4AKBA

Structure of galactose binding lectin from champedak (cgb) with galactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITGFTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
pubmed doi rcsb
molecule keywords AGGLUTININ ALPHA CHAIN
molecule tags Sugar binding protein
total genus 30
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4akbA00
1KU8A 2JZ4A 3VY6A 2BN0A 4R6PA 3VY7A 1XEZA 1X1VA 1ZGRA 3LL1A 3WOCA 3APAA 4R6OA 5J4TA 4R6QA 4DDNA 1TP8A 1JOTA 1J4SA 1WS5C 3VZGA 1ZGSA 2NU5A 1VBPA 1J4UA 3O44A 1UGWC 3LL0A 1WS5A 1UGXA 3R51A 2BMYA 1UGWA 3LLZA 5J4XA 3LL2A 2GUXA 5AV7A 3VZFA 3VZEA 4PITA 1UH1A 2GUCA 4GX7A 1UH0A 5J51A 3P8SA 5JM1A 3R50A 4R6NA 4AKCA 1PXDA 3AQGA 1M26A 1TOQA 4R6RA 5J50A 1XXRA 1J4TA 2GUEA 4MQ0A 1C3NA 1OUWA 1C3MA 3MIUA 2GTYA 1KUJA 1C3KA 4PIKA 4PIUA 1VBOA 1WS4C 2BMZA 3LKYA 2GUDA 3LLYA 3LM1A 4AKDA 1JACA 3MIVA 1WS4A 2HYQA 3WOBA 2NUOA 4AK4A 5BN6E 4WOGA 1UGYC 4AKBA 4PIFA 1XXQA 2HYRA 3R52A 3MITA 5EXGA 1UGYA
chains in the Genus database with same CATH superfamily
1KU8A 2JZ4A 3VY6A 2BN0A 4R6PA 4W8JA 3VY7A 1XEZA 1X1VA 1ZGRA 3LL1A 3WOCA 3APAA 4R6OA 5J4TA 4R6QA 4DDNA 1TP8A 1JOTA 1J4SA 1WS5C 3VZGA 1ZGSA 2NU5A 1VBPA 4D8MA 1J4UA 3O44A 1UGWC 3LL0A 1WS5A 1UGXA 3R51A 2BMYA 1UGWA 3LLZA 5J4XA 3LL2A 3TOWA 2GUXA 5AV7A 2C9KA 3VZFA 3VZEA 4PITA 1UH1A 4ARXA 2GUCA 4GX7A 1UH0A 5J51A 3P8SA 5JM1A 3R50A 4R6NA 4AKCA 1PXDA 3AQGA 1M26A 1CIYA 1TOQA 1I5PA 4R6RA 4ARYA 5J50A 1XXRA 4QX2A 4QX0A 1J4TA 2GUEA 4MQ0A 1C3NA 1OUWA 4MOAA 1C3MA 2QP2A 3MIUA 1DLCA 1W99A 2GTYA 1KUJA 1C3KA 4PIKA 4PIUA 1VBOA 1WS4C 2BMZA 3LKYA 4QX3A 2GUDA 3LLYA 3LM1A 4AKDA 1JACA 1VMOA 3EB7A 3MIVA 2HYQA 1WS4A 3WOBA 2NUOA 4AK4A 5BN6E 4WOGA 1UGYC 4AKBA 4PIFA 1XXQA 2HYRA 3R52A 1JI6A 4QX1A 3MITA 5EXGA 1UGYA
chains in the Genus database with same CATH topology
1KU8A 2JZ4A 3VY6A 2BN0A 4R6PA 3VY7A 1XEZA 1X1VA 1ZGRA 3LL1A 3WOCA 3APAA 4R6OA 5J4TA 4R6QA 4DDNA 1TP8A 1JOTA 1J4SA 1WS5C 3VZGA 1ZGSA 2NU5A 1VBPA 1J4UA 3O44A 1UGWC 3LL0A 1WS5A 1UGXA 3R51A 2BMYA 1UGWA 3LLZA 5J4XA 3LL2A 2GUXA 5AV7A 3VZFA 3VZEA 4PITA 1UH1A 2GUCA 4GX7A 1UH0A 5J51A 3P8SA 5JM1A 3R50A 4R6NA 4AKCA 1PXDA 3AQGA 1M26A 1TOQA 4R6RA 5J50A 1XXRA 1J4TA 2GUEA 4MQ0A 1C3NA 1OUWA 1C3MA 3MIUA 2GTYA 1KUJA 1C3KA 4PIKA 4PIUA 1VBOA 1WS4C 2BMZA 3LKYA 2GUDA 3LLYA 3LM1A 4AKDA 1JACA 3MIVA 1WS4A 2HYQA 3WOBA 2NUOA 4AK4A 5BN6E 4WOGA 1UGYC 4AKBA 4PIFA 1XXQA 2HYRA 3R52A 3MITA 5EXGA 1UGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU8 A;  2JZ4 A;  3VY6 A;  2BN0 A;  4R6P A;  3VY7 A;  1XEZ A;  1X1V A;  1ZGR A;  3LL1 A;  3WOC A;  3APA A;  4R6O A;  5J4T A;  4R6Q A;  4DDN A;  1TP8 A;  1JOT A;  1J4S A;  1WS5 C;  3VZG A;  1ZGS A;  2NU5 A;  1VBP A;  1J4U A;  3O44 A;  1UGW C;  3LL0 A;  1WS5 A;  1UGX A;  3R51 A;  2BMY