4R6RA

Jacalin-carbohydrate interactions. distortion of the ligand as a determinant of affinity.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 28
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4r6rA00
2BMZA 3MIVA 1J4TA 2HYQA 4PIKA 1J4SA 3LL1A 4MQ0A 1C3NA 5J4TA 4DDNA 1VBPA 4AKCA 2NU5A 4AKBA 5J51A 3VZFA 4AKDA 2NUOA 3VZGA 1ZGRA 2BMYA 3AQGA 1TOQA 1XXQA 1UGYA 3LM1A 1WS4C 4R6QA 4PIFA 4GX7A 1OUWA 3LKYA 3MIUA 1WS5A 5J4XA 1PXDA 3WOCA 4R6RA 4R6NA 1KUJA 2HYRA 1M26A 1C3KA 4WOGA 1ZGSA 4R6OA 1XEZA 3R52A 2BN0A 3O44A 1J4UA 2GUEA 1UGWA 3MITA 1JACA 4PITA 3LLZA 5AV7A 5J50A 3VZEA 1UGYC 1C3MA 3R51A 5EXGA 1XXRA 3LL0A 1JOTA 1WS5C 2GUDA 2GTYA 3LL2A 3R50A 2GUXA 3VY6A 4AK4A 1UH0A 2JZ4A 5BN6E 5JM1A 1X1VA 4PIUA 1UGXA 3P8SA 1WS4A 1KU8A 1VBOA 3VY7A 3APAA 4R6PA 1TP8A 1UGWC 3WOBA 1UH1A 2GUCA 3LLYA
chains in the Genus database with same CATH superfamily
4D8MA 3EB7A 2BMZA 3MIVA 1J4TA 4QX3A 2HYQA 1DLCA 4PIKA 1J4SA 3LL1A 4MQ0A 1C3NA 5J4TA 4DDNA 1VBPA 4AKCA 2NU5A 4AKBA 5J51A 3VZFA 1JI6A 4AKDA 2NUOA 3VZGA 1I5PA 1ZGRA 2BMYA 3AQGA 1TOQA 2QP2A 1XXQA 1UGYA 3LM1A 1WS4C 4R6QA 4PIFA 4GX7A 1OUWA 3LKYA 4QX0A 3MIUA 1WS5A 5J4XA 1PXDA 3WOCA 4R6RA 4QX1A 4R6NA 1KUJA 2HYRA 1M26A 1C3KA 4ARXA 4WOGA 1ZGSA 4R6OA 1XEZA 3R52A 2BN0A 3O44A 1J4UA 2GUEA 1UGWA 3MITA 1JACA 4PITA 3LLZA 5AV7A 1VMOA 5J50A 3VZEA 1UGYC 1C3MA 4QX2A 4MOAA 3R51A 5EXGA 1CIYA 3TOWA 1XXRA 3LL0A 4W8JA 1JOTA 1WS5C 2GUDA 2GTYA 3LL2A 3R50A 2GUXA 3VY6A 4AK4A 1UH0A 2JZ4A 2C9KA 5BN6E 5JM1A 1X1VA 4PIUA 4ARYA 1UGXA 3P8SA 1WS4A 1KU8A 1VBOA 3VY7A 1W99A 3APAA 4R6PA 1TP8A 1UGWC 3WOBA 1UH1A 2GUCA 3LLYA
chains in the Genus database with same CATH topology
2BMZA 3MIVA 1J4TA 2HYQA 4PIKA 1J4SA 3LL1A 4MQ0A 1C3NA 5J4TA 4DDNA 1VBPA 4AKCA 2NU5A 4AKBA 5J51A 3VZFA 4AKDA 2NUOA 3VZGA 1ZGRA 2BMYA 3AQGA 1TOQA 1XXQA 1UGYA 3LM1A 1WS4C 4R6QA 4PIFA 4GX7A 1OUWA 3LKYA 3MIUA 1WS5A 5J4XA 1PXDA 3WOCA 4R6RA 4R6NA 1KUJA 2HYRA 1M26A 1C3KA 4WOGA 1ZGSA 4R6OA 1XEZA 3R52A 2BN0A 3O44A 1J4UA 2GUEA 1UGWA 3MITA 1JACA 4PITA 3LLZA 5AV7A 5J50A 3VZEA 1UGYC 1C3MA 3R51A 5EXGA 1XXRA 3LL0A 1JOTA 1WS5C 2GUDA 2GTYA 3LL2A 3R50A 2GUXA 3VY6A 4AK4A 1UH0A 2JZ4A 5BN6E 5JM1A 1X1VA 4PIUA 1UGXA 3P8SA 1WS4A 1KU8A 1VBOA 3VY7A 3APAA 4R6PA 1TP8A 1UGWC 3WOBA 1UH1A 2GUCA 3LLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMZ A;  3MIV A;  1J4T A;  2HYQ A;  4PIK A;  1J4S A;  3LL1 A;  4MQ0 A;  1C3N A;  5J4T A;  4DDN A;  1VBP A;  4AKC A;  2NU5 A;  4AKB A;  5J51 A;  3VZF A;  4AKD A;  2NUO A;  3VZG A;  1ZGR A;  2BMY A;  3AQG A;  1TOQ A;  1XXQ A;  1UGY A;  3LM1 A;  1WS4 C;  4R6Q A;  4PIF A;  4GX7 A;  1OUW A;  3LKY A;  3MIU A;  1WS5 A;  5J4X A;  1PXD A;  3WOC A;  4R6R A;  4R6N