2DFUA

Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
251
Chain Sequence
b'MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
publication title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 68
structure length 251
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 2dfuA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 2dfuA02
2Q1AX 4QKUA 3V77A 4DBHA 1SV6A 4DBFA 2WQTA 1GTTA 1SAWA 3QDFA 2Q18X 3LZKA 3R6OA 2EB4A 2Q1CX 1I7OA 1WZOA 1QCOA 5D2KA 1QQJA 3S52A 5D2JA 3BQBA 2HZYA 1HYOA 1NR9A 5D2FA 2Q19X 1QCNA 2DFUA 5D2IA 2Q1DX 5D2HA 5D2GA 2EB5A 4PFZA 4MAQA 2EB6A 3RR6A 1NKQA
chains in the Genus database with same CATH superfamily
3M53A 3RMQA 1K9MR 4M75F 1YJNQ 1O75A 4C8QG 1HXDA 1QVGA 4N0AA 1YFNA 3BW1A 1LNXA 5FW9A 3DB3A 2EJFA 2M51A 1VQNA 4MDWA 3L2VA 1JEGA 4DOWA 2RJCA 4M78D 5LL6S 2Q1AX 5GMKe 2DD4A 2P0QA 2RH2A 2DL5A 1GCQA 2Q1CX 4C92D 3JB9H 1NEGA 1QP2A 4LDWA 2K6DA 3C4SA 2JVVA 1X6OA 2A3LA 2LJ0A 3I55A 2FVUA 2HQXA 1WHJA 2ZPEB 2E41A 2L3PA 4DEXA 2RMOA 3C94A 2W10A 4OGCA 2H8HA 2LNHB 2XD0A 2X4YA 2RNAA 4OMFB 2QA4T 2OTJQ 1YHQA 4OVAA 2PTKA 2DL4A 4M77F 3EFOB 4IUPA 1AOJA 1VQ7Q 1M4ZA 5GMKi 1NJIU 1YJWA 2OAUA 3OMGA 1G83A 2FRWA 3OYBA 4X9DA 2JTMA 1WQ7A 4IIOA 2M9UA 4AG2C 3VV0A 4OB0B 2RK1A 1VQ5Q 4EMKA 4A4FA 2COZA 5LJ3g 4OF1A 1PC0A 4JJDA 1QVGP 1RAIB 1M3AA 4FT4A 5CQXA 5J3BA 4C8QA 4LUDA 4PJJA 3OS2A 1H92A 4M78E 2MIOA 5C6SA 1PM3A 3CEYA 1GBQA 1N9SA 2EB5A 1M90U 3OSSC 2SEMA 4M7AG 4C92E 2GTOA 1W2BS 2K3YA 2M02A 4KUDK 4RUGA 3HSBA 4PJNA 1KIKA 1WHLA 1T0JA 1WGSA 1QW1A 3H0FA 1QP3A 5GJVB 5GAOr 1GFDA 1UHCA 4J9GA 1VQNQ 2QTXA 1Y07A 4BE2A 3T9NA 4DBRA 4QVCA 2A7YA 4IUVA 4C0DC 1MV0B 2O9SA 1I07A 4IKFA 2CSQA 1M1KR 1Y7XA 4HXJA 5L23A 3JB9J 1ZUUA 2ENMA 3UATA 1VQKT 2FZCB 3EGUA 2YT6A 2QG9B 2YUQA 1OYXA 1B34A 2XICA 3M9QA 3AT1B 2DA9A 2LMJA 1JO8A 3I55Q 2CSIA 3OYNA 3LH0A 4J9EA 3CC2A 1X43A 1P92A 2QEXA 3L2WA 1MNDA 3CCMA 3CMAA 1WHGA 2KNBB 4EMKB 2CT3A 1X6GA 2AK5A 1YHQQ 1NE8A 1G3YA 1J3TA 4C8QB 1ZBXA 1YJWQ 3MJXA 1ZX6A 4FL6A 2Z0WA 2F1LA 3JCMb 1TXQA 1T3SA 1T3LA 3QDRB 4DEYA 5CKEA 4JPBW 3E2UA 4J9CA 1K4US 1GRIA 1K0XA 4M7AA 4XTYA 4E47A 4XTVA 4PJOF 3GP8A 4ESRA 1Q81U 4MZTA 3RUXA 4KRTA 4M75C 3OW2S 3C12A 3OYCA 4ZGDB 2FG0A 3FC3A 4RTXA 1UJ0A 3CC4T 1JQQA 3EG2A 3M0TA 3EG1A 2RD1A 3VUZA 3R6NA 3VYGA 3L2UA 1ZSGA 3GOXA 1YIJA 3CPWS 2X9HA 5LJ3f 2K3XA 3QJYA 3H8ZA 5IT9E 1B34B 4GLKA 2DXTA 4QQDA 3OYJA 1X6BA 3F70A 1TS9A 2BTTA 5FU6B 5IHNA 1LJOA 2RQRA 1OPKA 2QXFA 2EGAA 3HRUA 2OTLA 1S1NA 3LLRA 4JLIA 5GAMd 5GANj 4J83A 5CKBA 1MUZA 2PQWA 2HSPA 2EYXA 2E4HA 2K7AA 1M3CA 3AHUA 3ASKA 2VVKA 4M77C 3I56T 1TUGB 1PRMC 2KT1A 1ABOA 3CC2Q 3BE3A 2QEXQ 1PKTA 2A08A 4QKUA 3CCMQ 2DYBA 2JXBA 4WF2A 1PWTA 4FCYA 3WVDB 2ED0A 4M7AB 4CRIA 5GMKl 2DIQA 4F7UG 1K9MC 4ELYC 5D2KA 4E7JA 1Z9ZA 3S52A 4PFOA 4P5NA 1M8VA 1UECA 2KXCA 1WXUA 3L1AA 3NTIA 2V8KA 2CZ1B 3BY7A 5ECAA 4DOVA 2HAXA 4MAQA 3MEAA 5A0DA 1G3SA 1AVZC 3MEUA 1TUCA 2M1HA 3OYDA 2DTOA 4C8QF 2FB7A 4ATOA 5GAN7 3GF5A 2VB6A 4RTYA 3M55A 3QYGB 3RESA 3I5RA 2DETA 2DEQA 4R55A 3MP1A 2FPEA 3UF4A 2VWFA 4LUEA 2XMFA 1VQ8T 3UDCA 3CCQQ 1YIJQ 2COYA 2J05A 2DMOA 1M30A 5HK0A 3INZA 4XAXB 2A37A 4LDXA 4D8DA 3OQ5A 2L3RA 3V7SA 2V8IA 2E12A 4BB7A 1E6HA 2I0NA 2LTOA 3FJ5A 2LQ8A 1QCNA 1ZLMA 1FMVA 4M75D 3J81E 1YN8A 4FYYB 4O5VA 2OTLQ 1KK7A 1D09B 3HFNA 5LJ5e 4PJLA 2V1RA 1WHHA 1YITT 3FIFA 1HK9A 4J9IA 3A8OB 1VQLT 2FYKA 2M0OA 1YNZA 3NPFA 5CQYA 3EG0A 1UGRB 1JJ2A 4ZGEB 2YSQA 2KMTA 3HPWA 2KGTA 2QTVA 4Z8AA 5GAOq 3OYFA 3CBPA 1NBEB 4BY6B 4FYVB 2EPDA 1R0BG 2Q18X 4J9HA 4MMKA 2BZ8A 4M7DG 2RB6A 1FXXA 3MP6A 5LJ3j 1I5LA 1KJWA 5FU7B 1M2OA 2YUNA 1KFZA 1K9AA 2DO3A 1QKWA 2DLPA 2JUFA 2YDLA 2HDAA 4Z02A 2DERA 4AT1B 2E3IA 5GAN6 2E70A 2KBTA 2JJ9A 1R77A 4DBFA 5FRNA 2RA2A 1M1KC 3C0CA 2EVRA 4M77D 4QQ6A 4B9XA 3QJ6A 5CK9A 3CCLA 2COWA 1UJYA 2K3BA 3UPUA 4XTWA 2EQKA 4N0AC 5KYNA 4M75E 3CD6A 4L6V5 3M0UA 3CCEA 2D9TA 2DM1A 4A63B 2QQAA 2E6NA 2GBQA 2LJ3A 2XHCA 3META 4N4GA 2K5FA 3WXMB 2IPOB 1ZUYA 1M9SA 3M54A 3KXTA 2F69A 1SPKA 4OP0A 1W4SA 2V26A 1JJ2P 1VQ6A 3L2ZA 1AWJA 1D0ZA 5FRMA 1OX8A 4HVWA 1YJ9A 4ME7A 1VYTA 5I2SA 2OX7A 1C6VX 2DZCA 4HCZA 3O5ZA 1E6GA 2VYTA 2PVOB 1OULA 2L89A 3FRNA 1OOTA 3M0SA 2JS0A 1NG2A 