2DFUA

Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
251
Chain Sequence
MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords probable 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
publication title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 68
structure length 251
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 2dfuA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 2dfuA02
3LZKA 1QCOA 1WZOA 1NR9A 4QKUA 1SAWA 1HYOA 5D2KA 4PFZA 1QCNA 1NKQA 3RR6A 5D2GA 2Q19X 1SV6A 3R6OA 4DBHA 1GTTA 3BQBA 3S52A 4DBFA 2EB4A 2Q18X 3QDFA 5D2FA 2Q1DX 2HZYA 2WQTA 2EB5A 1QQJA 1I7OA 5D2JA 4MAQA 5D2IA 2Q1AX 5D2HA 2EB6A 2DFUA 2Q1CX 3V77A
chains in the Genus database with same CATH superfamily
3M0SA 1VQLA 3HFNA 2KDSA 3FIFA 2L3RA 2FG0A 1TTHB 8AT1B 3GIBA 1VYTA 5GAN4 2ROTA 3CD6T 1PC0A 4JJDA 2CP3A 2SEMA 1UUEA 2VWFA 1YWPA 4PK4A 3L2RA 1QVGS 5IHNA 2K79A 4EIKA 1RAGB 1YCSB 5CIUA 2GFAA 3X24B 2RQTA 8ATCB 3GNFB 3OYLA 1AZGB 1ZBJA 2X4YA 4WF2A 1MGQA 1I4K1 2Q19X 2ZPBB 3VYHB 4J9CA 1I07A 2E6ZA 2O01E 3FRNA 4FW1A 5D2FA 2COYA 1ZLMA 2G3RA 4MDWA 1PHTA 1QMCA 1Q95G 3X26B 1D0ZA 1UDLA 3CPWS 2M16A 2JVVA 1RLPC 4HVVA 5GAMe 1Y71A 1BKBA 3TU4K 3CMEA 1YIJA 4CC4B 1N6AA 2J6OA 3QJ6A 1WDXA 2A0FB 4OF1A 4DEXA 2LVMA 5LJ3e 4X1VA 2KYBA 4A54A 1R77A 3EG3A 3SWNA 1YJNT 3QDRB 4GLMA 2O9SA 4MZPA 1SHGA 2X51A 4RTTA 1VYUA 4F16A 1AWWA 3JCMQ 3ME9A 2C0TA 5DLQE 1M2VA 1SAWA 1KD1U 1HYOA 2VB6A 4JRIA 1VQ8A 4CI0C 5KYUB 5GMKj 3TEEA 1N8RR 1QVFS 3BFMA 2FRWA 3QJYA 2HSPA 2YUPA 1YJWT 2MWPA 3M4GA 1JRIA 5GAMf 3V7CA 3CCLA 1OZ2A 4PFZA 1PRMC 2EGCA 2KBTA 1K73R 4AFSC 1VQ7Q 2MWOA 2CP0A 4M77G 1VQPQ 5LJ3f 3REAB 2PNIA 3HKSA 2YWWA 5HKCA 1HK9A 2AK5A 3NMZC 5D2HA 4ELYC 3VYGA 4M7DB 2L89A 1FXXA 4MZTA 2QA4A 2KGTA 4DBRA 2GQIA 1NG2A 1RAEB 3HTRA 4RUGA 1S1NA 1FWZA 2JMCA 3FB9A 4C92C 3EAEA 4OVAA 2KMTA 3HFOA 1KC8C 3TSZA 3H0IA 2OTJQ 2YXYA 3S52A 2KEAA 2XMFA 2EQIA 2ZPIB 4MZMA 1X01A 3CCMQ 1XTDA 3CCSA 1UGRB 4M77A 4F7UG 4GY5A 2VKNA 3LWHA 2CUDA 1Y0MA 2EQKA 1Y96B 1VQOA 1G3WA 2MOXA 4BUGA 1WJQA 2EAYA 4A4GA 3G4SA 1VQ7T 3CC2Q 5IN1A 4JDSA 3ASKA 1GCQA 4J9IA 3O5ZA 1S72A 4DBHA 1UGQB 4ZTFA 4LE9A 3FEOA 2E3HA 1M1FA 2XDBA 2LJ1A 1B34B 4N0AA 1EFNA 3M58A 1YI2Q 1W1FA 1LNXA 1IHVA 3H41A 2VC8A 4OGEA 2RHUA 5GAN6 1HXDA 4Y28E 1UJYA 2FYKA 2HBWA 1WHLA 2MK5A 2MCNA 3CCJQ 2HKNA 3CD6A 2E1HA 1TUGB 