1BSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS H;  4DJG A;  4YXW H;  1FS0 E;  3EFF K;  3FKS H;  5FL7 H;  1H8E H;  4ASU H;  2E5Y A;  2XND H;  2CK3 H;  1E79 H;  2HLD H;  1JEK A;  3OFN H;  4WVZ A;  4QMA A;  2W6J H;  3OE7 H;  3OAA H;  3USS A;  2JDI H;  2RQ7 A;  1BSN A;  3PJS K;  1AQT A;  1IFP A;  3OEH H;  2XOK H;  4TLF A;  5DN6 I;  2QE7 H;  2V7Q H;  2RQ6 A;  2E5T A;  1BSH A; 
#chains in the Genus database with same CATH topology
 1KQL A;  1GZL A;  4WY4 A;  3H1J D;  3RK3 E;  2E76 B;  2XND H;  1NJI Q;  1X22 A;  4H44 D;  1YTZ T;  3L75 D;  1CZQ A;  3CX5 H;  2W90 A;  3B5N C;  3AE7 C;  3H1J G;  3JC2 2;  3PJS K;  4OGQ B;  2E42 A;  5KLV D;  2LR2 A;  1FDO A;  4GOD A;  3CC4 P;  5CBO A;  3G9R A;  3H1L J;  3QH9 A;  4PJ0 H;  2W6J H;  1L4A B;  3SWK A;  5KLV G;  1L0N D;  4TT3 H;  2O1K A;  1KQS O;  3H1J J;  1ZLL A;  1YHQ P;  3OEH H;  2YO2 A;  4W7Z A;  2RQ6 A;  3L75 J;  2WTY A;  4Y99 C;  2IDB A;  4D6T G;  4ZKP A;  2Q6Q A;  2YIU C;  1LGH B;  3CI9 A;  3AED C;  1VQL P;  1JTH B;  2KYV A;  5KLV J;  1BE3 D;  1S3J A;  5B66 H;  3V2P A;  3H6P A;  5AW8 B;  1NTZ E;  1XTC C;  2IZ1 A;  5APX A;  1DEB A;  1L0N J;  1BE3 G;  1OVU A;  3NFQ A;  2QEX P;  1NWQ A;  2RMZ A;  2KS1 A;  2WPS A;  4PV1 B;  2QM8 A;  1PV3 A;  1H0T B;  5APW A;  1IJD B;  3WU2 H;  1X9V A;  1NKZ B;  2AEM A;  5H2F H;  2ITA A;  3L72 D;  1IC2 A;  1FU1 A;  2WSE J;  3CCQ P;  1NTM G;  1NYH A;  1BE3 J;  3SWY A;  1CI6 B;  1GK4 A;  3L72 G;  1VQ5 P;  1LWU A;  3AE6 C;  2J59 M;  1DIP A;  1VDF A;  4AYC A;  2WMM A;  2E74 C;  3P8M C;  1EXI A;  1FJP A;  2HLO A;  3CME P;  1YIJ P;  2FYU E;  3D71 A;  1URQ C;  2Z5H A;  4HJG H;  4C7R A;  1DEE G;  3L72 J;  1JCC A;  3BCC D;  3H1K D;  1M56 D;  3CXH I;  2KI7 B;  1LTJ C;  1FZE A;  3H1H E;  1LT9 C;  1GDT A;  3A0H E;  1N7L A;  3O6Q B;  1JB0 J;  3BCC G;  3H1K G;  2QSI A;  4RJT A;  1VQM P;  4NPE A;  3A0B E;  1RHZ B;  4XA4 A;  2IBZ E;  5TJH A;  1LTI C;  1FZC B;  2H89 C;  3UIA A;  4IL6 X;  3CCL P;  2XDJ A;  1OW7 A;  1PGQ A;  3BCC J;  3H1K J;  2BAS A;  1SQP D;  4XFJ A;  2YO3 A;  3CXH D;  4OVN F;  1DH3 A;  1M90 Q;  1L0L K;  1KFM A;  3WUU A;  3M91 A;  3L36 A;  2E76 D;  1FDM A;  1KYO I;  2IX7 C;  1S1C X;  1R5S A;  1URQ A;  3HE5 B;  2RH0 A;  