3BDLA 2XG8D 4M77E 1SRLA 1FWZA 3D7SB 3CPFA 5KE2A 2X4WA 1N27A 1UE9A 1F1BB 2E1HA 1SKUB 5D7UA 3G4SA 1Y71A 1WNLA 4WCIA 5IXBA 3ER0A 2X3XD 1N8RR 1V76A 3DB4A 4C8QC 3NFCA 4FYXB 1RL2A 1VQPQ 4II1A 4JS5A 2EGCA 2NWMA 4C0GA 3JB9F 2R5MA 3RKXA 5GAN2 2RF0A 1M1FA 1AT1B 2MYSA 4VUBA 1SSHA 4JZ4A 4XU2A 5GANg 3E9FA 2LC4A 1RAEB 2L2PA 3CCRA 2BIVA 3PMTA 1S72T 2EB4A 5CKHA 2HL3A 4HCCA 2CREA 2F2XA 3CD6Q 4BI4A 5GAMj 1RI9A 4GLMA 2DAQA 3CCEQ 4GBQA 3H41A 1U5SA 2FZKB 1YJNT 2P4TA 1BI1A 4M78G 4Z88A 4JJBA 4UC4A 4HA8A 1QKXA 1OQKA 2DXCA 3E19A 4Y92A 4XU3A 2PVDB 1PD0A 3ULRB 4ZTFA 2DRMA 1AHJB 1YI2T 1VQ6Q 2RO0A 2ROTA 7AT1B 2CS7A 3QPHA 1RLQC 1FMKA 5GAN3 3WVEB 4EMHA 1DJ7B 1B7TA 3A1PA 2KT8A 3S6WA 2AZVA 3QSUA 4CC3A 2K2MA 2CZ7B 2D8JA 2X35A 2K5LA 4FW1A 4IUTA 4J6XA 4DBQA 4F7UF 1BCMA 2FRYA 1Y57A 3H6ZA 2NYSA 1NEBA 5D2FA 4IUUA 2EGEA 3RKYA 3G71Q 3GPLA 2OTJT 1JU5C 2JTEA 3G4SQ 1K73R 2XDDA 3I9QA 1VQOA 4M7AC 1IHWA 2VXFA 1TSFA 2E10A 9ATCB 4PJOE 4BE0A 2RM4A 2QASA 3BDUA 1Q7YC 2PUOB 2E3HA 3RR6A 2DXBA 5CKDA 4M78A 1IXDA 2L3SA 2RHXA 4KH0B 2AIRB 3CCRQ 1KC8R 2RK2A 2CUDA 1BBZA 4D8KA 4HVUA 1PSEA 1WJQA 3JRZA 4MZMA 2KRNA 1NLOC 2YRVA 3H9NA 1RAHB 2XKOC 4PNOA 3KFVA 4NL3A 3CMEQ 1PCXA 1D0YA 3V77A 1BKBA 2KAFA 2RQUA 3M56A 3P8DA 4X1VA 2HQHA 4C8QD 4A54A 3OS0A 1I1JA 1BB9A 2RJFA 5GANf 1ARKA 2E5KA 3RKWA 4BDYA 2AHJB 2EIFA 2DF6A 2AKLA 1VQ9T 1PSFA 3HP9A 5KCHA 3H0IA 3TU4K 3OBWA 1W2BP 1UGQB 3CBMA 1XJWB 1IREB 4M7DF 3OW2A 1BI2A 5KYWA 2DVJA 1HD3A 2XIDA 2RI3A 1TH7A 1XTDA 1RLPC 3ZEHA 5GAOl 2LRQA 3JCMV 2O88A 1WFWA 3VS6A 5AYFA 2EQUA 4C0FA 3GBQA 3H0HA 3G6EA 1VQOQ 2RPNA 4HKEA 3L42A 4M78B 4M4ZA 3EGDA 1YJWT 1WYXA 1NM7A 4LXCA 5FU7C 1BIBA 1CSKA 1VQMT 8AT1B 5IH2A 4JRQA 1IRXA 2D1XA 5FWCA 3OYAA 4C8QE 1V1CA 2QAZA 2LQWA 3RMSA 1QVFS 2KXDA 2ATCB 2KQWA 3A8GB 1LPLA 3CC4A 4OGEA 3NGPA 1AWOA 4KH1B 2MK5A 3PMIA 5LJ3h 1QLYA 4R0KA 1K8AR 2L8DA 2G3RA 3JCMg 2VASA 3RDVA 4CI0C 3NTKA 4A4KA 2MMPA 1Q95G 2C0IA 5GMKj 3V8LA 2AZSA 4HT9A 1A0NB 2P84A 2DX1A 4JRPA 1NYFA 4M7AD 4RKUE 4ZTJA 4F17A 3MKDA 3Q1JA 1WX6A 4F14A 3LW5E 3EHRA 2DL8A 3OS1A 2KSSA 2LT1A 4LN2A 4JZ3A 1QVPA 3OW2P 5DLQE 2RI2A 3NHNA 1N8RC 3OYLA 4AG1C 2DJQA 2BKDN 3OYGA 5KYWB 4TVRA 1KQSS 3CCUA 4J6YA 3EAEA 3I5SA 4QVDA 3MP8A 3I56A 4LDUA 1X01A 3FJPA 3M5AA 2QQSA 3QIIA 1OPLA 1SAWA 3S3MA 3OBYA 2QI2A 3CPWP 4QW2A 1VIFA 4QQGA 3SD4A 3EGDB 4FSXA 4FIBA 4FW2A 5GAMg 3P8HA 3GLXA 3MEVA 5LJ5d 4FM4B 4Q5WA 2LZ6B 1BI0A 1Q82R 1QMCA 4XQ3A 3VS5A 3G6EQ 2EQIA 1G3TA 2KEAA 5KH6A 2DXUA 1KQ1A 8ATCB 1SV6A 1UDLA 2IVWA 3GIBA 1N9RA 3VUBA 3PIPA 1JRIA 2CH4W 4A4EA 2BZYA 1IZ6A 2YWWA 2JS2A 3JCMh 5IAYA 5D2HA 5EG2A 6AT1B 1K9MU 2DD5A 1ZSZC 5DLOA 2E64A 2W0ZA 1WPYA 4OMLA 2WSCE 3CMAQ 4AMCA 2A28A 2O31A 3LH5A 1WJRA 2KRSA 2NLUA 2RJEA 2AKKA 4EDUA 4J7IA 1VQ8A 2QK0A 3OMCA 1AEYA 3E9GA 1VOMA 3JB9D 1IO6A 4Z89A 3VRZA 1PD1A 3CCQT 1WLPB 1OU9A 1U1TA 3DKMA 1VQ4A 1XQHA 3QDFA 3RNJA 2V8JA 1K73C 2LJ1A 2DRKA 1Y0MA 3X20B 3KBGA 2SRCA 2OAWA 4E6RA 5J39A 4M7DC 4OMQA 4RG8A 4KUIA 4AFZC 4LDVA 2CUBA 5GAMh 4JS4A 2CP0A 3CCUQ 3JCMf 2J6FA 1Q86R 2GQIA 3LGLA 5A0LA 3I56Q 1VQLA 1D0XA 1ZHIA 3VJPA 3ZL7C 4C5GA 1VYVA 2GFAA 3ZFJA 2C06A 3DLMA 5KYUB 2QQ9A 4PLIA 4CC2A 1SG5A 3R6OA 4J5YA 4EMGA 3CXCS 1KC8C 3QZ9B 4JJNK 2M16A 4RTZA 1M27C 1Q7YR 1R8OB 2MF2A 4KBMB 3MHXA 2J6OA 2QYZA 3J7AF 1AWXA 1OZ2A 2A0FB 2CP6A 5GMKm 2CP3A 3LWIA 3QO3A 3OYHA 1D1CA 3VU3C 4M77G 2EW3A 3NTHA 1I7OA 3TSZA 2GGRA 3QBYA 2IG0A 2K79A 1G5VA 5GAMf 4ZGJB 5KYYA 2QDLA 5DM7R 2KE9A 1TOVA 4M75A 3X28B 4ANJA 4EPCA 4CC7A 1MMGA 1VQ8Q 1JXOA 2YRCA 5FROA 1RI0A 1KSWA 2EQMA 2VGMA 1AD5A 5FWBA 2PZ1A 1M1KU 2B86A 2P0PA 1E7OA 1ACMB 1XNIA 1VQ4Q 1NJIR 3FB9A 1QWEA 4N4IA 3QUIA 4M7AF 1I5OB 3OB9A 2R57A 4XK8E 3A8MB 1TWBA 1T0HA 3UT1A 1YWOA 1D3BA 1SHFA 4NL2A 3SWNA 2IIMA 5I22A 3JSCA 1VQLQ 1WIEA 2DFUA 2JNGA 2HEQA 4F7UE 4E7LA 2LVMA 2RQWA 4OB1B 1TUDA 2BZXA 1WHKA 2EFIA 4M77A 1NZ9A 3JCMX 1WZOA 1GCQC 2JOYA 2EJGA 2FHDA 1K8AC 2J7IA 4E2FB 1X2KA 4HT8A 3EH2A 1K0SA 1MMAA 3VKIA 1UEBA 1I4K1 4CC4B 5KYYB 3VS1A 1K76A 3JCMP 5A0GA 2PUKB 4M7DD 2D0QB 3OSVA 2HKNA 4M78C 4M75B 1VQPT 1OV3A 3QXEB 1YWPA 1RAFB 4B9WA 1UFFA 5D6XA 4LD9K 1JJ2S 3CCVT 1ZUKA 2D0NA 3CCJA 3TVTA 4A53A 4PJOG 1U06A 2ZZDA 3CC7A 2DPPB 2L3QA 3LYIA 3NMZC 