1BSHA

Solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
138
structure length
138
Chain Sequence
b'AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EPSILON SUBUNIT)
molecule tags Hydrolase
source organism Escherichia coli
publication title Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex.
pubmed doi rcsb
total genus 20
structure length 138
sequence length 138
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 1998-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 1bshA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 1bshA01
2E5TA 2WSSH 1BSHA 4YXWH 4WVZA 3OFNH 2HLDH 1AQTA 3OAAH 1E79H 4ASUH 2RQ7A 3PJSK 1IFPA 2JDIH 2W6JH 1JEKA 2RQ6A 3EFFK 3OE7H 2CK3H 1BSNA 2XNDH 3OEHH 1H8EH 3FKSH 4TLFA 4DJGA 2E5YA 2QE7H 2XOKH 5FL7H 4QMAA 3USSA 2V7QH 5DN6I 1FS0E
chains in the Genus database with same CATH superfamily
1SQQE 2E76C 2P7JA 3B4SA 1L0LE 3AE5C 3H1KD 4UB6H 1JY2P 1GDTA 3S4RA 1N7SB 2LR2A 5AW2B 2NRGA 1J1EC 1JTHA 1UIXA 2QG4A 3L73E 3PP5A 4JF7A 1JCDA 4WWIA 1PGQA 2H88C 2FYNB 3A0HE 4H44D 1J1DB 4H13C 4N3YB 1VDFA 3HUSB 1L0LK 2NPSC 1YYCA 2IX7C 1S2EA 4GOFA 2PP6A 3TDKA 2XU6A 1ZRTD 1SQBE 1VQNP 2OTJP 4GDOA 2V7QJ 2IYOA 4WY4B 1LT1A 1KYOH 2OTKE 1SQBJ 3HE5A 1OIPA 3M91A 1ZMEC 3L74E 3RL0g 1DD4A 1RE4A 1QVGO 1VQ6P 3AEEC 3RK2B 1FDOA 3SWYA 3TNUB 1D7MA 1GMJA 1YBKA 2FKWB 2NPSA 5APTA 1LTIC 2FFDB 1USDA 1BSHA 2C9NY 1SQPE 3H1KJ 3KQGA 1SQPG 1KILA 1KQLA 1OVUA 2UWJE 2W8ZA 3O6QA 4IL6X 5E79E 3SWKA 2W6JH 2YMKA 1K05A 4I2LC 4PD4E 1K9MQ 3L75E 3AE2C 4WY4C 4Y99C 1RF1C 3F89A 3P8CD 1NTMJ 2WPQA 1BSNA 3CCJP 3O8ZA 3VMXA 1SFCC 3AE1C 4IL6H 3H25A 2O01N 2OYHB 2KLUA 3CPWO 2N1TA 2A06E 1ZN5A 2FXMA 2OGUA 1LTAC 3FXEA 5APWA 3IN6A 1N8RQ 1ZXGA 2B89A 2OARA 3GF7A 4H0LB 5C39A 3SSUA 1HGZA 3AE8C 1Y8AA 2FY8A 3CXHI 2Q1KA 3EQ2A 2P58A 1QVFO 1KB9I 3KZIH 4DCKA 2IFNA 2MJZA 2M0BA 2M5AB 3PH0A 3VP9A 4YPCA 5APUA 2WSSH 5APQA 3P32A 1RF1B 1J1EB 2D2CC 3R4YA 1KYOI 4OH8B 2Q3EA 3T97A 2AEMA 1MFZA 4ASVA 3L4FA 1M56D 2ZVNB 1TU3F 4JBZA 3HE4B 3LW5H 1KB9D 1M1JC 4I7ZB 1NTKJ 1SQQD 1R5LA 3CI9A 2QIWA 3FXDA 4Y28J 3AE9C 3V2PA 4C7RA 3D6ZA 1VQ8P 2IPPA 2AEFA 1SQPD 2C0WA 3H32B 4HH2A 1Q2NA 3H1LG 4EDFA 1AFOA 1NTZK 2M8RA 3MZWB 1Z56A 5GTIE 2W6BA 3L75D 3CWBJ 2OYHA 1NVOA 1FJPA 1FJKA 2XOKH 3B8EB 1NKNA 3H1JG 4B86A 3M9HA 3RK2C 3OAKA 4W7ZA 3I55P 1FZCC 3Q5RA 3MD0A 3S9OA 3TYYA 4AUWA 3L73J 2XZRA 2HR3A 1WT6A 5AVUB 5AVXB 1N73C 1IFMA 5DJTB 2QRXA 1CZQA 2OYIA 1L4AD 1KILD 1KYOD 2AEJA 2WSCH 3E1RA 4GKGA 4GOEA 3Q1MA 4ASUH 1BCCD 1YQ4C 3MUDA 1SFCB 1QL1A 3H6PA 4OWFA 2LXBA 3H1IG 1CI6A 5AW3B 5KLVK 2IFMA 3Q5PA 1VQMP 1GK4A 1YTZI 1LT9C 1N7SA 2BCCG 1KORA 1LP1A 2KZIA 1IK7A 2YKOA 3FWNA 1QX8A 1FZCB 2P67A 1SQXE 4H0LC 3LIDA 2RH0A 4M3LA 2JJLA 1EDKA 1ZLLA 1RQUA 2QSIA 3L70G 2JEEA 5KLIC 5KKZC 1EC5A 1L4AC 1SQXJ 3V5BA 1HVVA 2YNYA 3C9IA 3OA7A 4UB8H 2ZXEB 3P8CE 3JSVC 1G1IA 3HD7A 5APYA 1HWTC 3GW6A 2FXPA 2YKQA 