3MJXA 2EB4A 4RTYA 2RJCA 1E6GA 2RQRA 2LQWA 1AD5A 3C95A 3NHNA 3CCRT 3WVDB 3A8GB 4CC2A 5I22A 2EFIA 1OX8A 2LCCA 4AT1B 4QW2A 1K8AU 5FU7C 3JV3A 3OYCA 3UT1A 2JN0A 2LX7A 2OTLQ 2DLPA 5GAMh 2DEUA 4KGZB 1U1SA 2B86A 1M1KR 3PGGA 3VU3C 5CKEA 3GBQA 5LJ3h 3DB3A 2KQWA 1X6OA 2K3XA 3G6EA 1VQ6A 2F2WA 4J8OA 3VKIA 4M7AC 2HD0A 2KAFA 1MV0B 4RG8A 4J9DA 1QVGP 3SDZA 4LD6A 1G5VA 4AFUC 4C8QF 2D1XA 2Y90A 3QWXX 2GBQA 2HL3A 5D6XA 1YITA 3M0TA 3ULRB 2EQUA 3OYDA 3CCEA 2M9UA 1GCPA 2DIGA 2LRQA 3OW2A 4MDXA 1ZSZB 3A5ZB 2DTHA 4D6WA 1VOMA 3LW5E 2FPDA 2VXFA 5GAN3 1E7OA 2RK2A 2MPXC 4CRIA 3LH0A 4Z89A 4C0DC 3CPWP 1NEBA 2DERA 3OBWA 4XTUA 2VGMA 2QASA 1SRLA 2DD5A 1W2BA 4M7AG 2HQHA 1ABOA 4A4EA 5KCOA 2F69A 1YWOA 1YJWA 3PMIA 3EG2A 4M75F 2JTMA 5GMKh 1EZZB 3G71Q 1FMKA 2EJFA 5GJVB 1BI1A 4C92E 2Q18X 2MYSA 3RKXA 2KY9A 3EH2A 3VS3A 2QTXA 3M0UA 2ZPGB 4XTWA 2MF2A 4BY6B 5A0DA 4BACA 3BW1A 3WVEB 1YP5A 3L2UA 4PJLA 2K57A 4M7AA 4PL6A 3VS7A 1RABB 2V26A 4BI8B 3EGUA 1E6HA 3QHSA 4RTUA 4M7DD 1QVFP 1NYFA 1JJ2S 4DEYA 2DL5A 3RKYA 3OBYA 3A98A 2NLUA 2VUBA 2DL7A 2ZAEA 3C12A 2V8IA 1PRLC 3EGDB 1C6VX 4M7DG 1RL2A 3M53A 1K1ZA 3J81E 2YDLA 1UGSB 3CC4T 5D2IA 5FWCA 1IB8A 2Q1CX 5GAMg 4J6XA 4OMMA 3TQ7P 2DL8A 3DB4A 2JNGA 2A36A 1VQ4Q 2AT1B 5LJ3g 4PJJA 2RQVA 4RCBA 4CC3A 1M4ZA 3TSWA 1Q86U 2DEQA 3OYIA 4M7DA 1WGSA 1VQLT 4IUUA 1KHCA 2YUOA 1OPKA 2QK0A 3M0QA 2EW3A 4HVWA 4HT9A 4XTXA 2NUTB 1AVZC 4M78B 2KI7A 1OX9A 3I55Q 4GBQA 1AWOA 4JLIA 2DJZA 5HCKA 1M3AA 3CCUQ 1H8KA 1Y96A 1LOJA 2CZ1B 3VRYA 2I0NA 2RPNA 1WPYA 1T0HA 4KRTA 1I1JA 4Z88A 3H0FA 5I2SA 2EB5A 1MUZA 2ED0A 1YJ9A 1VQ8Q 1D1CA 2QDLA 2Q1AX 1R0BG 1BCMA 4PLLA 1VUBA 5GAOn 3FJ5A 1TG0A 2F5TX 4AFZC 1Q86C 3E19A 5DY9A 3MPUB 3CMET 3I56Q 1YIJT 4PJOF 1SSFA 1WLPB 3THKA 2XDPA 2RHYA 2FZCB 1BK2A 2LT1A 3U23A 4BDYA 1AWXA 1PM3A 4C0FA 2DMOA 4AG2C 2M0YA 3VS1A 2GF7A 1KD1R 3JCMb 4P5NA 3VS6A 3ER0A 2J05A 3QBYA 2NUPB 4DOVA 2FVUA 4HVUA 2XU8A 3MEUA 5I11A 1SV6A 3VS4A 4FYVB 2PTKA 3RBBB 2VGNA 2FZGB 4L6V5 3DLLA 1IXDA 2NUZA 3NFCA 2XICA 3PVQA 1JXOA 2D6FA 1K0XA 4FYXB 4RG2A 1MHNA 2HCKA 2RM4A 3CCLT 3VS0A 1YNZA 1WHHA 3ZBDA 4HCCA 3R6OA 4JJNK 3G4SQ 4LDWA 1KHIA 1VIEA 4BB7A 1VQNQ 2HKQB 1JJ2A 3RIRA 1VQ9A 1RAHB 1I7OA 1MNEA 1K9MC 1ZSZA 2YUQA 3IQLA 4F7UB 2QA4T 5GAN7 3OYYA 2KSSA 4QVCA 4C5HA 2CZ7B 3NGPA 2KVQG 1UFFA 3M54A 3BQBA 4J7IA 3M57A 3QWYA 5GMKm 3L2WA 3OMGA 1SSHA 5GANe 