The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
227
|
structure length |
227
|
Chain Sequence |
HTIFQKVSVNGADQGQLKGIRAPANNNPVTDVMSSDIICNAVTMKDSNVLTVPAGAKVGHFWGHEIGGAAGPNDADNPIAASHKGPIMVYLAKVDNAATTGTSGLKWFKVAEAGLSNGKWAVDDLIANNGWSYFDMPTCIAPGQYLMRAELIALHNAGSQAGAQFYIGCAQINVTGGGSASPSNTVSFPGAYSASDPGILINIYGGSGKTDNGGKPYQIPGPALFTC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural and Functional Characterization of a Lytic Polysaccharide Monooxygenase with Broad Substrate Specificity
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Neurospora crassa (strain atcc 24698 / 74-or23-1a / cbs 708.71 / dsm 1257 / fgsc
|
molecule keywords |
ENDOGLUCANASE II
|
total genus |
52
|
structure length |
227
|
sequence length |
227
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-11-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03443 | Glyco_hydro_61 | Glycosyl hydrolase family 61 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | Coagulation Factor XIII; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 3EII A; 3EJA A; 4EIS A; 4MAI A; 2VTC A; 5ACG A; 4EIS B; 4QI8 A; 3ZUD A; 4D7U A; 4MAH A; 4EIR A; 5ACJ A; 5ACH A; 4D7V A; 5ACI A; 2YET A; 4B5Q A; 5FOH A; 4FMR A; 5ACF A; #chains in the Genus database with same CATH topology 4OY8 A; 2BXW A; 4A02 A; 2JHU A; 4MAI A; 2VTC A; 2JHS A; 1GDF A; 1RHO A; 4ALR A; 4ALT A; 5EMV A; 5E8F A; 5DQ8 A; 2BEM A; 4MAH A; 5FJQ A; 5DQE A; 1DS6 B; 5ACJ A; 4JV6 B; 5ACH A; 5ACI A; 5TAR B; 5FOH A; 3EJA A; 5HGU A; 5HNP A; 1KSH B; 4EIS B; 5L7K A; 2JI0 A; 4JVF B; 4OY7 A; 4QI8 A; 2YOW A; 4RE1 A; 4OY6 A; 3JUA A; 2JHX A; 3KYS A; 3T5G B; 5HNO A; 1QVY A; 4JHP B; 5FTZ A; 2R5O A; 2JHZ A; 1FT3 A; 2YET A; 4B5Q A; 5F2U A; 5AA7 A; 2YOX A; 5ACF A; 1DOA B; 4ALC A; 4EIS A; 5ACG A; 5E80 A; 4ALQ A; 3GQQ A; 4JVB B; 2YOY A; 4ALS A; 4D7U A; 4F38 B; 4GOK C; 4ALE A; 4GOJ C; 1KSJ B; 2XWX A; 4D7V A; 1KMT A; 4LN0 A; 1HH4 D; 4FMR A; 1AJW A; 3EII A; 2JHT A; 3UAM A; 1KSG B; 2JHV A; 2LHS A; 2JHY A; 1FT0 A; 3RBQ A; 1FSO A; 3ZUD A; 1FST A; 4GBO A; 4EIR A; 3L15 A; 5EMW A; 5IJU A; 5TB5 B; 4JV8 B; 2BEN A; 3T5I A; 2JHW A; #chains in the Genus database with same CATH homology 3EII A; 3EJA A; 5HGU A; 4EIS A; 4MAI A; 2VTC A; 5ACG A; 4EIS B; 4QI8 A; 5EMV A; 3ZUD A; 4D7U A; 5DQ8 A; 4RE1 A; 4MAH A; 3JUA A; 3KYS A; 4EIR A; 3L15 A; 5DQE A; 5EMW A; 5ACJ A; 5ACH A; 4D7V A; 5ACI A; 4LN0 A; 2YET A; 4B5Q A; 5FOH A; 4FMR A; 5ACF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...