2R44A 2D2CB 3L72D 1SP4A 2JWDA 3M0AA 3QWOC 4PD4H 4A7PA 1EDIA 2O1KA 2PAJA 5CCHC 1LWUA 1OMIA 3M9QA 2O1JA 3OFNH 3RL0B 3VTPC 1L0NG 1MZ9A 3RK3C 5AVSB 1FE6A 2E75B 1URQD 3HTKB 3L35A 3PJSK 1L4AA 1BGYJ 3AEDC 1PZQA 4H13D 3V2RA 2IDBA 3HRNA 1UIIA 4PV1B 5H2FE 1NU1D 2KXPB 1EDJA 3KDPB 3L70D 2RQ6A 1KILE 4EOTA 2YXQB 3KPEA 1KTMA 3H1LE 3OEHH 1R5SA 2I1KA 1VQ9P 2QA4P 2WT7B 3H1ID 3CC2P 3VMYA 1KB9E 1M1KQ 2ZJSE 1SVFA 2KI7B 1KFNA 3HUSC 2JP3A 5CJ4A 3T97B 2Z4EA 3RL0C 3NTNA 3A0HH 3QH9A 1YJ9P 2KNCA 1KYOE 3G4SP 1N73B 1IJDB 2RKLA 1L0LJ 1EDLA 4C46A 2G3AA 4WY4A 4BWNA 1U7JA 3AEFC 3CWBE 2XV5A 2QJKB 2WMMA 2WT7A 4WVZA 1KILC 3L71D 2D2CD 2Q5UA 4AQRD 3KXDA 4RESB 2H8PD 3H1JD 1OVVA 5AW1B 2QEXP 1SQXD 1Q86Q 2YO2A 4OGQD 2PFXA 1IFPA 2RQ7A 3KZIE 1RQVA 3L73G 1JCCA 3WU2E 1SQQK 2O01J 2YKPA 3SWFA 3CMAP 1VQ5P 2C9LY 1H0TB 3Q5SA 1EZVD 3G9RA 3H1JJ 4ASWA 1GTWA 1L0NJ 5B5EH 1NAYA 1ZOYC 1NH4A 2QVAA 3RK2D 2K9JA 1SQQG 4L74A 4IL6E 1NJIQ 2SPZA 4W80A 2E5YA 1DH3A 3L73D 2R5DA 1SQVD 2A45H 2QJKC 4WB4A 1RE3C 3P7KA 2FFDA 3P8MC 3IF4A 1GL2C 3PRJA 5KAIE 1NTMK 1HUCA 3EWKA 2M3BA 3L36A 4GIFA 4BXLA 3D6YA 1E5WA 1WMKA 1S5LE 1ZRTE 1FS0E 1LJ2A 1GU4A 4PV1C 3L70E 1P84D 3M06A 2W90A 2RN0A 4ZKPA 3G6EP 2KYVA 3E1IA 3VMAA 2Y0CA 1KQSO 1HJ0A 1NU1G 3L72E 1AQ5A 1NTME 2NPSD 1K73Q 3CLQA 3H1IE 5CCHA 2XKMA 1JM0A 2R5BA 3BRTB 1PIXA 3CXHD 1IFDA 3EFFK 3WUTA 3Q2YA 3B5ND 2MKVA 2E74C 2FYUK 2ZT9C 1SS1A 2N9YB 1BGYE 2A06G 3C8VA 2O3JA 3PLNA 4I7ZC 1JNMA 1NHLA 1AJYA 3W67A 1KV4A 1KQGB 1L2PA 3CWBD 2IBZD 1SLQA 2GM4A 5FL7H 2E75D 1K8AQ 4KHXA 1OX3A 3H1JE 3H1LJ 4K3AA 5DN6I 2OTLP 4PJ0H 1LT9A 1N7SC 4L73A 3WU2H 2A06D 1RY3A 1KFMA 1KQFB 2WSEH 2C0XA 1JOCA 4XFJA 1NTKG 1SQVE 1NU1J 5KJ7D 2M3EA 3F5HA 4YXWH 2BCCD 2GA1A 4OVNF 5KJ7A 5KAFH 1CW5A 1AVOA 1SQBK 2E74B 2ZT9B 5KLVG 1T2KD 3MGNA 3GHGB 1BE3G 1X9VA 1IK9A 3HD7C 2GUSA 3AEGC 1NO4A 3B71A 1U57A 1FC2C 3L71E 4KJMA 5CBNA 2E43A 5B66H 3BCCD 1HTLC 2K1AA 1HJBA 1Y9BA 3LW5J 1X22A 1URQC 1LT9B 2YMYA 3B5NA 2M5AA 3CXHE 1EZVE 1IC2A 1P84E 2HPCB 2FFDC 3CMEP 2JKVA 4HB1A 1A02F 1RE3A 3AE6C 3BATA 2H7HA 2HFED 3FGAD 4U7JA 1XTGB 1NTMD 3M0DC 5AVTB 1RF0C 1FU1A 2KIKA 1NTZG 1NKZB 1EXIA 3CC4P 2IBZE 1DD3A 1G2CA 3HD7B 2E5TA 2CPBA 1L0NE 2AXCA 2V4HA 1IFJA 2WPRA 1NYHA 5TISE 2QJYC 3GMAA 5APVA 5AVWB 2Z5IA 1N73A 4RJTA 1JTHB 1YJWP 1LGHB 3L75G 1PP9J 2P1JA 2FBWC 5AW8B 1FZCA 3JCUH 3RL0D 3GHGA 2W27A 2I8DA 3LIEA 3L71G 3CCSP 1N2DC 2ZYDA 3NFQA 1CI6B 1ZW0A 4D6TG 2OYHC 1BCCE 1KMIZ 2R32A 3D70A 1GW3A 2Q9IA 3CC7P 1H8EH 1SQBG 1HH0A 2W83C 3R2PA 3CX5H 4WBAA 5CBOA 2N1TC 1NTZD 2N9BA 4NPEA 5BU8B 1NTKK 3BCCE 1J2JB 1NWQA 3VYIA 1IFNA 1GD2E 3CX5D 1VF5B 4K35A 3SFDC 3A3YB 1DX7A 1FOSF 2AXTH 1YQ3C 4ZNCA 2K37A 2Q3IA 3BASA 1FDMA 3GG2A 1W2BO 2HPCA 1GW4A 3V4QA 1NGMB 1HF9A 2KS1B 3TSIA 2WITA 3CX5I 1GL2A 5AVYB 2E42A 1KILB 3O6QB 2QM7A 1HGVA 1JEKA 1L0ND 1RE4C 3L37A 4DZOA 1NU1K 1T3JA 2I1JA 1KZUB 2ITAA 2XNDH 4JYBA 5KLVD 1L0NK 3VOPA 2OQQA 