3CCST 3EG0A 3CD6Q 3CC4A 1K76A 1Q82C 1D0XA 3V77A 1VQOT 4C5EA 3G4ST 1NPRA 4C92B 2DZ9A 2E10A 3ZL7C 1S72T 3H0HA 2AZVA 4BE2A 1YHQA 4BE0A 3CCVA 4N4HA 2CH4A 2RK1A 3RUXA 4QQDA 1PD0A 2DF6A 3SHWA 1PKTA 1JBMA 4AFQC 1JJ2P 1M1GA 2SRCA 3E9FA 3QXEB 2A7YA 4IIOA 1P92A 5IHKA 4JZ3A 3SB2A 1YN8A 4E7IA 2LNVA 1WX6A 5LL6S 5GANf 4RTWA 1K8AR 2QQBA 4J7FA 5GAMj 5L8RE 3EGDA 4X9DA 3VRZA 4FU6A 1KG1A 1ZUYA 4JUVA 4M78D 2QEXA 4E7KA 3CCEQ 2GFUA 4DQ2A 2JTEA 1WA7A 1YJNQ 5LJ3j 2QQSA 2YLCA 4NL2A 4M78G 1GXIE 5A0GA 1U06A 1TS9A 4R55A 2Q1DX 4FM4B 1QKWA 3CCQA 1LPLA 3QYGB 4JLGA 3OA6A 3P8DA 1Q7YU 2X4WA 3JCMe 5FU7B 3G6ET 1VQ6T 1QVPA 1RAAB 2V8JA 2EBPA 1M30A 1VQ5A 1NR9A 5CCAA 2DIQA 2O88A 1KJWA 4C8QE 1BCOA 7AT1B 1YJWQ 2YSQA 2NUTA 1YITT 2LTOA 2B8AA 2E64A 2XKOC 4M78A 3CCET 2CH4W 2J6FA 2CUBA 2O2OA 3EFOA 4IIMA 2D0QB 4M7AB 3TCJA 1OZ3A 1WZOA 4PJOC 2E12A 1WXBA 4O6JA 4A4HA 1OEBA 1KC8U 1WJRA 2KNBB 2JS0A 3OSVA 1XJWB 1WQWA 3JCMV 1WIEA 3OB9A 3PMTA 3MKDA 1VQMA 3V8LA 1SRMA 5CKBA 2BE9B 2E3IA 4C0ZA 1WFWA 2MIOA 1WJSA 2RQUA 5GAOp 4M75E 9ATCB 2LQ8A 5CKFA 2COZA 1Q7YC 2Z0WA 1R8OB 4M77D 5IAYA 5IH2A 2BKDN 2VVKA 3JSCA 4XTVA 3EH1A 4C0DB 1ZA1B 3FDRA 3I35A 5GAN2 3VUBA 3D7SB 4XTYA 2LP5A 3META 5GANh 1NE8A 3JB9G 3G1JA 3PE0A 2RHXA 4AG1C 1QCOA 1SPKA 4VUBA 2QQAA 1IRXA 4ZGDB 3QUIA 2QTVA 4GLKA 1RI0A 3N5BB 4L59A 2NUPA 3OS5A 2KT8A 2DILA 2XK0A 3T9NA 1BB9A 2L3SA 3I5RA 3RMSA 2PU9B 4D8DA 1PKSA 1I8FA 1X2QA 1WXUA 4QQGA 1GFDA 1Z9ZA 4ZNXA 1OQKA 4EMKC 3CCRQ 3BY7A 2MI6A 2FO0A 5D2GA 3GNGA 5GAMd 3HHTB 4PNOA 1F1BB 5KYWA 5FRMA 2I2LA 1Q86R 4YTLA 3MEWA 3CXCS 2RA2A 2ENMA 1NJIC 2QXFA 1BU1A 1Q81C 5LJ3d 3GF5A 1QVGA 1AHJB 2EYQA 4C92G 5D6YA 1YJ9Q 4F7UA 4J9HA 1G3SA 2DVEA 2CP5A 1ACMB 3OYHA 1U1TA 4DBFA 2DKGA 4KGXB 1HJDA 3CC7A 5GAOm 1KQSS 3QIIA 1JO8A 3E2UA 4E47A 1GFCA 2M51A 2P0KA 3LZKA 2K7AA 2QGFB 1X27A 4PJNA 4FT2A 3CPWA 1WNLA 2WSEE 4C92A 2BTTA 5KCHA 4UC4A 2A28A 1FYNA 1LJOA 2P4TA 5AT1B 3OYJA 4FW2A 2RJFA 3Q1JA 1YJ9T 2YRDA 2LT4A 4KBMB 5CR2A 2AHJB 2LQKA 3E1SA 2LQNA 3EHQA 4PJOE 4JZ4A 3MEAA 1AOJA 1KIKA 2RI3A 1X6BA 4LDYA 3L2QA 4F17A 2EJ9A 4ZGEB 4E7LA 4F14A 3J80E 1VQ9Q 1Y7XA 2ABLA 1QVFA 3RKWA 4OMPA 3CBPA 2DYIA 1JB0E 2ZZDA 4M7AD 4LN2A 2K3BA 4ORZA 3V8KA 2BZYA 4Q5WA 2FEIA 3RDVA 1ABQA 1Q82R 3RERA 2LDMA 4M4ZA 1UGPB 3M9QA 4QQ6A 2X4JA 4ZN3A 3V7SA 3M59A 2FPEA 2IPOB 1WI7A 1C0MA 1ZX6A 5FRNA 1D3BB 1I0CA 