A;  1KUJ A;  2HYR A;  1M26 A;  1C3K A;  4WOG A;  1ZGS A;  4R6O A;  1XEZ A;  3R52 A;  2BN0 A;  3O44 A;  1J4U A;  2GUE A;  1UGW A;  3MIT A;  1JAC A;  4PIT A;  3LLZ A;  5AV7 A;  5J50 A;  3VZE A;  1UGY C;  1C3M A;  3R51 A;  5EXG A;  1XXR A;  3LL0 A;  1JOT A;  1WS5 C;  2GUD A;  2GTY A;  3LL2 A;  3R50 A;  2GUX A;  3VY6 A;  4AK4 A;  1UH0 A;  2JZ4 A;  5BN6 E;  5JM1 A;  1X1V A;  4PIU A;  1UGX A;  3P8S A;  1WS4 A;  1KU8 A;  1VBO A;  3VY7 A;  3APA A;  4R6P A;  1TP8 A;  1UGW C;  3WOB A;  1UH1 A;  2GUC A;  3LLY A; 
#chains in the Genus database with same CATH topology
 4D8M A;  3EB7 A;  2BMZ A;  3MIV A;  1J4T A;  4QX3 A;  2HYQ A;  1DLC A;  4PIK A;  1J4S A;  3LL1 A;  4MQ0 A;  1C3N A;  5J4T A;  4DDN A;  1VBP A;  4AKC A;  2NU5 A;  4AKB A;  5J51 A;  3VZF A;  1JI6 A;  4AKD A;  2NUO A;  3VZG A;  1I5P A;  1ZGR A;  2BMY A;  3AQG A;  1TOQ A;  2QP2 A;  1XXQ A;  1UGY A;  3LM1 A;  1WS4 C;  4R6Q A;  4PIF A;  4GX7 A;  1OUW A;  3LKY A;  4QX0 A;  3MIU A;  1WS5 A;  5J4X A;  1PXD A;  3WOC A;  4R6R A;  4QX1 A;  4R6N A;  1KUJ A;  2HYR A;  1M26 A;  1C3K A;  4ARX A;  4WOG A;  1ZGS A;  4R6O A;  1XEZ A;  3R52 A;  2BN0 A;  3O44 A;  1J4U A;  2GUE A;  1UGW A;  3MIT A;  1JAC A;  4PIT A;  3LLZ A;  5AV7 A;  1VMO A;  5J50 A;  3VZE A;  1UGY C;  1C3M A;  4QX2 A;  4MOA A;  3R51 A;  5EXG A;  1CIY A;  3TOW A;  1XXR A;  3LL0 A;  4W8J A;  1JOT A;  1WS5 C;  2GUD A;  2GTY A;  3LL2 A;  3R50 A;  2GUX A;  3VY6 A;  4AK4 A;  1UH0 A;  2JZ4 A;  2C9K A;  5BN6 E;  5JM1 A;  1X1V A;  4PIU A;  4ARY A;  1UGX A;  3P8S A;  1WS4 A;  1KU8 A;  1VBO A;  3VY7 A;  1W99 A;  3APA A;  4R6P A;  1TP8 A;  1UGW C;  3WOB A;  1UH1 A;  2GUC A;  3LLY A; 
#chains in the Genus database with same CATH homology
 2BMZ A;  3MIV A;  1J4T A;  2HYQ A;  4PIK A;  1J4S A;  3LL1 A;  4MQ0 A;  1C3N A;  5J4T A;  4DDN A;  1VBP A;  4AKC A;  2NU5 A;  4AKB A;  5J51 A;  3VZF A;  4AKD A;  2NUO A;  3VZG A;  1ZGR A;  2BMY A;  3AQG A;  1TOQ A;  1XXQ A;  1UGY A;  3LM1 A;  1WS4 C;  4R6Q A;  4PIF A;  4GX7 A;  1OUW A;  3LKY A;  3MIU A;  1WS5 A;  5J4X A;  1PXD A;  3WOC A;  4R6R A;  4R6N A;  1KUJ A;  2HYR A;  1M26 A;  1C3K A;  4WOG A;  1ZGS A;  4R6O A;  1XEZ A;  3R52 A;  2BN0 A;  3O44 A;  1J4U A;  2GUE A;  1UGW A;  3MIT A;  1JAC A;  4PIT A;  3LLZ A;  5AV7 A;  5J50 A;  3VZE A;  1UGY C;  1C3M A;  3R51 A;  5EXG A;  1XXR A;  3LL0 A;  1JOT A;  1WS5 C;  2GUD A;  2GTY A;  3LL2 A;  3R50 A;  2GUX A;  3VY6 A;  4AK4 A;  1UH0 A;  2JZ4 A;  5BN6 E;  5JM1 A;  1X1V A;  4PIU A;  1UGX A;  3P8S A;  1WS4 A;  1KU8 A;  1VBO A;  3VY7 A;  3APA A;  4R6P A;  1TP8 A;  1UGW C;  3WOB A;  1UH1 A;  2GUC A;  3LLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...