1JM0 A;  1NOH A;  3CCS P;  1K73 Q;  1VQO P;  1BGY E;  2SPZ A;  3LID A;  1SQP J;  1BCC E;  1NO4 A;  1LT9 A;  1QLE D;  2JEE A;  2HPC B;  3HD7 C;  3RL0 B;  1L4A D;  1S72 P;  1NU1 D;  2HR3 A;  1FAV A;  1SQQ D;  1IK9 A;  2A45 I;  2WT7 B;  3FXD A;  2N1T B;  2WWW A;  4CPG A;  1KYO D;  1JCD A;  1JY2 O;  1SQB G;  5KAF E;  2QJP B;  4UB8 E;  4I1L A;  4GIF A;  5CJ4 A;  1RE3 C;  1OX3 A;  3MD0 A;  3RK2 C;  4K35 A;  2E75 C;  3CC7 P;  2P10 A;  2E43 A;  3U1C A;  1M1J B;  4LLH A;  3MUD A;  4L73 A;  1NU1 J;  3L70 J;  1SQQ J;  2R5D A;  5E79 E;  1FJK A;  1L4A A;  1EDL A;  4BXL A;  3H25 A;  3AEA C;  5DN6 I;  4PV1 D;  1HUC A;  3B4S A;  3G6E P;  1VQ6 P;  1NH4 A;  4JF7 A;  5BU8 B;  1GL2 C;  1JTH A;  1PP9 D;  3FWN A;  3E1I A;  5KJ7 D;  4JQ0 D;  1NTK E;  1QL2 A;  2C0W A;  1YIT P;  2WIT A;  3RBZ A;  1PZQ A;  3CWB E;  2J58 A;  1M1K Q;  3CX5 E;  4KT0 J;  4BRY B;  2AXT H;  4U3F G;  2Z5I A;  1FZG A;  1FC2 C;  1RE3 A;  4RES B;  1H0T A;  2B87 A;  5CHX A;  1PP9 J;  3VN0 A;  1MUU A;  1YQ3 C;  3VOP A;  3GLM A;  1OVV A;  1KQG B;  3L37 A;  1UII A;  4PJ0 E;  2OYI B;  4RKU J;  1M7L A;  1Z56 A;  2OGU A;  4M3L A;  2XV5 A;  1PGP A;  3HRN A;  5AW3 B;  2V4H A;  2WSC J;  1L0L E;  2DW3 A;  4B86 A;  3VYI A;  4GKG A;  1GL2 A;  2CPB A;  4L76 A;  1EC5 A;  2OAR A;  5B66 E;  4ZKU A;  3O6Q A;  3AEG C;  1OFC X;  3RK3 C;  1FZA A;  3ABV C;  4N6J A;  2M3B A;  1KZU B;  4JYB A;  1AQ5 A;  3A3Y B;  3JCU H;  1KB9 E;  1ZW0 A;  3B5N B;  1FZC A;  3WU2 E;  1MZ9 A;  4XE5 B;  5H2F E;  5AW6 B;  3TGU G;  4RO0 A;  2QM7 A;  4H13 C;  3RL0 D;  5FL7 H;  4WBA A;  1VPC A;  3L73 D;  1VQP P;  2N1T D;  1LTT C;  1IFD A;  1W5C E;  1R5L A;  2R3S A;  1KIL E;  3HTK B;  3NTN A;  2BCC D;  1NTZ K;  2V7Q H;  3HE5 A;  4Y99 B;  2NRG A;  2YIU B;  3WUT A;  2LXB A;  2WSF J;  3SFE C;  1JEK A;  2OYH C;  4WVZ A;  2OTJ P;  2WSE H;  3AEE C;  4MN4 C;  2Y0D A;  3CCM P;  4W7Y A;  2Y9Y A;  1P84 I;  1ZP0 C;  1RQU A;  3RL0 g;  4ASV A;  2ZT9 C;  3L73 J;  3CL3 D;  3KHU A;  2N9B A;  1HTL C;  2WT7 A;  1RE4 C;  2N1T A;  3OAK A;  4KJM A;  2BCC J;  2B9B A;  4Z1M H;  3CMA P;  3C1L A;  2BEZ F;  2FYU K;  3L71 D;  5B5E H;  3H32 B;  1SQV D;  5APU A;  2ZVO B;  2RN0 A;  2ZXE B;  1KV4 A;  1ZR4 A;  3SFD C;  3H1I E;  3MHV