3G71P 3M9BA 3H1HJ 1OVRA 1VF5D 1SFCA 2QJPC 2B87B 1NU1E 1PPJE 1XTCC 2FYZA 2QE7H 3L72G 2KUBA 4D6TJ 3TGUJ 3K5BA 3H1HE 3H1HG 3L71J 1LTTC 3AE4C 1M8OB 2HODA 3KHUA 2KSJA 2NPSB 1OWAA 2W6AA 2QJYB 2POHA 3WUVA 1URQA 2YIUC 3AEBC 5CCGA 4IFFA 4JPZB 1AV1A 2Y0DA 1AA0A 1JY3N 1SQXK 3IR9A 4ZMDA 4GODA 3CCRP 2Z5HA 2K9YA 4L76A 4EIJA 1VQ4P 1AVYA 2IYPA 3BCCG 5CMZA 2WSEJ 4AYCA 4UB6E 2ZXXA 3I5CA 3TK1A 4EYYQ 5KKZB 4IFMA 5EFWB 1PGPA 3HTKA 5CCGD 2FYUG 2YXRB 3H32A 3HUSA 1GZLA 2CK3H 4TT3H 1ZR4A 2LKMA 1FZFA 1X0TA 1KC8Q 1QL2A 5GTHH 2OYIC 4LGDE 2BASA 3CX5E 3AE3C 4TLFA 1YTZT 2YIUB 4DOJA 3D71A 1FZGA 5GTHE 1OXZA 1N7SD 1QEXA 4Y99B 2J58A 1MFTA 5AVQB 3TNUA 5CCHD 3JC22 3A0BH 1YJNP 2H89C 3C1LA 4L75A 3USSA 1SQPJ 1BCCJ 3H1KE 3IAOA 1SQVJ 3KYQA 2B9BA 3JCUE 1Q90D 1IFIA 3IFMA 1IZNB 3II6A 3L72J 2ZAEB 1YHQP 3V4WA 3BVHA 3H1HD 3HE5B 5BVZA 1PGOA 2IBZG 1M90Q 2J59M 2ZYAA 2R3CA 4W7YA 3TGUE 4U3FG 3CXHH 4RO0A 4C7NA 1DIPA 1VQOP 3OAAH 4D6TD 4H44C 2H43A 1M1JA 4DT0A 2WTYA 3W68A 4PD4I 5AW6B 2K9JB 2QM8A 3U1AA 4BRYB 2QJPB 2KP8A 3L74G 2Q7CA 5B66E 1ZP0C 5TJHA 3OJAB 3V6IA 3CCVP 1LTJA 1N86A 1LWUB 4HKZH 1G2CB 2Q6QA 1M1JB 1NOHA 2L5GB 2RMZA 3AECC 1PV3A 3NXSA 4LC1A 1FZBA 1QGKB 3CL3D 3NMDA 3RBZA 5CHXA 5KAIH 1NTMG 2KOGA 2PGDA 4PV1D 4U3FJ 1S9KE 3MUDC 1BGYD 1URQB 3WMM0 1JY3O 2HYNA 1RF0A 3M0DA 4R4MA 1JY3P 1EQ7A 1S72P 3CCLP 1FDIA 1S1CX 2CPSA 1S5LH 2HODB 3MTUE 3VN0A 1NTKE 1SQVG 1L0LG 1OW6A 2KNCB 3AEAC 1LTSC 1OZHA 2HLDH 1GK6A 2IZ0A 2BEQD 2B87A 3BRVB 1LP1B 3MP7B 2R3SA 2JR8A 4ZKUA 3HE4A 1PFIA 2BCCJ 1S5LX 2ZVOB 4YTPC 1PP9D 4Z1MH 5AW5B 2IZ1A 1LTJC 4R4LA 2K3RA 1NAFA 1S3JA 2WPVB 3N4XA 1RHZB 1OFCX 2BCCE 5CCGC 2K88A 2KS1A 2KSEA 1SQPK 3TGUD 1H89A 3A5TA 1GL2B 5APSA 1T6AA 2FYUJ 2JO1A 3GLMA 5DJUB 1DEBA 1NTZJ 2E76D 3VMZA 2WVRA 2WPSA 4HJGH 5AVRB 1EZVI 3CD6P 4U3FD 1YI2P 3I56P 1Q82Q 4XA4A 1SQVK 5E79H 1FZEA 2KLVA 2V7QH 1S4XA 4RKUJ 5AVZB 1ZR2A 2N1TB 2DW3A 2G8YA 4PJ0E 4H44B 1YITP 3CWBG 1G1JA 5M1BA 2BEZF 5K5GB 3CCMP 4YXDC 1S9KD 1VF5C 1BE3J 1T3UA 3VP8A 1JB0J 2WQYC 4MN4C 2JDIH 3RK3E 3V2NA 4O9BA 3H1KG 4IOIH 1N7LA 3HD7D 2KZJA 2WSCJ 1VL2A 5B5EE 3V2QA 2P10A 5KLVJ 4NPFX 1BE3D 2AXTE 5KTBA 1RH5B 4N6JA 5AW7B 3RK3B 1T2KC 4D6TE 1VQLP 1QLED 1M57D 2FYUD 2HLOA 3FX0A 4N78D 1ZV8A 4XE5B 4GT1A 3PTZA 1BDCA 4EI2A 1EXJA 2OYOA 1H0TA 4OGQB 1SFCD 2VRSA 1NTKD 1SQQJ 3A7OA 3PHLA 1PL5A 1RF1A 3OW2O 1FAVA 4JYCA 1P84H 5AW9B 4UB8E 3WUUA 2FXOA 1T8ZA 4IFDK 1OW8A 5H2FH 1YIJP 2Y9ZA 2NZ2A 3GHGC 3AE7C 3B5NB 2XDJA 2ZFCA 1GL2D 2Y9YA 3GF3A 1NTZE 5AVVB 1K04A 4HYTB 1LTJB 4U3FE 5AW0B 3Q3DA 1Y47A 1Q7YQ 1VPCA 3L74J 1FBMA 2PRRA 1CSBA 2XNXA 1JY2N 3MIWA 2E76B 3ABVC 3FWLA 4H0LD 4JQ0D 2A45I 4CPGA 1LNQA 3A0BE 5TISH 1L0LD 1A02J 2Y0EA 1SQXG 3SFEC 1BCCG 1FZAA 3N7NA 3TGUG 1PPJG 5BU5A 1X8YA 3CCEP 1PP9E 1PP9G 2FYNC 3B5NC 2A45G 1J1DC 2ZYGA 4H13B 3UIAA 3G3ZA 1HBWA 1JY2O 1PGJA 3CCUP 1JMMA 1W5CE 3ITKA 5GTIH 5KLVE 1LTGC 1Q81Q 2OYIB 1KD1Q 2FYUE 3U59A 