1RAGB 2EKOA 3CD6T 1AZGB 4EMKC 1YJNA 3EFSA 4AFQC 4OMOA 2DKGA 1QCOA 4RTVA 2F2WA 3CCST 3P8BB 1D3BB 3C95A 4BDZA 1NYGA 2FEIA 3SWNB 1KQ2A 1ZA1B 2O9VA 5AT1B 4BACA 5LJ5j 1AZEA 1YI2A 4GY5A 4A4HA 1Q82C 2FPDA 2F5KA 2DL7A 5M9OA 4LDYA 1MMNA 2O2OA 3CBOA 3CCLQ 2EYQA 4M77B 1VIEA 1Q81R 1OZ3A 5GMKh 1JXMA 3FLGA 2YXYA 5C0MA 4B6MA 4M7DE 2CYZB 4BE1A 2PNIA 3LX7A 3V8KA 3OS5A 4E7IA 4MMLA 1W70A 1CKBA 1UHFA 1XOVA 2X4JA 3JCMW 2YHTA 3QHSA 1H3ZA 2EYWA 2D8HA 2LDMA 3TCJA 4C92G 5D2JA 2BUDA 4OB3B 2YRDA 3HHTB 1IHVA 4XTUA 1TTHB 3G71T 3BFMA 4L5GA 1KD1C 5L8RE 1EZZB 1C1AA 1WQWA 3PT9A 3PFSA 2DK3A 2MI6A 2CT4A 3FDRA 1YJ9Q 4PJOA 1NKQA 2JW4A 2ZPBB 3L2QA 5FU6C 4DBHA 1YCYA 4QVZA 2CZ6B 2ZPGB 3SEMA 2GFUA 2F5TX 1LVKA 2QQRA 1ZBJA 2FPFA 3OYIA 1BYMA 5GAN8 2KVQG 2X51A 1M3BA 2EWNA 1Z9QA 3EGXB 3VS3A 1M2VA 3M0RA 2L5QA 2F2VA 3CCJQ 2QA4A 1D1AA 1WHMA 1Q86C 2PU9B 4IURA 2MWOA 3CC7Q 2GNCA 2HMAA 2FL7A 2LCCA 3QKJA 1W2BA 1Q7YU 1VQ7T 2MOXA 5J26A 5GANh 3PGGA 2KRMA 1KHIA 3CMET 1ZA2B 4Y91A 2G6FX 1SRMA 2DNUA 1VQ5T 1IGQA 1YI2Q 3JCMc 5FLXE 3VS4A 1Y96A 2QQBA 1VQ9A 3OYKA 4FYWB 4C92A 4A4GA 2EJ9A 4ELZC 2JZ2A 1HSQA 1SEMA 3E1SA 2ECZA 3J80E 5HY6A 4ZN3A 4KGZB 2B8AA 2WSFE 1QVFA 5HK3A 4PJOB 2RQVA 2CP5A 4C5IA 3FEOA 3S3NA 4RCBA 3EHQA 2CH4A 2LT4A 4PJMA 4BD3A 1VQNT 2VXEA 2EBPA 2J06A 2K9GA 5GAOn 2H3JA 2BE9B 2R58A 1VQKA 3RIRA 1RABB 1VQOT 2YLCA 1M2VB 2NUTA 4R56A 3L2RA 4QT7A 4BUGA 5CCAA 1VQMA 2VUBA 2GQVA 4JLGA 2HBWA 2KROA 2K57A 1NJIC 3JV3A 3M59A 2DL3A 4D6WA 1QVGS 1G3WA 2HCKA 3TEEA 3VS7A 3UWNA 2ZGWA 2K2VA 1FYNA 3I55T 2GTJA 4PK4A 2QA4Q 5GANe 3HKSA 4WTOB 1X27A 1KQSA 2K4YA 2RQTA 1UGPB 3RBBB 5LJ3d 2XU8A 1YHQT 1Y96B 5GAOp 4V2SA 4BY6C 1RADB 3UA7A 1U3OA 5KE3A 3JB9I 3CQTA 1M90C 1EIFA 3LGFA 3CPWA 4DA4A 1GBRA 1UTIA 2EYZA 2OI3A 2MWPA 4C92B 1OI1A 2X4XA 4ZN1A 1QVFP 4KT0E 1VQ9Q 5D6WA 5GAN4 2K5IA 2JMAA 2H3EB 2WQTA 4JRKA 4C5EA 4IIMA 3VYHB 1UB4A 5CVIA 2RHIA 2JM8A 1TG0A 5I21A 1QWFA 1RAAB 2JT4A 2RHZA 3M57A 2NUTB 2HSEB 1N8RU 3VS0A 2YLBA 2RN8A 1U1SA 1JB0E 2Y4YA 4C0ZA 3REBB 2VV5A 1B07A 2KR3A 2LP5A 3SDZA 3HRTA 5GAOm 1WXTA 2EKHA 2DILA 1VQKQ 1GCPA 1JBMA 3G6ET 1KG1A 1KQSP 3OA6A 3M4YA 1VQMQ 2P0KA 5LJ5g 2CDTA 2XI9A 4RG2A 1BU1A 2DBKA 2JN0A 3O8VA 2MCNA 4F16A 1PRLC 2DE0X 3SB2A 2WSEE 3JCMd 2ZPIB 1PG5B 3OYYA 3CC2T 1BI3A 1W1FA 3JCMJ 4O6JA 3VRYA 2QEXT 3JB9G 5CIUA 3OYMA 2VGNA 1Q81C 2O01E 2CP7A 1LOJA 3EFRA 3X25B 2EYYA 3CCMT 3CMAT 1X69A 5CAIA 5KCOA 5KYUA 4MZPA 2E65A 1OEBA 3CCQA 3M0PA 4MDXA 4NOYA 2BE7D 4L59A 2ESWA 3CXCA 4XTZA 3OY9A 2I2LA 5D6YA 4M7AE 3TQ7P 1HYOA 3M0QA 3X24B 5LJ3e 3SWNC 1UGSB 3G7ZA 5CO7A 3HL8A 2A36A 3CC4Q 4E7ZA 4M78F 5EC7A 5GJWB 2HNIA 1UGVA 3REAB 4BI8B 3CCUT 4E7HA 5HCKA 4J7FA 1KD1R 4C92F 4KGXB 2NUPA 4OB2B 1NR9A 4AFSC 1K73U 1BK2A 1PHTA 2JMCA 5LJ5h 3TREA 1YIJT 3QYHB 1QCFA 4J8OA 3PTAA 4RCCA 4M75G 2Y90A 2ABLA 2KYBA 2YUOA 2CZ0B 2QGGA 2LQKA 4JUVA 1WI7A 3MPUB 2EAYA 3BQBA 1R0CB 4Y28E 3DLLA 2ROLA 1VA7A 4PLLA 3QG1A 1NPPA 5D2GA 1IB8A 1OU8A 2FZGB 2KY9A 2XDPA 1YITA 2RHYA 4PFZA 3V7RA 3VS2A 1KC8U 2OTLT 4HCKA 2DIGA 2PVGB 1FMWA 2LCSA 2WACA 4RTWA 4RTUA 4FSSA 4J6WA 3HTRA 1MV3A 3CXCP 3A98A 1KHCA 2QGFB 2LQNA 2ZPHB 1FX7A 1G8XA 3EG9A 1YCSB 2HQEA 3JAME 1CKAA 5IHKA 3JCMe 3A8LB 5LJ5f 1WXBA 1H8KA 1G2BA 3I35A 2DVEA 3LZKA 2ED1A 4KULA 3PE0A 4F04B 3PIOA 3M58A 2AT1B 2MPXC 1PKSA 2E6ZA 1SHGA 1VQ4T 2KDSA 2Q1DX 4KGVB 2X3WD 1EX4A 2NUPB 3V7CA 2RI5A 1WJSA 4FU6A 4J9BA 3EG3A 1HJDA 1M1GA 2LX9A 1B3QA 4LNPA 4F7UA 3KUFA 2DTIA 4YTLA 4C0DB 5GAMe 2KI7A 3EH1A 4PJOC 1GFCA 2RHUA 4ORZA 5KYXA 1U8RA 4XU1A 3THKA 4AFUC 2DZ9A 2DEUA 1M5Q1 2LCLA 3N5BB 4NS5A 3OYEA 1PNJA 2Q19X 1VQPA 1YITQ 4E7KA 1MHNA 4JDSA 3EG9B 3PNWC 4HVVA 1SSFA 3CCVA 5A2QE 2FO0A 2VKNA 4OMNA 1K8AU 1ZQ1A 5HKCA 5CR2A 1M90R 4XTXA 3G1JA 3SFMA 1X75C 5IN1A 4JJCA 4K11A 1O9SA 2DTHA 1SF9A 2M0YA 2D6FA 4DQ2A 2HKQB 1ZSZA 2HD0A 3IQLA 1K1ZA 4FT2A 1ABQA 4LD6A 4PL6A 3RERA 2DJZA 3CCSA 4OMPA 2YUPA 3HFOA 2EQJA 4RTTA 1I81A 3X26B 2O4XA 4F7UB 1TU0B 5DY9A 5CKFA 4OMMA 2HZYA 1X2QA 2C0TA 1AWWA 3MEWA 4C92C 2P4RA 1S72A 2DBMA 3ZBDA 1NLPC 2QDYB 3QWXX 2Y4XA 2GF7A 2ZCFB 3CCLT 3JCMQ 4PKCC 2LNVA 1VYUA 1WDXA 2C0OA 2E5QA 4M7DA 4PFPA 3QWYA 5KYXB 2HBPA 3EGXA 3CCET 1Q82U 2GCXA 1MNEA 4EIKA 1RUWA 2XDBA 2CKKA 1RACB 