2E5KA 3CC4Q 2HMAA 2KXDA 5I21A 4JPBW 1IO6A 3GOXA 5A2QE 2LX9A 5KYXA 1M90U 3OYAA 2ECZA 4WTOB 2RD1A 1WXTA 2CKKA 1O9SA 1VQ9T 1IHWA 4DA4A 1YHQQ 2DL3A 4FCYA 3VS2A 3MCAB 4HCKA 5CAIA 3UF4A 3CPFA 1BYMA 2DNUA 1O75A 2DK3A 2GTJA 2X35A 2CT3A 2ZGWA 4Y92A 1VQLQ 4JS5A 3QKJA 1RI9A 1GBRA 1BI3A 2R5MA 3L2VA 1YBYA 1SEMA 3EGXB 2H3JA 6AT1B 1T3LA 1HSQA 2D9TA 4KUDK 3DLMA 1QWFA 3M55A 4JRPA 1NM7A 3HL8A 1QCNA 1VYVA 4OMLA 3GPLA 1YHQT 3CCVT 3FC3A 1BI0A 3OS0A 1M90C 1K9AA 4FIBA 2KROA 1GBQA 2IIMA 4MAQA 4E7ZA 3TREA 4M78F 2F5KA 4E7JA 1KQSA 3A1PA 1YCYA 5CKHA 3CCQQ 1D1BA 2CP2A 4RCCA 3PFSA 1N8RC 1VQPA 1K4US 2RF0A 4FYYB 1RUWA 1VQ5Q 4IKFA 1ZBXA 2GQVA 5HY6A 2QGGA 4NOYA 2P0PA 2DD4A 1QP2A 4FYWB 1TH7A 3CMEQ 4KGVB 4CC7A 1YIJQ 1K0SA 1B7TA 1QQJA 2K2VA 1K73C 3EFOB 3NPFA 1C1AA 3RNJA 1CKBA 2QEXT 2HEQA 2OTJA 3JCMP 2FZKB 1OV3A 3PNWC 3EFSA 1JQQA 4J83A 4MMKA 3CCMA 2XD0A 3CXCP 3QDFA 3VV0A 1Q7YR 2K5IA 4LUEA 1D0YA 3CCQT 3FLGA 2EYWA 2EB6A 4A4KA 2A37A 4Y91A 4ATOA 2VYTA 3DKMA 4OB3B 3CMAA 1VQMQ 1VQ5T 3MP6A 2DVJA 2M02A 1KQSP 3OYMA 2BE7D 3M0RA 1MMGA 1FMVA 1YI2A 1BIBA 4OP0A 1WHMA 4D8KA 3CCLQ 1K9MU 5D2JA 4KT0E 2BUDA 4LNPA 2ZPEB 3X28B 1U3OA 2YT6A 4DBQA 1OOTA 2KRMA 1PCXA 3UA7A 1KC8R 1D09B 4M77F 4C8QC 5LJ5e 3GP8A 3QG1A 2VXEA 2LCLA 1FMWA 5DM7R 5CVIA 2QA4Q 2L2PA 3EG9A 4ZTJA 4E7HA 4TVRA 3A8OB 1PSEA 3S6WA 4RKUE 2KK4A 3PIOA 4MMLA 1Q82U 2O9VA 1VQMT 2OTLA 5C0MA 3JCMc 4OMOA 4PJOB 4EMHA 4KULA 4M7DE 3CCSQ 3BE3A 1RLQC 2EPDA 5GANj 1TWBA 4OMQA 4EMGA 3RR6A 4F7UF 2RI5A 1VQOQ 1RAFB 1X43A 2WSCE 4DOWA 1KSWA 5KYWB 1GRIA 2L0AA 3X20B 4C8QG 2EIFA 1S72Q 4M75C 2L3QA 4JRQA 1X2KA 4FSSA 1M1KC 1TUCA 2BIVA 2L3PA 3VUZA 5LJ5f 2JM9A 2MAMA 1JEGA 2QYZA 4C0GA 1MMAA 1OI1A 1G83A 3JB9H 2FRYA 2RJEA 1SG5A 4BE1A 1OU8A 4OB1B 2HZYA 5GMKl 4RMOA 2FHDA 2C0IA 4IUPA 4OGCA 3UA6A 2JS2A 3VS5A 2C06A 5KE2A 4JJCA 2E4HA 1H3HA 4C8QA 1H92A 1N9SA 4R56A 1D3BA 1HD3A 1DJ7B 2J6KA 1TOVA 2YRVA 5IXBA 5IHIA 3OY9A 1PG5B 4OMNA 4ZGJB 2LZ6B 3OYBA 2AKKA 4M75G 2DBMA 4BD3A 2CSIA 4KUIA 3G71A 1RACB 2LMJA 2V8KA 2MMPA 4EMKB 4OMFB 3MEVA 3M4YA 3F70A 4XQ3A 2DZCA 4HXJA 4PFOA 3OS1A 3CEYA 3G6EQ 1VQ6Q 3S3OA 5FROA 1G3YA 2X9HA 5GAOq 2WSFE 2BZ8A 3CC7T 3TVTA 5GJWB 4E6RA 4M75A 3OYFA 1YITQ 3EGXA 1X6GA 2JM8A 2DTOA 2P0QA 2K2MA 2HL5C 1UE9A 3UATA 1NKQA 2OI3A 4NL3A 2DX1A 5KYYB 2CZ6B 4XU1A 2DL4A 5D7UA 1M8VA 1B07A 2ESWA 3LLRA 2KYMA 4HCZA 5DLOA 