2YO3A 1IO4A 1PPJD 2WSFJ 4I6MC 3RK3D 2KB7P 2L91A 5KAFE 1BGYG 1H88A 4DJGA 1JUNA 1KN7A 3BCCJ 3L74D 1AQTA 3MHVA 1BDDA 2WSFH 4LLHA 1E79H 2WZ7A 3CCQP 4NPDA 1P84I 5KJ7C 1KB9H 3TF5A 3H1LD 2J5UA 1VQKP 1JMBA 1MKMA 2GUVA 1LTBC 3A2AA 3S1KA 1EZVG 1SQBD 2WWWA 3RGUA 1W2EA 4WY4D 3ZDMA 2KK7A 5APXA 2JWAA 4I1LA 1USEA 1L4AB 2HG5D 2LXCB 4C7NB 5KLIB 1VQPP 3OE7H 2P2UA 1M7LA 1WRGA 2IBZI 2N1TD 4OGQC 5L8RJ 3U1CA 1OW7A 2O01H 3RBXA 4BRYA 1VQ7P 3FKSH 1DEEG 2E74D 2ZT9D 3L70J 1BE3E 1X79B 4KT0J 1R8EA 1U7MA 4QMAA 1H8AA 1FOSE 1LWUC 1JO5A 3E7KA 1MUUA 5AW4B 4N78E 3L75J 2B88A 2E75C 1GU5A 5CJ0A 3H1IJ 1MV8A 3EFGA 4PD4D
chains in the Genus database with same CATH topology
2E5TA 2WSSH 1BSHA 4YXWH 4WVZA 3OFNH 2HLDH 1AQTA 3OAAH 1E79H 4ASUH 2RQ7A 3PJSK 1IFPA 2JDIH 2W6JH 1JEKA 2RQ6A 3EFFK 3OE7H 2CK3H 1BSNA 2XNDH 3OEHH 1H8EH 3FKSH 4TLFA 4DJGA 2E5YA 2QE7H 2XOKH 5FL7H 4QMAA 3USSA 2V7QH 5DN6I 1FS0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5T A;  2WSS H;  1BSH A;  4YXW H;  4WVZ A;  3OFN H;  2HLD H;  1AQT A;  3OAA H;  1E79 H;  4ASU H;  2RQ7 A;  3PJS K;  1IFP A;  2JDI H;  2W6J H;  1JEK A;  2RQ6 A;  3EFF K;  3OE7 H;  2CK3 H;  1BSN A;  2XND H;  3OEH H;  1H8E H;  3FKS H;  4TLF A;  4DJG A;  2E5Y A;  2QE7 H;  2XOK H;  5FL7 H;  4QMA A;  3USS A;  2V7Q H;  5DN6 I;  1FS0 E; 
#chains in the Genus database with same CATH topology
 1SQQ E;  2E76 C;  2P7J A;  3B4S A;  1L0L E;  3AE5 C;  3H1K D;  4UB6 H;  1JY2 P;  1GDT A;  3S4R A;  1N7S B;  2LR2 A;  5AW2 B;  2NRG A;  1J1E C;  1JTH A;  1UIX A;  2QG4 A;  3L73 E;  3PP5 A;  4JF7 A;  1JCD A;  4WWI A;  1PGQ A;  2H88 C;  2FYN B;  3A0H E;  4H44 D;  1J1D B;  4H13 C;  4N3Y B;  1VDF A;  3HUS B;  1L0L K;  2NPS C;  1YYC A;  2IX7 C;  1S2E A;  4GOF A;  2PP6 A;  3TDK A;  2XU6 A;  1ZRT D;  1SQB E;  1VQN P;  2OTJ P;  4GDO A;  2V7Q J;  2IYO A;  4WY4 B;  1LT1 A;  1KYO H;  2OTK E;  1SQB J;  3HE5 A;  1OIP A;  3M91 A;  1ZME C;  3L74 E;  3RL0 g;  1DD4 A;  1RE4 A;  1QVG O;  1VQ6 P;  3AEE C;  3RK2 B;  1FDO A;  3SWY A;  3TNU B;  1D7M A;  1GMJ A;  1YBK A;  2FKW B;  2NPS A;  5APT A;  1LTI C;  2FFD B;  1USD A;  1BSH A;  2C9N Y;  1SQP E;  3H1K J;  3KQG A;  1SQP G;  1KIL A;  1KQL A;  1OVU A;  2UWJ E;  2W8Z A;  3O6Q A;  4IL6 X;  5E79 E;  3SWK A;  2W6J H;  2YMK A;  1K05 A;  4I2L C;  4PD4 E;  1K9M Q;  3L75 E;  3AE2 C;  4WY4 C;  4Y99 C;  1RF1 C;  3F89 A;  3P8C D;  1NTM J;  2WPQ A;  1BSN A;  3CCJ P;  3O8Z A;  3VMX A;  1SFC C;  3AE1 C;  4IL6 H;  3H25 A;  2O01 N;  2OYH B;  2KLU A;  3CPW O;  2N1T A;  2A06 E;  1ZN5 A;  2FXM A;  2OGU A;  1LTA C;  3FXE A;  5APW A;  3IN6 A;  1N8R Q;  1ZXG A;  2B89 A;  2OAR A;  3GF7 A;  4H0L B;  5C39 A;  3SSU A;  1HGZ A;  3AE8 C;  1Y8A A;  2FY8 A;  3CXH I;  2Q1K A;  3EQ2 A;  2P58 A;  1QVF O;  1KB9 I;  3KZI H;  4DCK A;  2IFN A;  2MJZ A;  2M0B A;  2M5A B;  3PH0 A;  3VP9 A;  4YPC A;  5APU A;  2WSS H;  