The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
63
|
structure length |
63
|
Chain Sequence |
KAMINLHIQKDNPKIVHAFDGEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Allosteric control in a metalloprotein dramatically alters function.
pubmed doi rcsb |
molecule tags |
Metal binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
CDGSH iron-sulfur domain-containing protein 1
|
total genus |
11
|
structure length |
63
|
sequence length |
63
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2012-05-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09360 | zf-CDGSH | Iron-binding zinc finger CDGSH type |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Ribosomal Protein L9; domain 1 | Ribosomal Protein L9; domain 1 |
#chains in the Genus database with same CATH superfamily 3TBN A; 3REE A; 4F1E A; 3EW0 A; 3FNV A; 3TBO A; 2QH7 A; 3LPQ A; 4OOA A; 4F28 A; 3S2Q A; 3S2R A; 2R13 A; 4EZF A; 4F2C A; 2QD0 A; 4OO7 A; #chains in the Genus database with same CATH topology 3REE A; 4FSD A; 3FND A; 3FNV A; 2HVF A; 2OUT A; 1DIV A; 2E9X D; 2X4A A; 4OOA A; 2Q9Q B; 4F28 A; 2R13 A; 1CQU A; 3S2Q A; 3CO4 A; 2E9X B; 2LSM A; 3J7Z H; 2QH7 A; 3S2R A; 5GHS C; 2QD0 A; 4OO7 A; 3TBN A; 3ANW A; 4FS8 A; 3TBO A; 4RSR A; 5EG5 A; 4KW7 A; 4F2C A; 2HBB A; 2EHO C; 2Q9Q A; 4F1E A; 3EW0 A; 4UY8 H; 3LPQ A; 2HJQ A; 5GHR B; 4EZF A; 4FR0 A; 2HBA A; 2X49 A; #chains in the Genus database with same CATH homology 3REE A; 4FSD A; 3FNV A; 2OUT A; 2E9X D; 2X4A A; 4OOA A; 2Q9Q B; 4F28 A; 2R13 A; 3S2Q A; 2E9X B; 2LSM A; 2QH7 A; 3S2R A; 5GHS C; 2QD0 A; 4OO7 A; 3TBN A; 3ANW A; 4FS8 A; 3TBO A; 4RSR A; 5EG5 A; 4KW7 A; 4F2C A; 2EHO C; 2Q9Q A; 4F1E A; 3EW0 A; 3LPQ A; 5GHR B; 4EZF A; 4FR0 A; 2X49 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...