3QSUA 5FWBA 3O8VA 1VQ4A 3I5SA 1N5ZA 1OPLA 1QCFA 1NEGA 2EYXA 1M27C 5CKDA 5LJ5h 2EVRA 4M7AF 1Y07A 2DXCA 4KH1B 5KYXB 3MP1A 1G2BA 1T0JA 2HDAA 1VQKA 3HRTA 5IXFA 2EJGA 3EFRA 2CP6A 2LNHB 3A8HB 3V8JA 3MHXA 1H641 5J26A 1ARKA 1XQHA 3JB9I 5GANd 3I9QA 4QKUA 4B9XA 4ELZC 4LXCA 3C0CA 3I55A 1NLOC 2EYYA 3LYIA 1GTTA 2GCXA 2YRCA 1ZA2B 3CCUA 2WQTA 2IVWA 4RTVA 2HAXA 4M77C 5D6WA 2K5LA 3JCMf 1LVKA 2DJQA 3CQTA 3QPHA 3LH5A 3HP9A 3A8MB 2DXUA 1V1CA 3E9GA 5CQYA 1UEBA 1UTIA 4OB2B 1M90R 2F2XA 3PVLA 4M7DF 1GCQC 2JMAA 4PJOD 2KT1A 2R57A 1AT1B 3OW2S 3JB9D 1NJIU 2DTIA 1N9RA 4N0AC 1Q81U 2L5QA 4PJOG 2CGHA 3I56A 2LCSA 2XG8D 3SD4A 4FSXA 2JJ9A 3QZ5B 1AEYA 1WHKA 1M3BA 2DXBA 1W2BS 1NPPA 2DA9A 5FU6C 5I2MA 4XAXB 1RAIB 3S3NA 1UGVA 1AWJA 2RH2A 1TU0B 1PD1A 1G3TA 2J7IA 3H6ZA 2PUKB 2E41A 3JB9J 2ROLA 1KFZA 4F04B 5GMKe 1NLPC 4PJOA 1J3TA 3JCMd 1FX7A 1KK7A 3CBMA 3QO3A 2A08A 3C4SA 2JZ2A 4J5YA 1KD1C 1I5OB 3LGFA 1XNIA 2XDDA 4C92D 2OJ2A 1VIFA 4XU2A 2PVDB 1TSFA 5EC7A 2EQMA 4M78E 1BBZA 4IURA 1EIFA 4K11A 2AZSA 2DXTA 5LJ5g 2P84A 3M0PA 4IUQA 4ZN1A 1PSFA 1IZ6A 1QLYA 3UWNA 3C94A 3NTKA 1VQNA 1VQPT 2W10A 2DRKA 3J7AF 2QG9B 3CMAQ 4BI3A 2K3YA 5ECAA 1OU9A 3L1AA 1JXMA 3OYKA 5IT9E 4NS5A 2W0ZA 1U8RA 4XU3A 1OULA 4WCIA 5GAOl 2M1HA 4E7SA 4LDXA 4PFPA 4J9GA 2O4XA 2OTJT 1EX4A 2HQXA 3M56A 3JCMh 2PVGB 5J39A 3HRSA 4JRKA 2DBKA 3BDLA 3CCMT 2XHCA 1TUDA 2QQ9A 3EG9B 1WHGA 3UPUA 2X3WD 1N27A 2A3LA 5AYFA 3CC2T 4BI4A 2PZ1A 3HPWA 5FLXE 3QZ9B 3GLXA 3KFVA 4EMKA 3CMAT 1AZEA 2HQEA 2CSQA 4QVDA 1G8XA 1KQ2A 4FT4A 4LDUA 2V1RA 1YI2T 2CYZB 3URGA 1X69A 1K9MR 1WQ7A 2AIRB 5GANg 3M5AA 4IUTA 1ZUUA 4QVZA 1JU5C 1PNJA 2ATCB 4M77E 4L5GA 3CCJT 3AHUA 4QT7A 4JJBA 1QW1A 4EDUA 4PLIA 3OSSC 1W4SA 3MP8A 2EKOA 5EG2A 2RHIA 4J6WA 4X34A 1OYXA 5KYYA 3L2ZA 2KE9A 1ZQ1A 1SKUB 4BDZA 4V2SA 1YJNA 2OTLT 4IUVA 2KRNA 2EYZA 2RMOA 3S3MA 4C8QB 4RTXA 1K8AC 2CS7A 3KUFA 4Z8AA 2EGAA 4A4FA 4F7UE 5HK3A 2COWA 4J6YA 3JCMX 3OYEA 2V1QA 4J9FA 4EPCA 3SEMA 1ZHIA 5L23A 3CCVQ 1N8RU 3SFMA 4M7DC 3HRUA 1UHCA 1M2OA 1VA7A 3QYHB 5KE3A 5D2KA 3PIPA 2YUNA 4ESRA 2E70A 1IGQA 1MMNA 2K9GA 3X25B 5KH6A 3JCMJ 2HNIA 3PT9A 1K73U 2XIDA 1CSKA 4B9WA 2D8JA 2H8HA 3LWIA 2CREA 4M75B 3JCMg 1M9SA 1KQ1A 2PUOB 3A8LB 2AKLA 2H3EB 3OW2P 3CXCA 3RESA 4C5IA 3OQ5A 1V76A 1BIAA 2G6FX 4HCBA 4E2FB 4XK8E 4JS4A 4FL6A 2QEXQ 2HSEB 2E65A 5KYUA 2JTFA 2ED1A 2X3XD 4A53A 2EQJA 