1BIAA 1N5ZA 2CGHA 1LCKA 4J9FA 5I2MA 3SHWA 2EB6A 1WA7A 1M8MA 3G71A 1I0CA 3URGA 3LWHA 1D1BA 3A8HB 4X9CA 1IGUA 1GL5A 1VQ6T 1QQJA 2VC8A 2V1QA 1YJ9T 3PVLA 4BI3A 2J6KA 1BCOA 2R5AA 2RJDA 4RMOA 1N6AA 2JTFA 1ZSZB 4E7SA 3CCVQ 3PVQA 4N4HA 4IUQA 1MGQA 1C0MA 2HL5C 3GNFB 3S3OA 1UG1A 1YP5A 2DYIA 1KD1U 1GTTA 3MO8A 3MCAB 3M4GA 4X34A 1EFNA 2XK0A 3CCJT 2OTJA 1YBYA 3QZ5B 1NPRA 2OJ2A 2O4XB 4JRIA 4ZNXA 3A5ZB 3CC7T 1VQ7A 3HRSA 4C5HA 3U23A 4HCBA 1W6XA 3CCSQ 2KK4A 4PJOD 1MMDA 3G4ST 3CMEA 1GXIE 3UA6A 5IXFA 2JM9A 5GANd 4XU0A 1OX9A 1H641 1VQ5A 3ME9A 1UUEA 5GAN5 2ZAEA 3TSWA 3EFOA 1VUBA 1Q86U 2LX7A 4M7DB 5IHIA 5I11A 1H3HA 2L0AA 2ZPFB 3V8JA 1I8FA 2NUZA 2KYMA 1S72Q 4J9DA 5D2IA 2CP2A 2MAMA 3GNGA 4LE9A 3CCRT 1V29B
chains in the Genus database with same CATH topology
2Q1AX 4QKUA 3V77A 4DBHA 1SV6A 4DBFA 2WQTA 1GTTA 1SAWA 3QDFA 2Q18X 3LZKA 3R6OA 2EB4A 2Q1CX 1I7OA 1WZOA 1QCOA 5D2KA 1QQJA 3S52A 5D2JA 3BQBA 2HZYA 1HYOA 1NR9A 5D2FA 2Q19X 1QCNA 2DFUA 5D2IA 2Q1DX 5D2HA 5D2GA 2EB5A 4PFZA 4MAQA 2EB6A 3RR6A 1NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1A X;  4QKU A;  3V77 A;  4DBH A;  1SV6 A;  4DBF A;  2WQT A;  1GTT A;  1SAW A;  3QDF A;  2Q18 X;  3LZK A;  3R6O A;  2EB4 A;  2Q1C X;  1I7O A;  1WZO A;  1QCO A;  5D2K A;  1QQJ A;  3S52 A;  5D2J A;  3BQB A;  2HZY A;  1HYO A;  1NR9 A;  5D2F A;  2Q19 X;  1QCN A;  2DFU A;  5D2I A;  2Q1D X;  5D2H A;  5D2G A;  2EB5 A;  4PFZ A;  4MAQ A;  2EB6 A;  3RR6 A;  1NKQ A; 
#chains in the Genus database with same CATH topology
 3M53 A;  3RMQ A;  1K9M R;  4M75 F;  1YJN Q;  1O75 A;  4C8Q G;  1HXD A;  1QVG A;  4N0A A;  1YFN A;  3BW1 A;  1LNX A;  5FW9 A;  3DB3 A;  2EJF A;  2M51 A;  1VQN A;  4MDW A;  3L2V A;  1JEG A;  4DOW A;  2RJC A;  4M78 D;  5LL6 S;  2Q1A X;  5GMK e;  2DD4 A;  2P0Q A;  2RH2 A;  2DL5 A;  1GCQ A;  2Q1C X;  4C92 D;  3JB9 H;  1NEG A;  1QP2 A;  4LDW A;  2K6D A;  3C4S A;  2JVV A;  1X6O A;  2A3L A;  2LJ0 A;  3I55 A;  2FVU A;  2HQX A;  1WHJ A;  2ZPE B;  2E41 A;  2L3P A;  4DEX A;  2RMO A;  3C94 A;  2W10 A;  4OGC A;  2H8H A;  2LNH B;  2XD0 A;  2X4Y A;  2RNA A;  4OMF B;  2QA4 T;  2OTJ Q;  1YHQ A;  4OVA A;  2PTK A;  2DL4 A;  4M77 F;  3EFO B;  4IUP A;  1AOJ A;  1VQ7 Q;  1M4Z A;  5GMK i;  1NJI U;  1YJW A;  2OAU A;  3OMG A;  1G83 A;  2FRW A;  3OYB A;  4X9D A;  2JTM A;  1WQ7 A;  4IIO A;  2M9U A;  4AG2 C;  3VV0 A;  4OB0 B;  2RK1 A;  1VQ5 Q;  4EMK A;  4A4F A;  2COZ A;  5LJ3 g;  4OF1 A;  1PC0 A;  4JJD A;  1QVG P;  1RAI B;  1M3A A;  4FT4 A;  5CQX A;  5J3B A;  4C8Q A;  4LUD A;  4PJJ A;  3OS2 A;  1H92 A;  4M78 E;  2MIO A;  5C6S A;  1PM3 A;  3CEY A;  1GBQ A;  1N9S A;  2EB5 A;  1M90 U;  3OSS C;  2SEM A;  4M7A G;  4C92 E;  2GTO A;  1W2B S;  2K3Y A;  2M02 A;  4KUD K;  4RUG A;  3HSB A;  4PJN A;  1KIK A;  1WHL A;  1T0J A;  1WGS A;  1QW1 A;  3H0F A;  1QP3 A;  5GJV B;  5GAO r;  1GFD A;  1UHC A;  4J9G A;  1VQN Q;  2QTX A;  1Y07 A;  4BE2 A;  3T9N A;  4DBR A;  4QVC A;  2A7Y A;  4IUV A;  4C0D C;  1MV0 B;  2O9S A;  1I07 A;  4IKF A;  2CSQ A;  1M1K R;  1Y7X A;  4HXJ A;  5L23 A;  3JB9 J;  1ZUU A;  2ENM A;  3UAT A;  1VQK T;  2FZC B;  3EGU A;  2YT6 A;  2QG9 B;  2YUQ A;  1OYX A;  1B34 A;  2XIC A;  3M9Q A;  3AT1 B;  2DA9 A;  2LMJ A;  1JO8 A;  3I55 Q;  2CSI A;  3OYN A;  3LH0 A;  4J9E A;  3CC2 A;  1X43 A;  1P92 A;  2QEX A;  3L2W A;  1MND A;  3CCM A;  3CMA A;  1WHG A;  2KNB B;  4EMK B;  2CT3 A;  1X6G A;  2AK5 A;  1YHQ Q;  1NE8 A;  1G3Y A;  1J3T A;  4C8Q B;  1ZBX A;  1YJW Q;  3MJX A;  1ZX6 A;  4FL6 A;  2Z0W A;  2F1L A;  3JCM b;  1TXQ A;  1T3S A;  1T3L A;  3QDR B;  4DEY A;  5CKE A;  4JPB W;  3E2U A;  4J9C A;  1K4U S;  1GRI A;  1K0X A;  4M7A A;  4XTY A;  4E47 A;  4XTV A;  4PJO F;  3GP8 A;  4ESR A;  1Q81 U;  4MZT A;  3RUX A;  4KRT A;  4M75 C;  3OW2 S;  3C12 A;  3OYC A;  4ZGD B;  2FG0 A;  3FC3 A;  4RTX A;  1UJ0 A;  3CC4 T;  1JQQ A;  3EG2 A;  3M0T A;  3EG1 A;  2RD1 A;  3VUZ A;  3R6N A;  3VYG A;  3L2U A;  1ZSG A;  3GOX A;  1YIJ A;  3CPW S;  2X9H A;  5LJ3 f;  2K3X A;  3QJY A;  3H8Z A;  5IT9 E;  1B34 B;  4GLK A;  2DXT A;  4QQD A;  3OYJ A;  1X6B A;  3F70 A;  1TS9 A;  2BTT A;  5FU6 B;  5IHN A;  1LJO A;  2RQR A;  1OPK