5APQ A;  3P32 A;  1RF1 B;  1J1E B;  2D2C C;  3R4Y A;  1KYO I;  4OH8 B;  2Q3E A;  3T97 A;  2AEM A;  1MFZ A;  4ASV A;  3L4F A;  1M56 D;  2ZVN B;  1TU3 F;  4JBZ A;  3HE4 B;  3LW5 H;  1KB9 D;  1M1J C;  4I7Z B;  1NTK J;  1SQQ D;  1R5L A;  3CI9 A;  2QIW A;  3FXD A;  4Y28 J;  3AE9 C;  3V2P A;  4C7R A;  3D6Z A;  1VQ8 P;  2IPP A;  2AEF A;  1SQP D;  2C0W A;  3H32 B;  4HH2 A;  1Q2N A;  3H1L G;  4EDF A;  1AFO A;  1NTZ K;  2M8R A;  3MZW B;  1Z56 A;  5GTI E;  2W6B A;  3L75 D;  3CWB J;  2OYH A;  1NVO A;  1FJP A;  1FJK A;  2XOK H;  3B8E B;  1NKN A;  3H1J G;  4B86 A;  3M9H A;  3RK2 C;  3OAK A;  4W7Z A;  3I55 P;  1FZC C;  3Q5R A;  3MD0 A;  3S9O A;  3TYY A;  4AUW A;  3L73 J;  2XZR A;  2HR3 A;  1WT6 A;  5AVU B;  5AVX B;  1N73 C;  1IFM A;  5DJT B;  2QRX A;  1CZQ A;  2OYI A;  1L4A D;  1KIL D;  1KYO D;  2AEJ A;  2WSC H;  3E1R A;  4GKG A;  4GOE A;  3Q1M A;  4ASU H;  1BCC D;  1YQ4 C;  3MUD A;  1SFC B;  1QL1 A;  3H6P A;  4OWF A;  2LXB A;  3H1I G;  1CI6 A;  5AW3 B;  5KLV K;  2IFM A;  3Q5P A;  1VQM P;  1GK4 A;  1YTZ I;  1LT9 C;  1N7S A;  2BCC G;  1KOR A;  1LP1 A;  2KZI A;  1IK7 A;  2YKO A;  3FWN A;  1QX8 A;  1FZC B;  2P67 A;  1SQX E;  4H0L C;  3LID A;  2RH0 A;  4M3L A;  2JJL A;  1EDK A;  1ZLL A;  1RQU A;  2QSI A;  3L70 G;  2JEE A;  5KLI C;  5KKZ C;  1EC5 A;  1L4A C;  1SQX J;  3V5B A;  1HVV A;  2YNY A;  3C9I A;  3OA7 A;  4UB8 H;  2ZXE B;  3P8C E;  3JSV C;  1G1I A;  3HD7 A;  5APY A;  1HWT C;  3GW6 A;  2FXP A;  2YKQ A;  2R44 A;  2D2C B;  3L72 D;  1SP4 A;  2JWD A;  3M0A A;  3QWO C;  4PD4 H;  4A7P A;  1EDI A;  2O1K A;  2PAJ A;  5CCH C;  1LWU A;  1OMI A;  3M9Q A;  2O1J A;  3OFN H;  3RL0 B;  3VTP C;  1L0N G;  1MZ9 A;  3RK3 C;  5AVS B;  1FE6 A;  2E75 B;  1URQ D;  3HTK B;  3L35 A;  3PJS K;  1L4A A;  1BGY J;  3AED C;  1PZQ A;  4H13 D;  3V2R A;  2IDB A;  3HRN A;  1UII A;  4PV1 B;  5H2F E;  1NU1 D;  2KXP B;  1EDJ A;  3KDP B;  3L70 D;  2RQ6 A;  1KIL E;  4EOT A;  2YXQ B;  3KPE A;  1KTM A;  3H1L E;  3OEH H;  1R5S A;  2I1K A;  1VQ9 P;  2QA4 P;  2WT7 B;  3H1I D;  3CC2 P;  3VMY A;  1KB9 E;  1M1K Q;  2ZJS E;  1SVF A;  2KI7 B;  1KFN A;  3HUS C;  2JP3 A;  5CJ4 A;  3T97 B;  2Z4E A;  3RL0 C;  3NTN A;  3A0H H;  3QH9 A;  1YJ9 P;  2KNC A;  1KYO E;  3G4S P;  1N73 B;  1IJD B;  2RKL A;  1L0L J;  1EDL A;  4C46 A;  2G3A A;  4WY4 A;  4BWN A;  1U7J A;  3AEF C;  3CWB E;  2XV5 A;  2QJK B;  2WMM A;  2WT7 A;  4WVZ A;  1KIL C;  3L71 D;  2D2C D;  2Q5U A;  4AQR D;  3KXD A;  4RES B;  2H8P D;  3H1J D;  1OVV A;  5AW1 B;  2QEX P;  1SQX D;  1Q86 Q;  2YO2 A;  4OGQ D;  2PFX A;  1IFP A;  2RQ7 A;  3KZI E;  1RQV A;  3L73 G;  1JCC A;  3WU2 E;  1SQQ K;  2O01 J;  2YKP A;  3SWF A;  3CMA P;  1VQ5 P;  2C9L Y;  1H0T B;  3Q5S A;  1EZV D;  3G9R A;  3H1J J;  4ASW A;  1GTW A;  1L0N J;  5B5E H;  1NAY A;  1ZOY C;  1NH4 A;  2QVA A;  3RK2 D;  2K9J A;  1SQQ G;  4L74 A;  4IL6 E;  