3G71T 5C6SA 2GNCA 1W2BP 2EKHA 1LCKA 1VQ7A 2QDYB 2JW4A 1QP3A 4N4IA 3UDCA 1RADB 3OS2A 2JT4A 2RN8A 2DETA 2DM1A 2F1LA 1QKXA 3EHRA 1UG1A 1YFNA 1QWEA 2IG0A 2QQRA 3H8ZA 1H3ZA 1VQKQ 1Y57A 2HBPA 3JAME 3KXTA 3EG1A 3LGLA 2FL7A 4LUDA 1M5Q1 2DE0X 4B6MA 4J9EA 2YLBA 1TXQA 2EGEA 2L8DA 3H9NA 4J9BA 2JUFA 4HT8A 4II1A 4LDVA 2P4RA 1D1AA 3HSBA 3INZA 2Y4YA 5LJ5j 3SWNB 2R5AA 4Z02A 3CCRA 3CC2A 4PKCC 2K4YA 3JCMW 2RNAA 2D0NA 1VQ4T 1M8MA 3CBOA 5GAN5 1M2VB 4M7AE 5GMKi 1WHJA 4AMCA 1UHFA 2LJ0A 3NTIA 3AT1B 1W70A 2CP7A 1I5LA 5CQXA 3OYGA 1UECA 1R0CB 3P8BB 2RI2A 1VQKT 4RTZA 1B34A 1W6XA 1X75C 1M1KU 1T3SA 3ZFJA 4ME7A 2XI9A 1ZSZC 1NBEB 2QAZA 5M9OA 3CCJA 1WYXA 1I81A 3R6NA 4R0KA 2CDTA 2FPFA 3I55T 4XTZA 1MNDA 3WXMB 2KXCA 3JB9F 1ZSGA 4KH0B 2J06A 3CCUT 4OB0B 3REBB 1GL5A 1PWTA 1U5SA 2KRSA 3LX7A 2KR3A 3G7ZA 2YHTA 1ZUKA 1UB4A 2M0OA 2ZPHB 2E5QA 2PQWA 1VQ8T 1XOVA 2DRMA 3NTHA 3ZEHA 4PJMA 1NJIR 3V7RA 4C8QD 2NYSA 2CZ0B 1Q81R 2K5FA 5J3BA 4M77B 3PTAA 1B3QA 4BY6C 1MMDA 2NWMA 3RMQA 1CKAA 3I56T 2F2VA 2R58A 2RHZA 2GGRA 3OMCA 5GAN8 2Y4XA 5KYNA 2DAQA 2E6NA 4A63B 2DO3A 2RO0A 5CO7A 2RQWA 1A0NB 2GTOA 2OAWA 2X4XA 3JRZA 4C92F 4LD9K 2PVOB 2RB6A 5GAOr 2EWNA 2JOYA 2C0OA 1SF9A 3MO8A 2VV5A 2QI2A 2O4XB 3CC7Q 1Z9QA 1SHFA 2RJDA 4M75D 4C5GA 1M3CA 2WACA 2OX7A 2LJ3A 2FB7A 5FU6B 2ZCFB 2BZXA 2OAUA 3FJPA 2DYBA 1BI2A 4ANJA 2D8HA 4HKEA 2DPPB 2K6DA 5FW9A 2ZPFB 2DFUA 3P8HA 1NYGA 5CK9A 5A0LA 3L42A 1NZ9A 4O5VA 4X9CA 3OYNA 1VQNT 3VJPA 4HA8A 2LC4A 4N4GA 1MV3A 3KBGA 5HK0A 5LJ5d 1V29B 1IREB 4XU0A 2VASA 3BDUA 4M78C 2O31A 1UJ0A 2CT4A 3SWNC 2JXBA 1IGUA
chains in the Genus database with same CATH topology
3LZKA 1QCOA 1WZOA 1NR9A 4QKUA 1SAWA 1HYOA 5D2KA 4PFZA 1QCNA 1NKQA 3RR6A 5D2GA 2Q19X 1SV6A 3R6OA 4DBHA 1GTTA 3BQBA 3S52A 4DBFA 2EB4A 2Q18X 3QDFA 5D2FA 2Q1DX 2HZYA 2WQTA 2EB5A 1QQJA 1I7OA 5D2JA 4MAQA 5D2IA 2Q1AX 5D2HA 2EB6A 2DFUA 2Q1CX 3V77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZK A;  1QCO A;  1WZO A;  1NR9 A;  4QKU A;  1SAW A;  1HYO A;  5D2K A;  4PFZ A;  1QCN A;  1NKQ A;  3RR6 A;  5D2G A;  2Q19 X;  1SV6 A;  3R6O A;  4DBH A;  1GTT A;  3BQB A;  3S52 A;  4DBF A;  2EB4 A;  2Q18 X;  3QDF A;  5D2F A;  2Q1D X;  2HZY A;  2WQT A;  2EB5 A;  1QQJ A;  1I7O A;  5D2J A;  4MAQ A;  5D2I A;  2Q1A X;  5D2H A;  2EB6 A;  2DFU A;  2Q1C X;  3V77 A; 
#chains in the Genus database with same CATH topology