A;  3VMY A;  3Q3D A;  1T2K C;  1M1J A;  1P84 D;  1S9K E;  2G3A A;  3MZW B;  1NTZ G;  2E74 B;  3AE1 C;  4LGD E;  3E1R A;  2P1J A;  3OA7 A;  1SQX E;  1K05 A;  5AW0 B;  4ASU H;  3L71 J;  1PPJ D;  1SQV J;  2OYH A;  4JYC A;  3R4Y A;  1DX7 A;  3TNU A;  1LTJ B;  3MGN A;  2ZVN B;  1LT9 B;  1G1I A;  1N7S C;  1EXJ A;  1N86 A;  2WPR A;  2M5A B;  1KD1 Q;  1AVO A;  1NGM B;  4IL6 H;  1RE4 A;  1H89 A;  2QJY C;  2JWA A;  1L0N K;  3EQ2 A;  1OZH A;  2B88 A;  2LXC B;  1Q81 Q;  2B89 A;  4BRY A;  3P8C D;  1M8O B;  5EFW B;  1Y47 A;  2O01 N;  3CXH H;  5AVR B;  1YBK A;  5AW9 B;  2YKQ A;  2OYI A;  1KOR A;  4D6T D;  2JJL A;  2OTK E;  2UWJ E;  2QIW A;  2IBZ G;  3CCV P;  1S2E A;  1ZOY C;  3O8Z A;  3FKS H;  3G71 P;  1JMB A;  2CK3 H;  1S5L H;  3L74 E;  4BWN A;  2Q9I A;  1ZME C;  1G2C B;  2NPS C;  1N7S A;  3HD7 B;  1D7M A;  1X0T A;  3GHG C;  2KZI A;  5CCG A;  2RKL A;  4D6T J;  1KYO H;  4IFM A;  3U59 A;  2JO1 A;  2ZYA A;  3Q1M A;  5DJT B;  3FX0 A;  2AXT E;  2V7Q J;  3B5N A;  1NTM D;  1NAY A;  2P67 A;  2ZAE B;  2BEQ D;  2ZFC A;  1FZB A;  2QJK C;  3RK2 B;  2E75 B;  2B87 B;  1BGY G;  3K5B A;  1BCC G;  3A7O A;  2WPV B;  1GK6 A;  3V2Q A;  2P58 A;  2A45 H;  1YQ4 C;  3WMM 0;  1KIL B;  1K8A Q;  1SS1 A;  1NTK K;  3W68 A;  1DD4 A;  2IFM A;  4UB6 H;  1VQK P;  3HTK A;  1AFO A;  1EZV E;  1WT6 A;  3SWF A;  1NTM J;  2L5G B;  3T97 B;  1ZXG A;  1PL5 A;  2KLV A;  1GL2 B;  2Y9Z A;  1VL2 A;  1GU5 A;  3H1L E;  3A2A A;  2E74 D;  2IYP A;  4I7Z C;  1SFC C;  1BSH A;  3H1J E;  3IR9 A;  1EDI A;  1URQ D;  3JCU E;  4EI2 A;  3L75 E;  1GW4 A;  5BVZ A;  1AJY A;  2WSC H;  1IK7 A;  2K1A A;  5KLV E;  3H32 A;  4N78 D;  3VP9 A;  2D2C C;  3TDK A;  3G3Z A;  2KSE A;  1KN7 A;  1QX8 A;  4GOE A;  5C39 A;  1NTK G;  4LC1 A;  1L0N E;  3U1A A;  1EQ7 A;  3KQG A;  2CPS A;  4HB1 A;  3IAO A;  1NU1 K;  3CWB G;  1SQQ K;  1N8R Q;  2KIK A;  1N73 C;  2Y0E A;  4ZNC A;  1IFJ A;  5AW1 B;  2KNC A;  2Z4E A;  1X79 B;  2C9N Y;  2R44 A;  5AVY B;  5APT A;  4OGQ D;  4PD4 D;  1BE3 E;  1FDI A;  1LTJ A;  4GOF A;  1S5L X;  3RBX A;  2M5A A;  4H0L C;  3RK3 B;  1SQB D;  1SFC A;  3KZI E;  2H88 C;  2VRS A;  3GG2 A;  3TSI A;  1MFT A;  5GTH H;  2H7H A;  3AEC C;  1NAF A;  1WRG A;  2WSF H;  1MV8 A;  3VTP C;  