1NJI Q;  2SPZ A;  4W80 A;  2E5Y A;  1DH3 A;  3L73 D;  2R5D A;  1SQV D;  2A45 H;  2QJK C;  4WB4 A;  1RE3 C;  3P7K A;  2FFD A;  3P8M C;  3IF4 A;  1GL2 C;  3PRJ A;  5KAI E;  1NTM K;  1HUC A;  3EWK A;  2M3B A;  3L36 A;  4GIF A;  4BXL A;  3D6Y A;  1E5W A;  1WMK A;  1S5L E;  1ZRT E;  1FS0 E;  1LJ2 A;  1GU4 A;  4PV1 C;  3L70 E;  1P84 D;  3M06 A;  2W90 A;  2RN0 A;  4ZKP A;  3G6E P;  2KYV A;  3E1I A;  3VMA A;  2Y0C A;  1KQS O;  1HJ0 A;  1NU1 G;  3L72 E;  1AQ5 A;  1NTM E;  2NPS D;  1K73 Q;  3CLQ A;  3H1I E;  5CCH A;  2XKM A;  1JM0 A;  2R5B A;  3BRT B;  1PIX A;  3CXH D;  1IFD A;  3EFF K;  3WUT A;  3Q2Y A;  3B5N D;  2MKV A;  2E74 C;  2FYU K;  2ZT9 C;  1SS1 A;  2N9Y B;  1BGY E;  2A06 G;  3C8V A;  2O3J A;  3PLN A;  4I7Z C;  1JNM A;  1NHL A;  1AJY A;  3W67 A;  1KV4 A;  1KQG B;  1L2P A;  3CWB D;  2IBZ D;  1SLQ A;  2GM4 A;  5FL7 H;  2E75 D;  1K8A Q;  4KHX A;  1OX3 A;  3H1J E;  3H1L J;  4K3A A;  5DN6 I;  2OTL P;  4PJ0 H;  1LT9 A;  1N7S C;  4L73 A;  3WU2 H;  2A06 D;  1RY3 A;  1KFM A;  1KQF B;  2WSE H;  2C0X A;  1JOC A;  4XFJ A;  1NTK G;  1SQV E;  1NU1 J;  5KJ7 D;  2M3E A;  3F5H A;  4YXW H;  2BCC D;  2GA1 A;  4OVN F;  5KJ7 A;  5KAF H;  1CW5 A;  1AVO A;  1SQB K;  2E74 B;  2ZT9 B;  5KLV G;  1T2K D;  3MGN A;  3GHG B;  1BE3 G;  1X9V A;  1IK9 A;  3HD7 C;  2GUS A;  3AEG C;  1NO4 A;  3B71 A;  1U57 A;  1FC2 C;  3L71 E;  4KJM A;  5CBN A;  2E43 A;  5B66 H;  3BCC D;  1HTL C;  2K1A A;  1HJB A;  1Y9B A;  3LW5 J;  1X22 A;  1URQ C;  1LT9 B;  2YMY A;  3B5N A;  2M5A A;  3CXH E;  1EZV E;  1IC2 A;  1P84 E;  2HPC B;  2FFD C;  3CME P;  2JKV A;  4HB1 A;  1A02 F;  1RE3 A;  3AE6 C;  3BAT A;  2H7H A;  2HFE D;  3FGA D;  4U7J A;  1XTG B;  1NTM D;  3M0D C;  5AVT B;  1RF0 C;  1FU1 A;  2KIK A;  1NTZ G;  1NKZ B;  1EXI A;  3CC4 P;  2IBZ E;  1DD3 A;  1G2C A;  3HD7 B;  2E5T A;  2CPB A;  1L0N E;  2AXC A;  2V4H A;  1IFJ A;  2WPR A;  1NYH A;  5TIS E;  2QJY C;  3GMA A;  5APV A;  5AVW B;  2Z5I A;  1N73 A;  4RJT A;  1JTH B;  1YJW P;  1LGH B;  3L75 G;  1PP9 J;  2P1J A;  2FBW C;  5AW8 B;  1FZC A;  3JCU H;  3RL0 D;  3GHG A;  2W27 A;  2I8D A;  3LIE A;  3L71 G;  3CCS P;  1N2D C;  2ZYD A;  3NFQ A;  1CI6 B;  1ZW0 A;  4D6T G;  2OYH C;  1BCC E;  1KMI Z;  2R32 A;  3D70 A;  1GW3 A;  2Q9I A;  3CC7 P;  1H8E H;  1SQB G;  1HH0 A;  2W83 C;  3R2P A;  3CX5 H;  4WBA A;  5CBO A;  2N1T C;  1NTZ D;  2N9B A;  4NPE A;  5BU8 B;  1NTK K;  3BCC E;  1J2J B;  1NWQ A;  3VYI A;  1IFN A;  1GD2 E;  3CX5 D;  1VF5 B;  4K35 A;  3SFD C;  3A3Y B;  1DX7 A;  1FOS F;  2AXT H;  1YQ3 C;  4ZNC A;  2K37 A;  2Q3I A;  3BAS A;  1FDM A;  3GG2 A;  1W2B O;  2HPC A;  1GW4 A;  3V4Q A;  1NGM B;  1HF9 A;  2KS1 B;  3TSI A;  2WIT A;  3CX5 I;  1GL2 A;  5AVY B;  2E42 A;  1KIL B;  3O6Q B;  2QM7 A;  1HGV A;  1JEK A;  1L0N D;  1RE4 C;  3L37 A;  4DZO A;  1NU1 K;  1T3J A;  2I1J A;  1KZU B;  2ITA A;  2XND H;  