The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
102
|
structure length |
97
|
Chain Sequence |
CKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGKVECINQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and functional analysis of IPSE/alpha-1, an IL-4-inducing factor secreted from Schistosoma mansoni eggs, reveals an IgE-binding crystallin fold
rcsb |
| molecule keywords |
IL-4-inducing protein
|
| molecule tags |
Signaling protein
|
| source organism |
Schistosoma mansoni
|
| total genus |
17
|
| structure length |
97
|
| sequence length |
102
|
| ec nomenclature | |
| pdb deposition date | 2012-04-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18258 | IL4_i_Ig | Interleukin-4 inducing immunoglobulin-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Gamma-B Crystallin; domain 1 | Crystallins |
#chains in the Genus database with same CATH superfamily 1GAM A; 2KFB A; 4GCR A; 4EL6 A; 3ENU A; 4GR7 A; 1PRS A; 2M3C A; 5HT8 A; 1ZWO A; 1NPS A; 2A5M A; 2DAD A; 1PRR A; 1HDF A; 2G98 A; 1ZIQ A; 3HZ2 A; 4PSP A; 4W9A A; 1M8U A; 2M3U A; 1A5D A; 4AKA A; 3QK3 A; 1ZIE A; 2NBR A; 1BD7 A; 4PSR A; 4IAU A; 3SO0 A; 2B1O A; 1E7N A; 1AG4 A; 1OKI A; 1A45 A; 1AMM A; 2BB2 A; 4W9B A; 3SNY A; 1ZIR A; 2V2U A; 2JDF A; 3SNZ A; 3CW3 A; 3I9H A; 1DSL A; 3IAJ A; 1ZWM A; 2JDG A; 3LWK A; 1YHP A; 1BLB A; 3ENT A; 1ELP A; 1I5I A; 2K1X A; 4FD9 A; 2KP5 A; 2M3T A; 5HT9 A; 1A7H A; 3HZB A; 1HA4 A; 2K1W A; 4JGF A; 1YTQ A; 1HK0 X; 1GCS A; 3SO1 A; 1ZGT A; 2BV2 A; 4NI3 A; 1H4A X; #chains in the Genus database with same CATH topology 2KFB A; 4EL6 A; 2M3C A; 1NPS A; 2A5M A; 4PSP A; 1HDF A; 4IAU A; 1E7N A; 1OKI A; 2JDF A; 3SNZ A; 3CW3 A; 3IAJ A; 3LWK A; 3ENT A; 2K1X A; 4FD9 A; 2M3T A; 1HA4 A; 2BV2 A; 1GAM A; 4GCR A; 1G6E A; 4W9A A; 5HT9 A; 2G98 A; 1ZIQ A; 2NBR A; 4PSR A; 3SO0 A; 2B1O A; 1AG4 A; 1A45 A; 2V2U A; 1DSL A; 2JDG A; 1BLB A; 1I5I A; 1A7H A; 4JGF A; 1HK0 X; 1GCS A; 4NI3 A; 1H4A X; 1GH5 A; 3ENU A; 2DAD A; 1PRR A; 1C01 A; 1M8U A; 1A5D A; 3QK3 A; 1ZIE A; 1BD7 A; 1WKT A; 3SNY A; 1ZIR A; 1F53 A; 3I9H A; 1ZWM A; 1YHP A; 1BHU A; 2KP5 A; 3HZB A; 3SO1 A; 4W9B A; 4GR7 A; 1PRS A; 5HT8 A; 1ZWO A; 3HZ2 A; 4AKA A; 2M3U A; 1AMM A; 2BB2 A; 3UJZ A; 1ELP A; 2K1W A; 1YTQ A; 1ZGT A; #chains in the Genus database with same CATH homology 1GAM A; 2KFB A; 4GCR A; 4EL6 A; 3ENU A; 4GR7 A; 1PRS A; 2M3C A; 5HT8 A; 1ZWO A; 1NPS A; 2A5M A; 2DAD A; 1PRR A; 1HDF A; 2G98 A; 1ZIQ A; 3HZ2 A; 4PSP A; 4W9A A; 1M8U A; 2M3U A; 1A5D A; 4AKA A; 3QK3 A; 1ZIE A; 2NBR A; 1BD7 A; 4PSR A; 4IAU A; 3SO0 A; 2B1O A; 1E7N A; 1AG4 A; 1OKI A; 1A45 A; 1AMM A; 2BB2 A; 4W9B A; 3SNY A; 1ZIR A; 2V2U A; 2JDF A; 3SNZ A; 3CW3 A; 3I9H A; 1DSL A; 3IAJ A; 1ZWM A; 2JDG A; 3LWK A; 1YHP A; 1BLB A; 3ENT A; 1ELP A; 1I5I A; 2K1X A; 4FD9 A; 2KP5 A; 2M3T A; 5HT9 A; 1A7H A; 3HZB A; 1HA4 A; 2K1W A; 4JGF A; 1YTQ A; 1HK0 X; 1GCS A; 3SO1 A; 1ZGT A; 2BV2 A; 4NI3 A; 1H4A X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...