A;  2QXF A;  2EGA A;  3HRU A;  2OTL A;  1S1N A;  3LLR A;  4JLI A;  5GAM d;  5GAN j;  4J83 A;  5CKB A;  1MUZ A;  2PQW A;  2HSP A;  2EYX A;  2E4H A;  2K7A A;  1M3C A;  3AHU A;  3ASK A;  2VVK A;  4M77 C;  3I56 T;  1TUG B;  1PRM C;  2KT1 A;  1ABO A;  3CC2 Q;  3BE3 A;  2QEX Q;  1PKT A;  2A08 A;  4QKU A;  3CCM Q;  2DYB A;  2JXB A;  4WF2 A;  1PWT A;  4FCY A;  3WVD B;  2ED0 A;  4M7A B;  4CRI A;  5GMK l;  2DIQ A;  4F7U G;  1K9M C;  4ELY C;  5D2K A;  4E7J A;  1Z9Z A;  3S52 A;  4PFO A;  4P5N A;  1M8V A;  1UEC A;  2KXC A;  1WXU A;  3L1A A;  3NTI A;  2V8K A;  2CZ1 B;  3BY7 A;  5ECA A;  4DOV A;  2HAX A;  4MAQ A;  3MEA A;  5A0D A;  1G3S A;  1AVZ C;  3MEU A;  1TUC A;  2M1H A;  3OYD A;  2DTO A;  4C8Q F;  2FB7 A;  4ATO A;  5GAN 7;  3GF5 A;  2VB6 A;  4RTY A;  3M55 A;  3QYG B;  3RES A;  3I5R A;  2DET A;  2DEQ A;  4R55 A;  3MP1 A;  2FPE A;  3UF4 A;  2VWF A;  4LUE A;  2XMF A;  1VQ8 T;  3UDC A;  3CCQ Q;  1YIJ Q;  2COY A;  2J05 A;  2DMO A;  1M30 A;  5HK0 A;  3INZ A;  4XAX B;  2A37 A;  4LDX A;  4D8D A;  3OQ5 A;  2L3R A;  3V7S A;  2V8I A;  2E12 A;  4BB7 A;  1E6H A;  2I0N A;  2LTO A;  3FJ5 A;  2LQ8 A;  1QCN A;  1ZLM A;  1FMV A;  4M75 D;  3J81 E;  1YN8 A;  4FYY B;  4O5V A;  2OTL Q;  1KK7 A;  1D09 B;  3HFN A;  5LJ5 e;  4PJL A;  2V1R A;  1WHH A;  1YIT T;  3FIF A;  1HK9 A;  4J9I A;  3A8O B;  1VQL T;  2FYK A;  2M0O A;  1YNZ A;  3NPF A;  5CQY A;  3EG0 A;  1UGR B;  1JJ2 A;  4ZGE B;  2YSQ A;  2KMT A;  3HPW A;  2KGT A;  2QTV A;  4Z8A A;  5GAO q;  3OYF A;  3CBP A;  1NBE B;  4BY6 B;  4FYV B;  2EPD A;  1R0B G;  2Q18 X;  4J9H A;  4MMK A;  2BZ8 A;  4M7D G;  2RB6 A;  1FXX A;  3MP6 A;  5LJ3 j;  1I5L A;  1KJW A;  5FU7 B;  1M2O A;  2YUN A;  1KFZ A;  1K9A A;  2DO3 A;  1QKW A;  2DLP A;  2JUF A;  2YDL A;  2HDA A;  4Z02 A;  2DER A;  4AT1 B;  2E3I A;  5GAN 6;  2E70 A;  2KBT A;  2JJ9 A;  1R77 A;  4DBF A;  5FRN A;  2RA2 A;  1M1K C;  3C0C A;  2EVR A;  4M77 D;  4QQ6 A;  4B9X A;  3QJ6 A;  5CK9 A;  3CCL A;  2COW A;  1UJY A;  2K3B A;  3UPU A;  4XTW A;  2EQK A;  4N0A C;  5KYN A;  4M75 E;  3CD6 A;  4L6V 5;  3M0U A;  3CCE A;  2D9T A;  2DM1 A;  4A63 B;  2QQA A;  2E6N A;  2GBQ A;  2LJ3 A;  2XHC A;  3MET A;  4N4G A;  2K5F A;  3WXM B;  2IPO B;  1ZUY A;  1M9S A;  3M54 A;  3KXT A;  2F69 A;  1SPK A;  4OP0 A;  1W4S A;  2V26 A;  1JJ2 P;  1VQ6 A;  3L2Z A;  1AWJ A;  1D0Z A;  5FRM A;  1OX8 A;  4HVW A;  1YJ9 A;  4ME7 A;  1VYT A;  5I2S A;  2OX7 A;  1C6V X;  2DZC A;  4HCZ A;  3O5Z A;  1E6G A;  2VYT A;  2PVO B;  1OUL A;  2L89 A;  3FRN A;  1OOT A;  3M0S A;  2JS0 A;  1NG2 A;  3BDL A;  2XG8 D;  4M77 E;  1SRL A;  1FWZ A;  3D7S B;  3CPF A;  5KE2 A;  2X4W A;  1N27 A;  1UE9 A;  1F1B B;  2E1H A;  1SKU B;  5D7U A;  3G4S A;  1Y71 A;  1WNL A;  4WCI A;  5IXB A;  3ER0 A;  2X3X D;  1N8R R;  1V76 A;  3DB4 A;  4C8Q C;  3NFC A;  4FYX B;  1RL2 A;  1VQP Q;  4II1 A;  4JS5 A;  2EGC A;  2NWM A;  4C0G A;  3JB9 F;  2R5M A;  3RKX A;  5GAN 2;  2RF0 A;  1M1F A;  1AT1 B;  2MYS A;  4VUB A;  1SSH A;  4JZ4 A;  4XU2 A;  5GAN g;  3E9F A;  2LC4 A;  1RAE B;  2L2P A;  3CCR A;  2BIV A;  3PMT A;  1S72 T;  2EB4 A;  5CKH A;  2HL3 A;  4HCC A;  2CRE A;  2F2X A;  3CD6 Q;  4BI4 A;  5GAM j;  1RI9 A;  4GLM A;  2DAQ A;  3CCE Q;  4GBQ A;  3H41 A;  1U5S A;  2FZK B;  1YJN T;  2P4T A;  1BI1 A;  4M78 G;  4Z88 A;  4JJB A;  4UC4 A;  4HA8 A;  1QKX A;  1OQK A;  2DXC A;  3E19 A;  4Y92 A;  4XU3 A;  2PVD B;  1PD0 A;  3ULR B;  4ZTF A;  2DRM A;  1AHJ B;  1YI2 T;  1VQ6 Q;  2RO0 A;  2ROT A;  7AT1 B;  2CS7 A;  3QPH A;  1RLQ C;  1FMK A;  5GAN 3;  3WVE B;  4EMH A;  1DJ7 B;  1B7T A;  3A1P A;  2KT8 A;  3S6W A;  2AZV A;  3QSU A;  4CC3 A;  2K2M A;  2CZ7 B;  2D8J A;  2X35 A;  2K5L A;  4FW1 A;  4IUT A;  4J6X A;  4DBQ A;  4F7U F;  1BCM A;  2FRY A;  1Y57 A;  3H6Z A;  2NYS A;  1NEB A;  5D2F A;  4IUU A;  2EGE A;  3RKY A;  3G71 Q;  3GPL A;  2OTJ T;  1JU5 C;  2JTE A;  3G4S Q;  1K73 R;  2XDD A;  3I9Q A;  1VQO A;  4M7A C;  1IHW A;  2VXF A;  1TSF A;  2E10 A;  9ATC B;  4PJO E;  4BE0 A;  2RM4 A;  2QAS A;  3BDU A;  1Q7Y C;  2PUO B;  2E3H A;  3RR6 A;  2DXB A;  5CKD A;  4M78 A;  1IXD A;  2L3S A;  2RHX A;  4KH0 B;  2AIR B;  3CCR