4JYB A;  5KLV D;  1L0N K;  3VOP A;  2OQQ A;  3G71 P;  3M9B A;  3H1H J;  1OVR A;  1VF5 D;  1SFC A;  2QJP C;  2B87 B;  1NU1 E;  1PPJ E;  1XTC C;  2FYZ A;  2QE7 H;  3L72 G;  2KUB A;  4D6T J;  3TGU J;  3K5B A;  3H1H E;  3H1H G;  3L71 J;  1LTT C;  3AE4 C;  1M8O B;  2HOD A;  3KHU A;  2KSJ A;  2NPS B;  1OWA A;  2W6A A;  2QJY B;  2POH A;  3WUV A;  1URQ A;  2YIU C;  3AEB C;  5CCG A;  4IFF A;  4JPZ B;  1AV1 A;  2Y0D A;  1AA0 A;  1JY3 N;  1SQX K;  3IR9 A;  4ZMD A;  4GOD A;  3CCR P;  2Z5H A;  2K9Y A;  4L76 A;  4EIJ A;  1VQ4 P;  1AVY A;  2IYP A;  3BCC G;  5CMZ A;  2WSE J;  4AYC A;  4UB6 E;  2ZXX A;  3I5C A;  3TK1 A;  4EYY Q;  5KKZ B;  4IFM A;  5EFW B;  1PGP A;  3HTK A;  5CCG D;  2FYU G;  2YXR B;  3H32 A;  3HUS A;  1GZL A;  2CK3 H;  4TT3 H;  1ZR4 A;  2LKM A;  1FZF A;  1X0T A;  1KC8 Q;  1QL2 A;  5GTH H;  2OYI C;  4LGD E;  2BAS A;  3CX5 E;  3AE3 C;  4TLF A;  1YTZ T;  2YIU B;  4DOJ A;  3D71 A;  1FZG A;  5GTH E;  1OXZ A;  1N7S D;  1QEX A;  4Y99 B;  2J58 A;  1MFT A;  5AVQ B;  3TNU A;  5CCH D;  3JC2 2;  3A0B H;  1YJN P;  2H89 C;  3C1L A;  4L75 A;  3USS A;  1SQP J;  1BCC J;  3H1K E;  3IAO A;  1SQV J;  3KYQ A;  2B9B A;  3JCU E;  1Q90 D;  1IFI A;  3IFM A;  1IZN B;  3II6 A;  3L72 J;  2ZAE B;  1YHQ P;  3V4W A;  3BVH A;  3H1H D;  3HE5 B;  5BVZ A;  1PGO A;  2IBZ G;  1M90 Q;  2J59 M;  2ZYA A;  2R3C A;  4W7Y A;  3TGU E;  4U3F G;  3CXH H;  4RO0 A;  4C7N A;  1DIP A;  1VQO P;  3OAA H;  4D6T D;  4H44 C;  2H43 A;  1M1J A;  4DT0 A;  2WTY A;  3W68 A;  4PD4 I;  5AW6 B;  2K9J B;  2QM8 A;  3U1A A;  4BRY B;  2QJP B;  2KP8 A;  3L74 G;  2Q7C A;  5B66 E;  1ZP0 C;  5TJH A;  3OJA B;  3V6I A;  3CCV P;  1LTJ A;  1N86 A;  1LWU B;  4HKZ H;  1G2C B;  2Q6Q A;  1M1J B;  1NOH A;  2L5G B;  2RMZ A;  3AEC C;  1PV3 A;  3NXS A;  4LC1 A;  1FZB A;  1QGK B;  3CL3 D;  3NMD A;  3RBZ A;  5CHX A;  5KAI H;  1NTM G;  2KOG A;  2PGD A;  4PV1 D;  4U3F J;  1S9K E;  3MUD C;  1BGY D;  1URQ B;  3WMM 0;  1JY3 O;  2HYN A;  1RF0 A;  3M0D A;  4R4M A;  1JY3 P;  1EQ7 A;  1S72 P;  3CCL P;  1FDI A;  1S1C X;  2CPS A;  1S5L H;  2HOD B;  3MTU E;  3VN0 A;  1NTK E;  1SQV G;  1L0L G;  1OW6 A;  2KNC B;  3AEA C;  1LTS C;  1OZH A;  2HLD H;  1GK6 A;  2IZ0 A;  2BEQ D;  2B87 A;  3BRV B;  1LP1 B;  3MP7 B;  2R3S A;  2JR8 A;  4ZKU A;  3HE4 A;  1PFI A;  2BCC J;  1S5L X;  2ZVO B;  4YTP C;  1PP9 D;  4Z1M H;  5AW5 B;  2IZ1 A;  1LTJ C;  4R4L A;  2K3R A;  1NAF A;  1S3J A;  2WPV B;  3N4X A;  1RHZ B;  1OFC X;  2BCC E;  5CCG C;  2K88 A;  2KS1 A;  2KSE A;  1SQP K;  3TGU D;  1H89 A;  3A5T A;  1GL2 B;  5APS A;  1T6A A;  2FYU J;  2JO1 A;  3GLM A;  5DJU B;  1DEB A;  1NTZ J;  2E76 D;  3VMZ A;  2WVR A;  2WPS A;  4HJG H;  5AVR B;  1EZV I;  3CD6 P;  4U3F D;  1YI2 P;  3I56 P;  1Q82 Q;  4XA4 A;  1SQV K;  5E79 H;  1FZE A;  2KLV A;  2V7Q H;  1S4X A;  4RKU J;  5AVZ B;  1ZR2 A;  2N1T B;  2DW3 A;  2G8Y A;  