 3M0S A;  1VQL A;  3HFN A;  2KDS A;  3FIF A;  2L3R A;  2FG0 A;  1TTH B;  8AT1 B;  3GIB A;  1VYT A;  5GAN 4;  2ROT A;  3CD6 T;  1PC0 A;  4JJD A;  2CP3 A;  2SEM A;  1UUE A;  2VWF A;  1YWP A;  4PK4 A;  3L2R A;  1QVG S;  5IHN A;  2K79 A;  4EIK A;  1RAG B;  1YCS B;  5CIU A;  2GFA A;  3X24 B;  2RQT A;  8ATC B;  3GNF B;  3OYL A;  1AZG B;  1ZBJ A;  2X4Y A;  4WF2 A;  1MGQ A;  1I4K 1;  2Q19 X;  2ZPB B;  3VYH B;  4J9C A;  1I07 A;  2E6Z A;  2O01 E;  3FRN A;  4FW1 A;  5D2F A;  2COY A;  1ZLM A;  2G3R A;  4MDW A;  1PHT A;  1QMC A;  1Q95 G;  3X26 B;  1D0Z A;  1UDL A;  3CPW S;  2M16 A;  2JVV A;  1RLP C;  4HVV A;  5GAM e;  1Y71 A;  1BKB A;  3TU4 K;  3CME A;  1YIJ A;  4CC4 B;  1N6A A;  2J6O A;  3QJ6 A;  1WDX A;  2A0F B;  4OF1 A;  4DEX A;  2LVM A;  5LJ3 e;  4X1V A;  2KYB A;  4A54 A;  1R77 A;  3EG3 A;  3SWN A;  1YJN T;  3QDR B;  4GLM A;  2O9S A;  4MZP A;  1SHG A;  2X51 A;  4RTT A;  1VYU A;  4F16 A;  1AWW A;  3JCM Q;  3ME9 A;  2C0T A;  5DLQ E;  1M2V A;  1SAW A;  1KD1 U;  1HYO A;  2VB6 A;  4JRI A;  1VQ8 A;  4CI0 C;  5KYU B;  5GMK j;  3TEE A;  1N8R R;  1QVF S;  3BFM A;  2FRW A;  3QJY A;  2HSP A;  2YUP A;  1YJW T;  2MWP A;  3M4G A;  1JRI A;  5GAM f;  3V7C A;  3CCL A;  1OZ2 A;  4PFZ A;  1PRM C;  2EGC A;  2KBT A;  1K73 R;  4AFS C;  1VQ7 Q;  2MWO A;  2CP0 A;  4M77 G;  1VQP Q;  5LJ3 f;  3REA B;  2PNI A;  3HKS A;  2YWW A;  5HKC A;  1HK9 A;  2AK5 A;  3NMZ C;  5D2H A;  4ELY C;  3VYG A;  4M7D B;  2L89 A;  1FXX A;  4MZT A;  2QA4 A;  2KGT A;  4DBR A;  2GQI A;  1NG2 A;  1RAE B;  3HTR A;  4RUG A;  1S1N A;  1FWZ A;  2JMC A;  3FB9 A;  4C92 C;  3EAE A;  4OVA A;  2KMT A;  3HFO A;  1KC8 C;  3TSZ A;  3H0I A;  2OTJ Q;  2YXY A;  3S52 A;  2KEA A;  2XMF A;  2EQI A;  2ZPI B;  4MZM A;  1X01 A;  3CCM Q;  1XTD A;  3CCS A;  1UGR B;  4M77 A;  4F7U G;  4GY5 A;  2VKN A;  3LWH A;  2CUD A;  1Y0M A;  2EQK A;  1Y96 B;  1VQO A;  1G3W A;  2MOX A;  4BUG A;  1WJQ A;  2EAY A;  4A4G A;  3G4S A;  1VQ7 T;  3CC2 Q;  5IN1 A;  4JDS A;  3ASK A;  1GCQ A;  4J9I A;  3O5Z A;  1S72 A;  4DBH A;  1UGQ B;  4ZTF A;  4LE9 A;  3FEO A;  2E3H A;  1M1F A;  2XDB A;  2LJ1 A;  1B34 B;  4N0A A;  1EFN A;  3M58 A;  1YI2 Q;  1W1F A;  1LNX A;  1IHV A;  3H41 A;  2VC8 A;  4OGE A;  2RHU A;  5GAN 6;  1HXD A;  4Y28 E;  1UJY A;  2FYK A;  2HBW A;  1WHL