The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
263
|
structure length |
263
|
Chain Sequence |
NRTLTREQVLALAEHIENAELNVHDIGKVTNDFPEMTFADAYDVQWEIRRRKEARGNKIVGLKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVDCSKLIHPKIEAEISVVTKAPLHGPGCHLGDVIAAIDYVIPTVEVIDSRYENFKFDPISVVADNASSTRFITGGRMASLEEVDLRTLGVVMEKNGEVVELGAGAAVLGHPLSSVAMLANLLAERGEHIPAGTFIMTGGITAAVPVAPGDNITVRYQGLGSVSARFI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structures of Apo and Liganded 4-Oxalocrotonate Decarboxylase Uncover a Structural Basis for the Metal-Assisted Decarboxylation of a Vinylogous beta-Keto Acid.
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Pseudomonas putida
|
molecule keywords |
4-oxalocrotonate decarboxylase NahK
|
total genus |
88
|
structure length |
263
|
sequence length |
263
|
ec nomenclature |
ec
4.1.1.77: 2-oxo-3-hexenedioate decarboxylase. |
pdb deposition date | 2015-08-05 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Fumarylacetoacetate hydrolase; domain 2 | Fumarylacetoacetase-like, C-terminal domain |
#chains in the Genus database with same CATH superfamily 4QKU A; 5D2K A; 5D2F A; 3R6O A; 3QDF A; 2EB6 A; 2EB5 A; 1SAW A; 4PFZ A; 1GTT A; 2Q1C X; 2Q19 X; 4DBH A; 1QQJ A; 3V77 A; 1NKQ A; 5D2I A; 1NR9 A; 3BQB A; 2HZY A; 1QCN A; 2EB4 A; 1QCO A; 2WQT A; 4MAQ A; 4DBF A; 1WZO A; 1SV6 A; 5D2J A; 2Q1A X; 3S52 A; 3LZK A; 2DFU A; 2Q18 X; 5D2G A; 3RR6 A; 5D2H A; 2Q1D X; 1I7O A; 1HYO A; #chains in the Genus database with same CATH topology 4QKU A; 5D2K A; 5D2F A; 3R6O A; 3QDF A; 2EB6 A; 2EB5 A; 1SAW A; 4PFZ A; 1GTT A; 2Q1C X; 2Q19 X; 4DBH A; 1QQJ A; 3V77 A; 1NKQ A; 5D2I A; 1NR9 A; 3BQB A; 2HZY A; 1QCN A; 2EB4 A; 1QCO A; 2WQT A; 4MAQ A; 4DBF A; 1WZO A; 1SV6 A; 5D2J A; 2Q1A X; 3S52 A; 3LZK A; 2DFU A; 2Q18 X; 5D2G A; 3RR6 A; 5D2H A; 2Q1D X; 1I7O A; 1HYO A; #chains in the Genus database with same CATH homology 4QKU A; 5D2K A; 5D2F A; 3R6O A; 3QDF A; 2EB6 A; 2EB5 A; 1SAW A; 4PFZ A; 1GTT A; 2Q1C X; 2Q19 X; 4DBH A; 1QQJ A; 3V77 A; 1NKQ A; 5D2I A; 1NR9 A; 3BQB A; 2HZY A; 1QCN A; 2EB4 A; 1QCO A; 2WQT A; 4MAQ A; 4DBF A; 1WZO A; 1SV6 A; 5D2J A; 2Q1A X; 3S52 A; 3LZK A; 2DFU A; 2Q18 X; 5D2G A; 3RR6 A; 5D2H A; 2Q1D X; 1I7O A; 1HYO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...