5B5E E;  1L0L G;  3L72 E;  2K9J A;  4JBZ A;  4H13 B;  3HD7 D;  4U7J A;  1ZRT D;  3HUS C;  1SQB J;  2FY8 A;  1PIX A;  1KIL C;  3M9Q A;  2JKV A;  1N73 A;  3S4R A;  5APQ A;  2ZXX A;  1LT1 A;  2KXP B;  1J1E C;  2E75 D;  3V2N A;  2OYH B;  3BCC E;  3H1K E;  5KAI H;  3TNU B;  1G2C A;  1SLQ A;  1E5W A;  3ITK A;  1R8E A;  3MP7 B;  3HD7 A;  3D6Y A;  2ZT9 B;  3GW6 A;  3M0A A;  4YPC A;  4IOI H;  3Q2Y A;  3PTZ A;  5AW5 B;  4IL6 E;  4U3F D;  1KTM A;  3GF3 A;  2W27 A;  1VF5 C;  3M9H A;  3V5B A;  2GM4 A;  4YTP C;  3AE2 C;  1GL2 D;  1SQP E;  2K88 A;  1USE A;  3CXH E;  2Q7C A;  1SQX K;  2K3R A;  2H43 A;  2MKV A;  1P84 H;  1L2P A;  5CBN A;  2I8D A;  3MIW A;  1MFZ A;  1HVV A;  4HH2 A;  2C9L Y;  5APS A;  1KIL A;  4U3F J;  2W8Z A;  1ZV8 A;  2K9Y A;  1HBW A;  2WSS H;  3AE9 C;  1EDJ A;  1FS0 E;  3GMA A;  1S5L E;  4HKZ H;  2C0X A;  3T97 A;  1N7S B;  3H1I G;  1NU1 E;  3L70 E;  4L74 A;  1SQQ E;  3BAT A;  2O3J A;  5CCH C;  1KQF B;  1GD2 E;  2QJY B;  1KYO E;  1U7J A;  3KDP B;  1Y8A A;  3EFG A;  3TGU D;  3A0H H;  3FXE A;  1H88 A;  3II6 A;  4HYT B;  4EDF A;  1LP1 B;  1T8Z A;  1LTA C;  2PGD A;  3RK3 D;  1VQ7 P;  2AEF A;  4K3A A;  2OQQ A;  4DOJ A;  3AE8 C;  1JNM A;  3F89 A;  4EYY Q;  1BDC A;  2E5T A;  1OIP A;  3TGU J;  1Q2N A;  2ZJS E;  2KOG A;  3IN6 A;  4QMA A;  1PP9 E;  4H13 D;  1LJ2 A;  2NPS B;  1K04 A;  3RGU A;  1OMI A;  1SQV K;  2YKO A;  2GUV A;  2W6B A;  3CPW O;  3GHG B;  5CCH A;  5AVU B;  3CC2 P;  2A06 E;  2FBW C;  1NVO A;  3L35 A;  3Q5P A;  2P2U A;  1RF1 C;  3C8V A;  1OXZ A;  2FFD B;  2QJK B;  3V4Q A;  1SP4 A;  1YI2 P;  1CW5 A;  5AVS B;  1NTZ D;  4WY4 C;  2ZT9 D;  2O01 J;  4AUW A;  3CCJ P;  1H8A A;  3OFN H;  4UB8 H;  2R32 A;  3OW2 O;  1J2J B;  2KP8 A;  5KKZ C;  3PH0 A;  1N2D C;  5K5G B;  5CMZ A;  4TLF A;  1WMK A;  2KNC B;  1PGJ A;  2OTL P;  5AVV B;  1W2E A;  4DCK A;  1W2B O;  1JY3 O;  1T2K D;  3D6Z A;  1T6A A;  1NTZ J;  2FYU D;  4I7Z B;  5KLV K;  4R4L A;  2Q1K A;  1J1D C;  1SFC B;  2IBZ I;  3VP8 A;  4H44 C;  4I6M C;  1QL1 A;  2XU6 A;  1HF9 A;  3JSV C;  2FYU G;  5GTH E;  4IFD K;  2YNY A;  1PFI A;  5APV A;  1HJB A;  1EZV G;  2H8P D;  3EWK A;  3H1H D;  2R5B A;  2ZYG A;  1N7S D;  2K9J B;  2D2C B;  1PGO A;  4R4M A;  2OYO A;  