4PITA

Crystal structure of banana lectin h84t bound to dimannose
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
AIKVGAWGGNGGSAFDMGPAYRIISVKIFSGDVVDGVDVTFTYYGKTETRHYGGSGGTPHEIVLQEGEYLVGMAGEVANYTGAVVLGKLGFSTNKKAYGPFGNTGGTPFSLPIAAGKISGFFGRGGKFLDAIGVYLEPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a Therapeutic Lectin by Uncoupling Mitogenicity from Antiviral Activity.
pubmed doi rcsb
molecule keywords Ripening-associated protein
molecule tags Sugar binding protein
source organism Musa acuminata
total genus 25
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4pitA00
1VBOA 2BN0A 3VZEA 5J51A 1XXQA 2GUCA 1XEZA 2HYRA 1VBPA 1WS4A 3LL0A 3WOBA 1J4TA 4R6QA 4R6PA 5EXGA 1WS5C 3MIUA 2GUDA 3LL1A 2HYQA 1KU8A 3LLYA 1C3NA 2BMYA 4PIUA 2NU5A 3VZFA 2JZ4A 3LKYA 1J4SA 1TOQA 1ZGSA 1M26A 3R52A 4AKCA 5AV7A 3APAA 4AK4A 1UGWA 1WS5A 1UGYA 1UGWC 1UH1A 1UGYC 5JM1A 2GUEA 2NUOA 4DDNA 4R6NA 5BN6E 3LM1A 4WOGA 1ZGRA 3LLZA 3LL2A 4R6OA 1C3KA 2GUXA 1J4UA 4MQ0A 3WOCA 2GTYA 3O44A 3MIVA 3VY6A 3AQGA 3MITA 1OUWA 4PIFA 1JACA 1PXDA 4PIKA 5J50A 4AKDA 1XXRA 4GX7A 4PITA 4AKBA 3R51A 3R50A 4R6RA 1UGXA 1JOTA 1X1VA 3VZGA 1WS4C 1KUJA 5J4TA 1TP8A 3P8SA 5J4XA 1C3MA 1UH0A 3VY7A 2BMZA
chains in the Genus database with same CATH superfamily
1VBOA 4QX3A 2BN0A 3VZEA 5J51A 1XXQA 1CIYA 2GUCA 1XEZA 4ARXA 2HYRA 1VBPA 1WS4A 3LL0A 3WOBA 1J4TA 2C9KA 4R6QA 4R6PA 5EXGA 4ARYA 1WS5C 3MIUA 2GUDA 3LL1A 4QX0A 2HYQA 1KU8A 4QX1A 3LLYA 1C3NA 2BMYA 4PIUA 2NU5A 2QP2A 3VZFA 2JZ4A 3LKYA 1J4SA 1TOQA 1ZGSA 1M26A 1W99A 3R52A 4AKCA 5AV7A 3APAA 4AK4A 1UGWA 1WS5A 1UGYA 1UGWC 1UH1A 1UGYC 5JM1A 3TOWA 1DLCA 2GUEA 2NUOA 4DDNA 4R6NA 5BN6E 3LM1A 4WOGA 1ZGRA 3LLZA 3LL2A 4R6OA 4D8MA 1C3KA 2GUXA 1J4UA 4MQ0A 3WOCA 2GTYA 3O44A 4W8JA 3MIVA 3VY6A 3EB7A 3AQGA 3MITA 1I5PA 1OUWA 4PIFA 1JACA 1PXDA 4PIKA 1VMOA 5J50A 4AKDA 1XXRA 4GX7A 4PITA 4AKBA 3R51A 3R50A 4MOAA 4R6RA 1UGXA 1JOTA 1X1VA 3VZGA 1WS4C 4QX2A 1JI6A 1KUJA 5J4TA 1TP8A 3P8SA 5J4XA 1C3MA 1UH0A 3VY7A 2BMZA
chains in the Genus database with same CATH topology
1VBOA 2BN0A 3VZEA 5J51A 1XXQA 2GUCA 1XEZA 2HYRA 1VBPA 1WS4A 3LL0A 3WOBA 1J4TA 4R6QA 4R6PA 5EXGA 1WS5C 3MIUA 2GUDA 3LL1A 2HYQA 1KU8A 3LLYA 1C3NA 2BMYA 4PIUA 2NU5A 3VZFA 2JZ4A 3LKYA 1J4SA 1TOQA 1ZGSA 1M26A 3R52A 4AKCA 5AV7A 3APAA 4AK4A 1UGWA 1WS5A 1UGYA 1UGWC 1UH1A 1UGYC 5JM1A 2GUEA 2NUOA 4DDNA 4R6NA 5BN6E 3LM1A 4WOGA 1ZGRA 3LLZA 3LL2A 4R6OA 1C3KA 2GUXA 1J4UA 4MQ0A 3WOCA 2GTYA 3O44A 3MIVA 3VY6A 3AQGA 3MITA 1OUWA 4PIFA 1JACA 1PXDA 4PIKA 5J50A 4AKDA 1XXRA 4GX7A 4PITA 4AKBA 3R51A 3R50A 4R6RA 1UGXA 1JOTA 1X1VA 3VZGA 1WS4C 1KUJA 5J4TA 1TP8A 3P8SA 5J4XA 1C3MA 1UH0A 3VY7A 2BMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBO A;  2BN0 A;  3VZE A;  5J51 A;  1XXQ A;  2GUC A;  1XEZ A;  2HYR A;  1VBP A;  1WS4 A;  3LL0 A;  3WOB A;  1J4T A;  4R6Q A;  4R6P A;  5EXG A;  1WS5 C;  3MIU A;  2GUD