4PJ0 E;  4H44 B;  1YIT P;  3CWB G;  1G1J A;  5M1B A;  2BEZ F;  5K5G B;  3CCM P;  4YXD C;  1S9K D;  1VF5 C;  1BE3 J;  1T3U A;  3VP8 A;  1JB0 J;  2WQY C;  4MN4 C;  2JDI H;  3RK3 E;  3V2N A;  4O9B A;  3H1K G;  4IOI H;  1N7L A;  3HD7 D;  2KZJ A;  2WSC J;  1VL2 A;  5B5E E;  3V2Q A;  2P10 A;  5KLV J;  4NPF X;  1BE3 D;  2AXT E;  5KTB A;  1RH5 B;  4N6J A;  5AW7 B;  3RK3 B;  1T2K C;  4D6T E;  1VQL P;  1QLE D;  1M57 D;  2FYU D;  2HLO A;  3FX0 A;  4N78 D;  1ZV8 A;  4XE5 B;  4GT1 A;  3PTZ A;  1BDC A;  4EI2 A;  1EXJ A;  2OYO A;  1H0T A;  4OGQ B;  1SFC D;  2VRS A;  1NTK D;  1SQQ J;  3A7O A;  3PHL A;  1PL5 A;  1RF1 A;  3OW2 O;  1FAV A;  4JYC A;  1P84 H;  5AW9 B;  4UB8 E;  3WUU A;  2FXO A;  1T8Z A;  4IFD K;  1OW8 A;  5H2F H;  1YIJ P;  2Y9Z A;  2NZ2 A;  3GHG C;  3AE7 C;  3B5N B;  2XDJ A;  2ZFC A;  1GL2 D;  2Y9Y A;  3GF3 A;  1NTZ E;  5AVV B;  1K04 A;  4HYT B;  1LTJ B;  4U3F E;  5AW0 B;  3Q3D A;  1Y47 A;  1Q7Y Q;  1VPC A;  3L74 J;  1FBM A;  2PRR A;  1CSB A;  2XNX A;  1JY2 N;  3MIW A;  2E76 B;  3ABV C;  3FWL A;  4H0L D;  4JQ0 D;  2A45 I;  4CPG A;  1LNQ A;  3A0B E;  5TIS H;  1L0L D;  1A02 J;  2Y0E A;  1SQX G;  3SFE C;  1BCC G;  1FZA A;  3N7N A;  3TGU G;  1PPJ G;  5BU5 A;  1X8Y A;  3CCE P;  1PP9 E;  1PP9 G;  2FYN C;  3B5N C;  2A45 G;  1J1D C;  2ZYG A;  4H13 B;  3UIA A;  3G3Z A;  1HBW A;  1JY2 O;  1PGJ A;  3CCU P;  1JMM A;  1W5C E;  3ITK A;  5GTI H;  5KLV E;  1LTG C;  1Q81 Q;  2OYI B;  1KD1 Q;  2FYU E;  3U59 A;  2YO3 A;  1IO4 A;  1PPJ D;  2WSF J;  4I6M C;  3RK3 D;  2KB7 P;  2L91 A;  5KAF E;  1BGY G;  1H88 A;  4DJG A;  1JUN A;  1KN7 A;  3BCC J;  3L74 D;  1AQT A;  3MHV A;  1BDD A;  2WSF H;  4LLH A;  1E79 H;  2WZ7 A;  3CCQ P;  4NPD A;  1P84 I;  5KJ7 C;  1KB9 H;  3TF5 A;  3H1L D;  2J5U A;  1VQK P;  1JMB A;  1MKM A;  2GUV A;  1LTB C;  3A2A A;  3S1K A;  1EZV G;  1SQB D;  2WWW A;  3RGU A;  1W2E A;  4WY4 D;  3ZDM A;  2KK7 A;  5APX A;  2JWA A;  4I1L A;  1USE A;  1L4A B;  2HG5 D;  2LXC B;  4C7N B;  5KLI B;  1VQP P;  3OE7 H;  2P2U A;  1M7L A;  1WRG A;  2IBZ I;  2N1T D;  4OGQ C;  5L8R J;  3U1C A;  1OW7 A;  2O01 H;  3RBX A;  4BRY A;  1VQ7 P;  3FKS H;  1DEE G;  2E74 D;  2ZT9 D;  3L70 J;  1BE3 E;  1X79 B;  4KT0 J;  1R8E A;  1U7M A;  4QMA A;  1H8A A;  1FOS E;  1LWU C;  1JO5 A;  3E7K A;  1MUU A;  5AW4 B;  4N78 E;  3L75 J;  2B88 A;  2E75 C;  1GU5 A;  5CJ0 A;  3H1I J;  1MV8 A;  3EFG A;  4PD4 D; 
#chains in the Genus database with same CATH homology
 2E5T A;  2WSS H;  1BSH A;  4YXW H;  4WVZ A;  3OFN H;  2HLD H;  1AQT A;  3OAA H;  1E79 H;  4ASU H;  2RQ7 A;  3PJS K;  1IFP A;  2JDI H;  2W6J H;  1JEK A;  2RQ6 A;  3EFF K;  3OE7 H;  2CK3 H;  1BSN A;  2XND H;  3OEH H;  1H8E H;  3FKS H;  4TLF A;  4DJG A;  2E5Y A;  2QE7 H;  2XOK H;  5FL7 H;  4QMA A;  3USS A;  2V7Q H;  5DN6 I;  1FS0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...