3N7N A;  2G8Y A;  3E7K A;  3H1H G;  3H1L G;  5AW4 B;  2FYU J;  3L73 E;  5CCG D;  2W6A A;  2IBZ D;  2BCC E;  1N73 B;  3F5H A;  1GW3 A;  3L75 G;  3B5N D;  4GDO A;  1NHL A;  5KTB A;  5GTI H;  4WWI A;  3S1K A;  2PP6 A;  3H1H J;  2I1K A;  4PD4 H;  1HWT C;  5KAI E;  1CSB A;  1NTM K;  4ASW A;  1LWU C;  2K37 A;  2KLU A;  5TIS H;  3VMZ A;  4H0L B;  1L0N G;  1JY2 P;  1LTS C;  1HGZ A;  3HE4 A;  4NPD A;  4I2L C;  1JOC A;  1JY2 N;  1OWA A;  5BU5 A;  2WPQ A;  3IF4 A;  2LKM A;  1BGY D;  2KUB A;  1OVR A;  3L71 E;  4IFF A;  1BCC D;  4ZMD A;  1SQV E;  2Q5U A;  2HOD A;  3PRJ A;  2NPS D;  1G1J A;  2FFD C;  4Y28 J;  3B8E B;  4YXD C;  4OH8 B;  1HGV A;  1T3J A;  4DJG A;  3HUS B;  1P84 E;  3NXS A;  1LP1 A;  2IFN A;  2ZYD A;  1VQ4 P;  1KB9 H;  2HG5 D;  2M0B A;  1T3U A;  1ZN5 A;  4C7N A;  5AW7 B;  3A5T A;  1J1E B;  1BGY J;  1YTZ I;  1PPJ E;  1FBM A;  1BCC J;  2E5Y A;  3Q5S A;  2R3C A;  1E79 H;  2KK7 A;  3M9B A;  2NPS A;  3I55 P;  1GMJ A;  1SQP K;  4EIJ A;  5KLI C;  3CCU P;  2GA1 A;  3GHG A;  1ZR2 A;  2FYN C;  2WQY C;  3CX5 I;  1M57 D;  2N9Y B;  3QWO C;  5AVT B;  2YMY A;  1RQV A;  3VMA A;  1VF5 B;  1QGK B;  3P8C E;  1TU3 F;  3Q5R A;  2Y0C A;  1VQ8 P;  4N3Y B;  3LW5 J;  2FFD A;  1NTK D;  1IFM A;  4PD4 I;  1Y9B A;  2WVR A;  3P32 A;  2HYN A;  1XTG B;  3CWB D;  2E76 C;  3I56 P;  1SFC D;  2FYZ A;  3P7K A;  2W83 C;  4D6T E;  2FXP A;  2QRX A;  3CX5 D;  1BSN A;  2YKP A;  1FOS F;  1SQB K;  3W67 A;  2XOK H;  4OGQ C;  3C9I A;  2QG4 A;  1AV1 A;  3MUD C;  5AVQ B;  1NTK J;  2D2C D;  2QA4 P;  4O9B A;  1SQP G;  1L4A C;  2JDI H;  1RY3 A;  1NKN A;  3CWB J;  3SSU A;  3S9O A;  3KYQ A;  1IO4 A;  2M3E A;  1KB9 I;  3EFF K;  1A02 J;  1L0L D;  3G4S P;  4DZO A;  1NTM E;  1OW6 A;  1VQN P;  3PP5 A;  3OJA B;  5AVX B;  3L70 D;  1JUN A;  3BRT B;  4YXW H;  1NU1 G;  1YYC A;  4H0L D;  3LIE A;  3L70 G;  1SQQ G;  1Q86 Q;  3N4X A;  1KB9 D;  4PV1 C;  5APY A;  1AQT A;  1IFP A;  2FXM A;  3CD6 P;  1L0L J;  1RF0 C;  1OW8 A;  3TF5 A;  4JPZ B;  1MKM A;  3RK2 D;  2HFE D;  5KJ7 C;  2AXC A;  3ZDM A;  3AE4 C;  2O01 H;  1U7M A;  2RQ7 A;  5M1B A;  2KZJ A;  2A45 G;  1KIL D;  1DD3 A;  1HJ0 A;  2AEJ A;  3TYY A;  2KB7 P;  2FXO A;  3KPE A;  2POH A;  1IZN B;  3OE7 H;  1RF1 B;  2IYO