Q;  1KC8 R;  2RK2 A;  2CUD A;  1BBZ A;  4D8K A;  4HVU A;  1PSE A;  1WJQ A;  3JRZ A;  4MZM A;  2KRN A;  1NLO C;  2YRV A;  3H9N A;  1RAH B;  2XKO C;  4PNO A;  3KFV A;  4NL3 A;  3CME Q;  1PCX A;  1D0Y A;  3V77 A;  1BKB A;  2KAF A;  2RQU A;  3M56 A;  3P8D A;  4X1V A;  2HQH A;  4C8Q D;  4A54 A;  3OS0 A;  1I1J A;  1BB9 A;  2RJF A;  5GAN f;  1ARK A;  2E5K A;  3RKW A;  4BDY A;  2AHJ B;  2EIF A;  2DF6 A;  2AKL A;  1VQ9 T;  1PSF A;  3HP9 A;  5KCH A;  3H0I A;  3TU4 K;  3OBW A;  1W2B P;  1UGQ B;  3CBM A;  1XJW B;  1IRE B;  4M7D F;  3OW2 A;  1BI2 A;  5KYW A;  2DVJ A;  1HD3 A;  2XID A;  2RI3 A;  1TH7 A;  1XTD A;  1RLP C;  3ZEH A;  5GAO l;  2LRQ A;  3JCM V;  2O88 A;  1WFW A;  3VS6 A;  5AYF A;  2EQU A;  4C0F A;  3GBQ A;  3H0H A;  3G6E A;  1VQO Q;  2RPN A;  4HKE A;  3L42 A;  4M78 B;  4M4Z A;  3EGD A;  1YJW T;  1WYX A;  1NM7 A;  4LXC A;  5FU7 C;  1BIB A;  1CSK A;  1VQM T;  8AT1 B;  5IH2 A;  4JRQ A;  1IRX A;  2D1X A;  5FWC A;  3OYA A;  4C8Q E;  1V1C A;  2QAZ A;  2LQW A;  3RMS A;  1QVF S;  2KXD A;  2ATC B;  2KQW A;  3A8G B;  1LPL A;  3CC4 A;  4OGE A;  3NGP A;  1AWO A;  4KH1 B;  2MK5 A;  3PMI A;  5LJ3 h;  1QLY A;  4R0K A;  1K8A R;  2L8D A;  2G3R A;  3JCM g;  2VAS A;  3RDV A;  4CI0 C;  3NTK A;  4A4K A;  2MMP A;  1Q95 G;  2C0I A;  5GMK j;  3V8L A;  2AZS A;  4HT9 A;  1A0N B;  2P84 A;  2DX1 A;  4JRP A;  1NYF A;  4M7A D;  4RKU E;  4ZTJ A;  4F17 A;  3MKD A;  3Q1J A;  1WX6 A;  4F14 A;  3LW5 E;  3EHR A;  2DL8 A;  3OS1 A;  2KSS A;  2LT1 A;  4LN2 A;  4JZ3 A;  1QVP A;  3OW2 P;  5DLQ E;  2RI2 A;  3NHN A;  1N8R C;  3OYL A;  4AG1 C;  2DJQ A;  2BKD N;  3OYG A;  5KYW B;  4TVR A;  1KQS S;  3CCU A;  4J6Y A;  3EAE A;  3I5S A;  4QVD A;  3MP8 A;  3I56 A;  4LDU A;  1X01 A;  3FJP A;  3M5A A;  2QQS A;  3QII A;  1OPL A;  1SAW A;  3S3M A;  3OBY A;  2QI2 A;  3CPW P;  4QW2 A;  1VIF A;  4QQG A;  3SD4 A;  3EGD B;  4FSX A;  4FIB A;  4FW2 A;  5GAM g;  3P8H A;  3GLX A;  3MEV A;  5LJ5 d;  4FM4 B;  4Q5W A;  2LZ6 B;  1BI0 A;  1Q82 R;  1QMC A;  4XQ3 A;  3VS5 A;  3G6E Q;  2EQI A;  1G3T A;  2KEA A;  5KH6 A;  2DXU A;  1KQ1 A;  8ATC B;  1SV6 A;  1UDL A;  2IVW A;  3GIB A;  1N9R A;  3VUB A;  3PIP A;  1JRI A;  2CH4 W;  4A4E A;  2BZY A;  1IZ6 A;  2YWW A;  2JS2 A;  3JCM h;  5IAY A;  5D2H A;  5EG2 A;  6AT1 B;  1K9M U;  2DD5 A;  1ZSZ C;  5DLO A;  2E64 A;  2W0Z A;  1WPY A;  4OML A;  2WSC E;  3CMA Q;  4AMC A;  2A28 A;  2O31 A;  3LH5 A;  1WJR A;  2KRS A;  2NLU A;  2RJE A;  2AKK A;  4EDU A;  4J7I A;  1VQ8 A;  2QK0 A;  3OMC A;  1AEY A;  3E9G A;  1VOM A;  3JB9 D;  1IO6 A;  4Z89 A;  3VRZ A;  1PD1 A;  3CCQ T;  1WLP B;  1OU9 A;  1U1T A;  3DKM A;  1VQ4 A;  1XQH A;  3QDF A;  3RNJ A;  2V8J A;  1K73 C;  2LJ1 A;  2DRK A;  1Y0M A;  3X20 B;  3KBG A;  2SRC A;  2OAW A;  4E6R A;  5J39 A;  4M7D C;  4OMQ A;  4RG8 A;  4KUI A;  4AFZ C;  4LDV A;  2CUB A;  5GAM h;  4JS4 A;  2CP0 A;  3CCU Q;  3JCM f;  2J6F A;  1Q86 R;  2GQI A;  3LGL A;  5A0L A;  3I56 Q;  1VQL A;  1D0X A;  1ZHI A;  3VJP A;  3ZL7 C;  4C5G A;  1VYV A;  2GFA A;  3ZFJ A;  2C06 A;  3DLM A;  5KYU B;  2QQ9 A;  4PLI A;  4CC2 A;  1SG5 A;  3R6O A;  4J5Y A;  4EMG A;  3CXC S;  1KC8 C;  3QZ9 B;  4JJN K;  2M16 A;  4RTZ A;  1M27 C;  1Q7Y R;  1R8O B;  2MF2 A;  4KBM B;  3MHX A;  2J6O A;  2QYZ A;  3J7A F;  1AWX A;  1OZ2 A;  2A0F B;  2CP6 A;  5GMK m;  2CP3 A;  3LWI A;  3QO3 A;  3OYH A;  1D1C A;  3VU3 C;  4M77 G;  2EW3 A;  3NTH A;  1I7O A;  3TSZ A;  2GGR A;  3QBY A;  2IG0 A;  2K79 A;  1G5V A;  5GAM f;  4ZGJ B;  5KYY A;  2QDL A;  5DM7 R;  2KE9 A;  1TOV A;  4M75 A;  3X28 B;  4ANJ A;  4EPC A;  4CC7 A;  1MMG A;  1VQ8 Q;  1JXO A;  2YRC A;  5FRO A;  1RI0 A;  1KSW A;  2EQM A;  2VGM A;  1AD5 A;  5FWB A;  2PZ1 A;  1M1K U;  2B86 A;  2P0P A;  1E7O A;  1ACM B;  1XNI A;  1VQ4 Q;  1NJI R;  3FB9 A;  1QWE A;  4N4I A;  3QUI A;  4M7A F;  1I5O B;  3OB9 A;  2R57 A;  4XK8 E;  3A8M B;  1TWB A;  1T0H A;  3UT1 A;  1YWO A;  1D3B A;  1SHF A;  4NL2 A;  3SWN A;  2IIM A;  5I22 A;  3JSC A;  1VQL Q;  1WIE A;  2DFU A;  2JNG A;  2HEQ A;  4F7U E;  4E7L A;  2LVM A;  2RQW A;  4OB1 B;  1TUD A;  2BZX A;  1WHK A;  2EFI A;  4M77 A;  1NZ9 A;  3JCM X;  1WZO