A;  1UGW A;  3LLZ A;  5J4X A;  3LL2 A;  2GUX A;  5AV7 A;  3VZF A;  3VZE A;  4PIT A;  1UH1 A;  2GUC A;  4GX7 A;  1UH0 A;  5J51 A;  3P8S A;  5JM1 A;  3R50 A;  4R6N A;  4AKC A;  1PXD A;  3AQG A;  1M26 A;  1TOQ A;  4R6R A;  5J50 A;  1XXR A;  1J4T A;  2GUE A;  4MQ0 A;  1C3N A;  1OUW A;  1C3M A;  3MIU A;  2GTY A;  1KUJ A;  1C3K A;  4PIK A;  4PIU A;  1VBO A;  1WS4 C;  2BMZ A;  3LKY A;  2GUD A;  3LLY A;  3LM1 A;  4AKD A;  1JAC A;  3MIV A;  1WS4 A;  2HYQ A;  3WOB A;  2NUO A;  4AK4 A;  5BN6 E;  4WOG A;  1UGY C;  4AKB A;  4PIF A;  1XXQ A;  2HYR A;  3R52 A;  3MIT A;  5EXG A;  1UGY A; 
#chains in the Genus database with same CATH topology
 1KU8 A;  2JZ4 A;  3VY6 A;  2BN0 A;  4R6P A;  4W8J A;  3VY7 A;  1XEZ A;  1X1V A;  1ZGR A;  3LL1 A;  3WOC A;  3APA A;  4R6O A;  5J4T A;  4R6Q A;  4DDN A;  1TP8 A;  1JOT A;  1J4S A;  1WS5 C;  3VZG A;  1ZGS A;  2NU5 A;  1VBP A;  4D8M A;  1J4U A;  3O44 A;  1UGW C;  3LL0 A;  1WS5 A;  1UGX A;  3R51 A;  2BMY A;  1UGW A;  3LLZ A;  5J4X A;  3LL2 A;  3TOW A;  2GUX A;  5AV7 A;  2C9K A;  3VZF A;  3VZE A;  4PIT A;  1UH1 A;  4ARX A;  2GUC A;  4GX7 A;  1UH0 A;  5J51 A;  3P8S A;  5JM1 A;  3R50 A;  4R6N A;  4AKC A;  1PXD A;  3AQG A;  1M26 A;  1CIY A;  1TOQ A;  1I5P A;  4R6R A;  4ARY A;  5J50 A;  1XXR A;  4QX2 A;  4QX0 A;  1J4T A;  2GUE A;  4MQ0 A;  1C3N A;  1OUW A;  4MOA A;  1C3M A;  2QP2 A;  3MIU A;  1DLC A;  1W99 A;  2GTY A;  1KUJ A;  1C3K A;  4PIK A;  4PIU A;  1VBO A;  1WS4 C;  2BMZ A;  3LKY A;  4QX3 A;  2GUD A;  3LLY A;  3LM1 A;  4AKD A;  1JAC A;  1VMO A;  3EB7 A;  3MIV A;  2HYQ A;  1WS4 A;  3WOB A;  2NUO A;  4AK4 A;  5BN6 E;  4WOG A;  1UGY C;  4AKB A;  4PIF A;  1XXQ A;  2HYR A;  3R52 A;  1JI6 A;  4QX1 A;  3MIT A;  5EXG A;  1UGY A; 
#chains in the Genus database with same CATH homology
 1KU8 A;  2JZ4 A;  3VY6 A;  2BN0 A;  4R6P A;  3VY7 A;  1XEZ A;  1X1V A;  1ZGR A;  3LL1 A;  3WOC A;  3APA A;  4R6O A;  5J4T A;  4R6Q A;  4DDN A;  1TP8 A;  1JOT A;  1J4S A;  1WS5 C;  3VZG A;  1ZGS A;  2NU5 A;  1VBP A;  1J4U A;  3O44 A;  1UGW C;  3LL0 A;  1WS5 A;  1UGX A;  3R51 A;  2BMY A;  1UGW A;  3LLZ A;  5J4X A;  3LL2 A;  2GUX A;  5AV7 A;  3VZF A;  3VZE A;  4PIT A;  1UH1 A;  2GUC A;  4GX7 A;  1UH0 A;  5J51 A;  3P8S A;  5JM1 A;  3R50 A;  4R6N A;  4AKC A;  1PXD A;  3AQG A;  1M26 A;  1TOQ A;  4R6R A;  5J50 A;  1XXR A;  1J4T A;  2GUE A;  4MQ0 A;  1C3N A;  1OUW A;  1C3M A;  3MIU A;  2GTY A;  1KUJ A;  1C3K A;  4PIK A;  4PIU A;  1VBO A;  1WS4 C;  2BMZ A;  3LKY A;  2GUD A;  3LLY A;  3LM1 A;  4AKD A;  1JAC A;  3MIV A;  1WS4 A;  2HYQ A;  3WOB A;  2NUO A;  4AK4 A;  5BN6 E;  4WOG A;  1UGY C;  4AKB A;  4PIF A;  1XXQ A;  2HYR A;  3R52 A;  3MIT A;  5EXG A;  1UGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...