A;  2WZ7 A;  1KFN A;  2P7J A;  3AEF C;  4AQR D;  4A7P A;  4DT0 A;  4N78 E;  1JMM A;  4W80 A;  1PP9 G;  5AVZ B;  3CCE P;  4WY4 B;  4L75 A;  3IFM A;  1YJN P;  3HUS A;  1LTB C;  2YXR B;  2A06 D;  3M0D C;  1K9M Q;  5KKZ B;  1GTW A;  1FZC C;  2XKM A;  2A06 G;  3GF7 A;  1VF5 D;  3BRV B;  1RF0 A;  1Q90 D;  5GTI E;  1JY3 P;  3V2R A;  2J5U A;  3M06 A;  4PD4 E;  3H1I D;  1CI6 A;  5KJ7 A;  1JY3 N;  1JO5 A;  2YMK A;  1Q82 Q;  1YJW P;  1UIX A;  2PAJ A;  1S9K D;  3MTU E;  2XZR A;  2Q3E A;  3KXD A;  5TIS E;  1SQB E;  1J1D B;  1LTG C;  4H44 B;  3V4W A;  3HE4 B;  1SQX D;  2I1J A;  1QEX A;  3I5C A;  2QVA A;  3NMD A;  4NPF X;  1SQX G;  1X8Y A;  3WUV A;  3H1I J;  2HOD B;  2IZ0 A;  1AA0 A;  3RL0 C;  2QE7 H;  1ZRT E;  5AW2 B;  3A0B H;  2N1T C;  2O1J A;  5CCH D;  3M0D A;  2KS1 B;  2QJP C;  2MJZ A;  1SQX J;  4OWF A;  1QVG O;  4C7N B;  4UB6 E;  2Q3I A;  2KSJ A;  3FGA D;  3TK1 A;  3B71 A;  1BDD A;  1M1J C;  2FKW B;  1LWU B;  3AE5 C;  4GT1 A;  1FE6 A;  1IFN A;  3L73 G;  3VMX A;  4U3F E;  3V6I A;  3CLQ A;  3CCR P;  2BCC G;  3D70 A;  1U57 A;  1GU4 A;  3L74 D;  3AE3 C;  5L8R J;  5CJ0 A;  3USS A;  5DJU B;  2HPC A;  1LNQ A;  3L74 G;  2NZ2 A;  2JWD A;  3KZI H;  1USD A;  1YJ9 P;  1H8E H;  1S4X A;  1EDK A;  5KAF H;  1HH0 A;  3OAA H;  1SVF A;  1Q7Y Q;  2PRR A;  1EZV I;  2PFX A;  1QVF O;  3L74 J;  4WB4 A;  2YXQ B;  2JP3 A;  2XNX A;  3L71 G;  1RH5 B;  3LW5 H;  2JR8 A;  1SQV G;  4WY4 D;  5E79 H;  2OYI C;  2M8R A;  3BVH A;  4C46 A;  3AEB C;  4KHX A;  1URQ B;  1A02 F;  5KLI B;  4EOT A;  1AVY A;  2FYN B;  1KC8 Q;  2IPP A;  2L91 A;  1EZV D;  1FZF A;  5AVW B;  3L4F A;  2HLD H;  1KMI Z;  3TGU E;  3FWL A;  3PHL A;  1IFI A;  3R2P A;  1RF1 A;  1FOS E;  1PPJ G;  2GUS A;  3H1L D;  3BAS A;  1VQ9 P;  3PLN A;  5CCG C; 
#chains in the Genus database with same CATH homology
 2WSS H;  4DJG A;  4YXW H;  1FS0 E;  3EFF K;  3FKS H;  5FL7 H;  1H8E H;  4ASU H;  2E5Y A;  2XND H;  2CK3 H;  1E79 H;  2HLD H;  1JEK A;  3OFN H;  4WVZ A;  4QMA A;  2W6J H;  3OE7 H;  3OAA H;  3USS A;  2JDI H;  2RQ7 A;  1BSN A;  3PJS K;  1AQT A;  1IFP A;  3OEH H;  2XOK H;  4TLF A;  5DN6 I;  2QE7 H;  2V7Q H;  2RQ6 A;  2E5T A;  1BSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...