A;  1GCQ C;  2JOY A;  2EJG A;  2FHD A;  1K8A C;  2J7I A;  4E2F B;  1X2K A;  4HT8 A;  3EH2 A;  1K0S A;  1MMA A;  3VKI A;  1UEB A;  1I4K 1;  4CC4 B;  5KYY B;  3VS1 A;  1K76 A;  3JCM P;  5A0G A;  2PUK B;  4M7D D;  2D0Q B;  3OSV A;  2HKN A;  4M78 C;  4M75 B;  1VQP T;  1OV3 A;  3QXE B;  1YWP A;  1RAF B;  4B9W A;  1UFF A;  5D6X A;  4LD9 K;  1JJ2 S;  3CCV T;  1ZUK A;  2D0N A;  3CCJ A;  3TVT A;  4A53 A;  4PJO G;  1U06 A;  2ZZD A;  3CC7 A;  2DPP B;  2L3Q A;  3LYI A;  3NMZ C;  1RAG B;  2EKO A;  3CD6 T;  1AZG B;  4EMK C;  1YJN A;  3EFS A;  4AFQ C;  4OMO A;  2DKG A;  1QCO A;  4RTV A;  2F2W A;  3CCS T;  3P8B B;  1D3B B;  3C95 A;  4BDZ A;  1NYG A;  2FEI A;  3SWN B;  1KQ2 A;  1ZA1 B;  2O9V A;  5AT1 B;  4BAC A;  5LJ5 j;  1AZE A;  1YI2 A;  4GY5 A;  4A4H A;  1Q82 C;  2FPD A;  2F5K A;  2DL7 A;  5M9O A;  4LDY A;  1MMN A;  2O2O A;  3CBO A;  3CCL Q;  2EYQ A;  4M77 B;  1VIE A;  1Q81 R;  1OZ3 A;  5GMK h;  1JXM A;  3FLG A;  2YXY A;  5C0M A;  4B6M A;  4M7D E;  2CYZ B;  4BE1 A;  2PNI A;  3LX7 A;  3V8K A;  3OS5 A;  4E7I A;  4MML A;  1W70 A;  1CKB A;  1UHF A;  1XOV A;  2X4J A;  3JCM W;  2YHT A;  3QHS A;  1H3Z A;  2EYW A;  2D8H A;  2LDM A;  3TCJ A;  4C92 G;  5D2J A;  2BUD A;  4OB3 B;  2YRD A;  3HHT B;  1IHV A;  4XTU A;  1TTH B;  3G71 T;  3BFM A;  4L5G A;  1KD1 C;  5L8R E;  1EZZ B;  1C1A A;  1WQW A;  3PT9 A;  3PFS A;  2DK3 A;  2MI6 A;  2CT4 A;  3FDR A;  1YJ9 Q;  4PJO A;  1NKQ A;  2JW4 A;  2ZPB B;  3L2Q A;  5FU6 C;  4DBH A;  1YCY A;  4QVZ A;  2CZ6 B;  2ZPG B;  3SEM A;  2GFU A;  2F5T X;  1LVK A;  2QQR A;  1ZBJ A;  2FPF A;  3OYI A;  1BYM A;  5GAN 8;  2KVQ G;  2X51 A;  1M3B A;  2EWN A;  1Z9Q A;  3EGX B;  3VS3 A;  1M2V A;  3M0R A;  2L5Q A;  2F2V A;  3CCJ Q;  2QA4 A;  1D1A A;  1WHM A;  1Q86 C;  2PU9 B;  4IUR A;  2MWO A;  3CC7 Q;  2GNC A;  2HMA A;  2FL7 A;  2LCC A;  3QKJ A;  1W2B A;  1Q7Y U;  1VQ7 T;  2MOX A;  5J26 A;  5GAN h;  3PGG A;  2KRM A;  1KHI A;  3CME T;  1ZA2 B;  4Y91 A;  2G6F X;  1SRM A;  2DNU A;  1VQ5 T;  1IGQ A;  1YI2 Q;  3JCM c;  5FLX E;  3VS4 A;  1Y96 A;  2QQB A;  1VQ9 A;  3OYK A;  4FYW B;  4C92 A;  4A4G A;  2EJ9 A;  4ELZ C;  2JZ2 A;  1HSQ A;  1SEM A;  3E1S A;  2ECZ A;  3J80 E;  5HY6 A;  4ZN3 A;  4KGZ B;  2B8A A;  2WSF E;  1QVF A;  5HK3 A;  4PJO B;  2RQV A;  2CP5 A;  4C5I A;  3FEO A;  3S3N A;  4RCB A;  3EHQ A;  2CH4 A;  2LT4 A;  4PJM A;  4BD3 A;  1VQN T;  2VXE A;  2EBP A;  2J06 A;  2K9G A;  5GAO n;  2H3J A;  2BE9 B;  2R58 A;  1VQK A;  3RIR A;  1RAB B;  1VQO T;  2YLC A;  1M2V B;  2NUT A;  4R56 A;  3L2R A;  4QT7 A;  4BUG A;  5CCA A;  1VQM A;  2VUB A;  2GQV A;  4JLG A;  2HBW A;  2KRO A;  2K57 A;  1NJI C;  3JV3 A;  3M59 A;  2DL3 A;  4D6W A;  1QVG S;  1G3W A;  2HCK A;  3TEE A;  3VS7 A;  3UWN A;  2ZGW A;  2K2V A;  1FYN A;  3I55 T;  2GTJ A;  4PK4 A;  2QA4 Q;  5GAN e;  3HKS A;  4WTO B;  1X27 A;  1KQS A;  2K4Y A;  2RQT A;  1UGP B;  3RBB B;  5LJ3 d;  2XU8 A;  1YHQ T;  1Y96 B;  5GAO p;  4V2S A;  4BY6 C;  1RAD B;  3UA7 A;  1U3O A;  5KE3 A;  3JB9 I;  3CQT A;  1M90 C;  1EIF A;  3LGF A;  3CPW A;  4DA4 A;  1GBR A;  1UTI A;  2EYZ A;  2OI3 A;  2MWP A;  4C92 B;  1OI1 A;  2X4X A;  4ZN1 A;  1QVF P;  4KT0 E;  1VQ9 Q;  5D6W A;  5GAN 4;  2K5I A;  2JMA A;  2H3E B;  2WQT A;  4JRK A;  4C5E A;  4IIM A;  3VYH B;  1UB4 A;  5CVI A;  2RHI A;  2JM8 A;  1TG0 A;  5I21 A;  1QWF A;  1RAA B;  2JT4 A;  2RHZ A;  3M57 A;  2NUT B;  2HSE B;  1N8R U;  3VS0 A;  2YLB A;  2RN8 A;  1U1S A;  1JB0 E;  2Y4Y A;  4C0Z A;  3REB B;  2VV5 A;  1B07 A;  2KR3 A;  2LP5 A;  3SDZ A;  3HRT A;  5GAO m;  1WXT A;  2EKH A;  2DIL A;  1VQK Q;  1GCP A;  1JBM A;  3G6E T;  1KG1 A;  1KQS P;  3OA6 A;  3M4Y A;  1VQM Q;  2P0K A;  5LJ5 g;  2CDT A;  2XI9 A;  4RG2 A;  1BU1 A;  2DBK A;  2JN0 A;  3O8V A;  2MCN A;  4F16 A;  1PRL C;  2DE0 X;  3SB2 A;  2WSE E;  3JCM d;  2ZPI B;  1PG5 B;  3OYY A;  3CC2 T;  1BI3 A;  1W1F A;  3JCM J;  4O6J A;  3VRY A;  2QEX T;  3JB9 G;  5CIU A;  3OYM A;  2VGN A;  1Q81 C;  2O01 E;  2CP7 A;  1LOJ A;  3EFR A;  3X25 B;  2EYY A;  3CCM T;  3CMA T;  1X69 A;  5CAI A;  5KCO A;  5KYU A;  4MZP A;  2E65 A;  1OEB A;  3CCQ A;  3M0P A;  4MDX A;  4NOY A;  2BE7 