A;  3LL1 A;  2HYQ A;  1KU8 A;  3LLY A;  1C3N A;  2BMY A;  4PIU A;  2NU5 A;  3VZF A;  2JZ4 A;  3LKY A;  1J4S A;  1TOQ A;  1ZGS A;  1M26 A;  3R52 A;  4AKC A;  5AV7 A;  3APA A;  4AK4 A;  1UGW A;  1WS5 A;  1UGY A;  1UGW C;  1UH1 A;  1UGY C;  5JM1 A;  2GUE A;  2NUO A;  4DDN A;  4R6N A;  5BN6 E;  3LM1 A;  4WOG A;  1ZGR A;  3LLZ A;  3LL2 A;  4R6O A;  1C3K A;  2GUX A;  1J4U A;  4MQ0 A;  3WOC A;  2GTY A;  3O44 A;  3MIV A;  3VY6 A;  3AQG A;  3MIT A;  1OUW A;  4PIF A;  1JAC A;  1PXD A;  4PIK A;  5J50 A;  4AKD A;  1XXR A;  4GX7 A;  4PIT A;  4AKB A;  3R51 A;  3R50 A;  4R6R A;  1UGX A;  1JOT A;  1X1V A;  3VZG A;  1WS4 C;  1KUJ A;  5J4T A;  1TP8 A;  3P8S A;  5J4X A;  1C3M A;  1UH0 A;  3VY7 A;  2BMZ A; 
#chains in the Genus database with same CATH topology
 1VBO A;  4QX3 A;  2BN0 A;  3VZE A;  5J51 A;  1XXQ A;  1CIY A;  2GUC A;  1XEZ A;  4ARX A;  2HYR A;  1VBP A;  1WS4 A;  3LL0 A;  3WOB A;  1J4T A;  2C9K A;  4R6Q A;  4R6P A;  5EXG A;  4ARY A;  1WS5 C;  3MIU A;  2GUD A;  3LL1 A;  4QX0 A;  2HYQ A;  1KU8 A;  4QX1 A;  3LLY A;  1C3N A;  2BMY A;  4PIU A;  2NU5 A;  2QP2 A;  3VZF A;  2JZ4 A;  3LKY A;  1J4S A;  1TOQ A;  1ZGS A;  1M26 A;  1W99 A;  3R52 A;  4AKC A;  5AV7 A;  3APA A;  4AK4 A;  1UGW A;  1WS5 A;  1UGY A;  1UGW C;  1UH1 A;  1UGY C;  5JM1 A;  3TOW A;  1DLC A;  2GUE A;  2NUO A;  4DDN A;  4R6N A;  5BN6 E;  3LM1 A;  4WOG A;  1ZGR A;  3LLZ A;  3LL2 A;  4R6O A;  4D8M A;  1C3K A;  2GUX A;  1J4U A;  4MQ0 A;  3WOC A;  2GTY A;  3O44 A;  4W8J A;  3MIV A;  3VY6 A;  3EB7 A;  3AQG A;  3MIT A;  1I5P A;  1OUW A;  4PIF A;  1JAC A;  1PXD A;  4PIK A;  1VMO A;  5J50 A;  4AKD A;  1XXR A;  4GX7 A;  4PIT A;  4AKB A;  3R51 A;  3R50 A;  4MOA A;  4R6R A;  1UGX A;  1JOT A;  1X1V A;  3VZG A;  1WS4 C;  4QX2 A;  1JI6 A;  1KUJ A;  5J4T A;  1TP8 A;  3P8S A;  5J4X A;  1C3M A;  1UH0 A;  3VY7 A;  2BMZ A; 
#chains in the Genus database with same CATH homology
 1VBO A;  2BN0 A;  3VZE A;  5J51 A;  1XXQ A;  2GUC A;  1XEZ A;  2HYR A;  1VBP A;  1WS4 A;  3LL0 A;  3WOB A;  1J4T A;  4R6Q A;  4R6P A;  5EXG A;  1WS5 C;  3MIU A;  2GUD A;  3LL1 A;  2HYQ A;  1KU8 A;  3LLY A;  1C3N A;  2BMY A;  4PIU A;  2NU5 A;  3VZF A;  2JZ4 A;  3LKY A;  1J4S A;  1TOQ A;  1ZGS A;  1M26 A;  3R52 A;  4AKC A;  5AV7 A;  3APA A;  4AK4 A;  1UGW A;  1WS5 A;  1UGY A;  1UGW C;  1UH1 A;  1UGY C;  5JM1 A;  2GUE A;  2NUO A;  4DDN A;  4R6N A;  5BN6 E;  3LM1 A;  4WOG A;  1ZGR A;  3LLZ A;  3LL2 A;  4R6O A;  1C3K A;  2GUX A;  1J4U A;  4MQ0 A;  3WOC A;  2GTY A;  3O44 A;  3MIV A;  3VY6 A;  3AQG A;  3MIT A;  1OUW A;  4PIF A;  1JAC A;  1PXD A;  4PIK A;  5J50 A;  4AKD A;  1XXR A;  4GX7 A;  4PIT A;  4AKB A;  3R51 A;  3R50 A;  4R6R A;  1UGX A;  1JOT A;  1X1V A;  3VZG A;  1WS4 C;  1KUJ A;  5J4T A;  1TP8 A;  3P8S A;  5J4X A;  1C3M A;  1UH0 A;  3VY7 A;  2BMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...