The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
62
|
structure length |
60
|
Chain Sequence |
DNHNLIERRRRFNINDRIKELGTLIPKDPDMRWNKGTILKASVDYIRKLQREQQRAKDLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Restricted Leucine Zipper Dimerization and Specificity of DNA Recognition of the Melanocyte Master Regulator Mitf
pubmed doi rcsb |
| molecule keywords |
MICROPHTHALMIA-ASSOCIATED TRANSCRIPTION FACTOR
|
| molecule tags |
Dna binding protein/dna
|
| source organism |
Mus musculus
|
| total genus |
20
|
| structure length |
60
|
| sequence length |
62
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2012-05-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00010 | HLH | Helix-loop-helix DNA-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | MYOD Basic-Helix-Loop-Helix Domain, subunit B | Helix-loop-helix DNA-binding domain |
#chains in the Genus database with same CATH superfamily 4ATI A; 3MUJ A; 2QL2 A; 2QL2 B; 4AYA A; 5EYO A; 1NKP B; 2MH3 A; 4ATK A; 1NKP A; 2LFH A; 1AN4 A; 4F3L B; 4H10 A; 4F3L A; 4H10 B; 3U5V A; 4ATH A; 1R05 A; 1AM9 A; 1A0A A; 1MDY B; 1MDY A; 1NLW B; 1NLW A; 2YPA B; 1AN2 A; 2YPA A; 2YPB A; 2YPB B; 1HLO A; 5I50 A; 1UKL C; 5I4Z A; #chains in the Genus database with same CATH topology 4ATI A; 3MUJ A; 2QL2 A; 2QL2 B; 4AYA A; 5EYO A; 1NKP B; 2MH3 A; 4ATK A; 1NKP A; 2LFH A; 1AN4 A; 4F3L B; 4H10 A; 4F3L A; 4H10 B; 3U5V A; 1ZZA A; 4ATH A; 1R05 A; 1AM9 A; 1A0A A; 1MDY B; 1MDY A; 1NLW B; 1NLW A; 2YPA B; 1AN2 A; 2YPA A; 1K1F A; 2YPB A; 2YPB B; 1HLO A; 5I50 A; 1UKL C; 5I4Z A; #chains in the Genus database with same CATH homology 4ATI A; 3MUJ A; 2QL2 A; 2QL2 B; 4AYA A; 5EYO A; 1NKP B; 2MH3 A; 4ATK A; 1NKP A; 2LFH A; 1AN4 A; 4F3L B; 4H10 A; 4F3L A; 4H10 B; 3U5V A; 4ATH A; 1R05 A; 1AM9 A; 1A0A A; 1MDY B; 1MDY A; 1NLW B; 1NLW A; 2YPA B; 1AN2 A; 2YPA A; 2YPB A; 2YPB B; 1HLO A; 5I50 A; 1UKL C; 5I4Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