D;  4L59 A;  2ESW A;  3CXC A;  4XTZ A;  3OY9 A;  2I2L A;  5D6Y A;  4M7A E;  3TQ7 P;  1HYO A;  3M0Q A;  3X24 B;  5LJ3 e;  3SWN C;  1UGS B;  3G7Z A;  5CO7 A;  3HL8 A;  2A36 A;  3CC4 Q;  4E7Z A;  4M78 F;  5EC7 A;  5GJW B;  2HNI A;  1UGV A;  3REA B;  4BI8 B;  3CCU T;  4E7H A;  5HCK A;  4J7F A;  1KD1 R;  4C92 F;  4KGX B;  2NUP A;  4OB2 B;  1NR9 A;  4AFS C;  1K73 U;  1BK2 A;  1PHT A;  2JMC A;  5LJ5 h;  3TRE A;  1YIJ T;  3QYH B;  1QCF A;  4J8O A;  3PTA A;  4RCC A;  4M75 G;  2Y90 A;  2ABL A;  2KYB A;  2YUO A;  2CZ0 B;  2QGG A;  2LQK A;  4JUV A;  1WI7 A;  3MPU B;  2EAY A;  3BQB A;  1R0C B;  4Y28 E;  3DLL A;  2ROL A;  1VA7 A;  4PLL A;  3QG1 A;  1NPP A;  5D2G A;  1IB8 A;  1OU8 A;  2FZG B;  2KY9 A;  2XDP A;  1YIT A;  2RHY A;  4PFZ A;  3V7R A;  3VS2 A;  1KC8 U;  2OTL T;  4HCK A;  2DIG A;  2PVG B;  1FMW A;  2LCS A;  2WAC A;  4RTW A;  4RTU A;  4FSS A;  4J6W A;  3HTR A;  1MV3 A;  3CXC P;  3A98 A;  1KHC A;  2QGF B;  2LQN A;  2ZPH B;  1FX7 A;  1G8X A;  3EG9 A;  1YCS B;  2HQE A;  3JAM E;  1CKA A;  5IHK A;  3JCM e;  3A8L B;  5LJ5 f;  1WXB A;  1H8K A;  1G2B A;  3I35 A;  2DVE A;  3LZK A;  2ED1 A;  4KUL A;  3PE0 A;  4F04 B;  3PIO A;  3M58 A;  2AT1 B;  2MPX C;  1PKS A;  2E6Z A;  1SHG A;  1VQ4 T;  2KDS A;  2Q1D X;  4KGV B;  2X3W D;  1EX4 A;  2NUP B;  3V7C A;  2RI5 A;  1WJS A;  4FU6 A;  4J9B A;  3EG3 A;  1HJD A;  1M1G A;  2LX9 A;  1B3Q A;  4LNP A;  4F7U A;  3KUF A;  2DTI A;  4YTL A;  4C0D B;  5GAM e;  2KI7 A;  3EH1 A;  4PJO C;  1GFC A;  2RHU A;  4ORZ A;  5KYX A;  1U8R A;  4XU1 A;  3THK A;  4AFU C;  2DZ9 A;  2DEU A;  1M5Q 1;  2LCL A;  3N5B B;  4NS5 A;  3OYE A;  1PNJ A;  2Q19 X;  1VQP A;  1YIT Q;  4E7K A;  1MHN A;  4JDS A;  3EG9 B;  3PNW C;  4HVV A;  1SSF A;  3CCV A;  5A2Q E;  2FO0 A;  2VKN A;  4OMN A;  1K8A U;  1ZQ1 A;  5HKC A;  5CR2 A;  1M90 R;  4XTX A;  3G1J A;  3SFM A;  1X75 C;  5IN1 A;  4JJC A;  4K11 A;  1O9S A;  2DTH A;  1SF9 A;  2M0Y A;  2D6F A;  4DQ2 A;  2HKQ B;  1ZSZ A;  2HD0 A;  3IQL A;  1K1Z A;  4FT2 A;  1ABQ A;  4LD6 A;  4PL6 A;  3RER A;  2DJZ A;  3CCS A;  4OMP A;  2YUP A;  3HFO A;  2EQJ A;  4RTT A;  1I81 A;  3X26 B;  2O4X A;  4F7U B;  1TU0 B;  5DY9 A;  5CKF A;  4OMM A;  2HZY A;  1X2Q A;  2C0T A;  1AWW A;  3MEW A;  4C92 C;  2P4R A;  1S72 A;  2DBM A;  3ZBD A;  1NLP C;  2QDY B;  3QWX X;  2Y4X A;  2GF7 A;  2ZCF B;  3CCL T;  3JCM Q;  4PKC C;  2LNV A;  1VYU A;  1WDX A;  2C0O A;  2E5Q A;  4M7D A;  4PFP A;  3QWY A;  5KYX B;  2HBP A;  3EGX A;  3CCE T;  1Q82 U;  2GCX A;  1MNE A;  4EIK A;  1RUW A;  2XDB A;  2CKK A;  1RAC B;  1BIA A;  1N5Z A;  2CGH A;  1LCK A;  4J9F A;  5I2M A;  3SHW A;  2EB6 A;  1WA7 A;  1M8M A;  3G71 A;  1I0C A;  3URG A;  3LWH A;  1D1B A;  3A8H B;  4X9C A;  1IGU A;  1GL5 A;  1VQ6 T;  1QQJ A;  2VC8 A;  2V1Q A;  1YJ9 T;  3PVL A;  4BI3 A;  2J6K A;  1BCO A;  2R5A A;  2RJD A;  4RMO A;  1N6A A;  2JTF A;  1ZSZ B;  4E7S A;  3CCV Q;  3PVQ A;  4N4H A;  4IUQ A;  1MGQ A;  1C0M A;  2HL5 C;  3GNF B;  3S3O A;  1UG1 A;  1YP5 A;  2DYI A;  1KD1 U;  1GTT A;  3MO8 A;  3MCA B;  3M4G A;  4X34 A;  1EFN A;  2XK0 A;  3CCJ T;  2OTJ A;  1YBY A;  3QZ5 B;  1NPR A;  2OJ2 A;  2O4X B;  4JRI A;  4ZNX A;  3A5Z B;  3CC7 T;  1VQ7 A;  3HRS A;  4C5H A;  3U23 A;  4HCB A;  1W6X A;  3CCS Q;  2KK4 A;  4PJO D;  1MMD A;  3G4S T;  3CME A;  1GXI E;  3UA6 A;  5IXF A;  2JM9 A;  5GAN d;  4XU0 A;  1OX9 A;  1H64 1;  1VQ5 A;  3ME9 A;  1UUE A;  5GAN 5;  2ZAE A;  3TSW A;  3EFO A;  1VUB A;  1Q86 U;  2LX7 A;  4M7D B;  5IHI A;  5I11 A;  1H3H A;  2L0A A;  2ZPF B;  3V8J A;  1I8F A;  2NUZ A;  2KYM A;  1S72 Q;  4J9D A;  5D2I A;  2CP2 A;  2MAM A;  3GNG A;  4LE9 A;  3CCR T;  1V29 B; 
#chains in the Genus database with same CATH homology
 2Q1A X;  4QKU A;  3V77 A;  4DBH A;  1SV6 A;  4DBF A;  2WQT A;  1GTT A;  1SAW A;  3QDF A;  2Q18 X;  3LZK A;  3R6O A;  2EB4 A;  2Q1C X;  1I7O A;  1WZO A;  1QCO A;  5D2K A;  1QQJ A;  3S52 A;  5D2J A;  3BQB A;  2HZY A;  1HYO A;  1NR9 A;  5D2F A;  2Q19 X;  1QCN A;  2DFU A;  5D2I A;  2Q1D X;  5D2H A;  5D2G A;  2EB5 A;  4PFZ A;  4MAQ A;  2EB6 A;  3RR6 A;  1NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...