A;  2MK5 A;  2MCN A;  3CCJ Q;  2HKN A;  3CD6 A;  2E1H A;  1TUG B;  3MJX A;  2EB4 A;  4RTY A;  2RJC A;  1E6G A;  2RQR A;  2LQW A;  1AD5 A;  3C95 A;  3NHN A;  3CCR T;  3WVD B;  3A8G B;  4CC2 A;  5I22 A;  2EFI A;  1OX8 A;  2LCC A;  4AT1 B;  4QW2 A;  1K8A U;  5FU7 C;  3JV3 A;  3OYC A;  3UT1 A;  2JN0 A;  2LX7 A;  2OTL Q;  2DLP A;  5GAM h;  2DEU A;  4KGZ B;  1U1S A;  2B86 A;  1M1K R;  3PGG A;  3VU3 C;  5CKE A;  3GBQ A;  5LJ3 h;  3DB3 A;  2KQW A;  1X6O A;  2K3X A;  3G6E A;  1VQ6 A;  2F2W A;  4J8O A;  3VKI A;  4M7A C;  2HD0 A;  2KAF A;  1MV0 B;  4RG8 A;  4J9D A;  1QVG P;  3SDZ A;  4LD6 A;  1G5V A;  4AFU C;  4C8Q F;  2D1X A;  2Y90 A;  3QWX X;  2GBQ A;  2HL3 A;  5D6X A;  1YIT A;  3M0T A;  3ULR B;  2EQU A;  3OYD A;  3CCE A;  2M9U A;  1GCP A;  2DIG A;  2LRQ A;  3OW2 A;  4MDX A;  1ZSZ B;  3A5Z B;  2DTH A;  4D6W A;  1VOM A;  3LW5 E;  2FPD A;  2VXF A;  5GAN 3;  1E7O A;  2RK2 A;  2MPX C;  4CRI A;  3LH0 A;  4Z89 A;  4C0D C;  3CPW P;  1NEB A;  2DER A;  3OBW A;  4XTU A;  2VGM A;  2QAS A;  1SRL A;  2DD5 A;  1W2B A;  4M7A G;  2HQH A;  1ABO A;  4A4E A;  5KCO A;  2F69 A;  1YWO A;  1YJW A;  3PMI A;  3EG2 A;  4M75 F;  2JTM A;  5GMK h;  1EZZ B;  3G71 Q;  1FMK A;  2EJF A;  5GJV B;  1BI1 A;  4C92 E;  2Q18 X;  2MYS A;  3RKX A;  2KY9 A;  3EH2 A;  3VS3 A;  2QTX A;  3M0U A;  2ZPG B;  4XTW A;  2MF2 A;  4BY6 B;  5A0D A;  4BAC A;  3BW1 A;  3WVE B;  1YP5 A;  3L2U A;  4PJL A;  2K57 A;  4M7A A;  4PL6 A;  3VS7 A;  1RAB B;  2V26 A;  4BI8 B;  3EGU A;  1E6H A;  3QHS A;  4RTU A;  4M7D D;  1QVF P;  1NYF A;  1JJ2 S;  4DEY A;  2DL5 A;  3RKY A;  3OBY A;  3A98 A;  2NLU A;  2VUB A;  2DL7 A;  2ZAE A;  3C12 A;  2V8I A;  1PRL C;  3EGD B;  1C6V X;  4M7D G;  1RL2 A;  3M53 A;  1K1Z A;  3J81 E;  2YDL A;  1UGS B;  3CC4 T;  5D2I A;  5FWC A;  1IB8 A;  2Q1C X;  5GAM g;  4J6X A;  4OMM A;  3TQ7 P;  2DL8 A;  3DB4 A;  2JNG A;  2A36 A;  1VQ4 Q;  2AT1 B;  5LJ3 g;  4PJJ A;  2RQV A;  4RCB A;  4CC3 A;  1M4Z A;  3TSW A;  1Q86 U;  2DEQ A;  3OYI A;  4M7D A;  1WGS A;  1VQL T;  4IUU A;  1KHC A;  2YUO A;  1OPK A;  2QK0 A;  3M0Q A;  2EW3 A;  4HVW A;  4HT9 A;  4XTX A;  2NUT B;  1AVZ C;  4M78 B;  2KI7 A;  1OX9 A;  3I55 Q;  4GBQ A;  1AWO A;  4JLI A;  2DJZ A;  5HCK A;  1M3A A;  3CCU Q;  1H8K A;  1Y96 A;  1LOJ A;  2CZ1 B;  3VRY A;  2I0N A;  2RPN A;  1WPY A;  1T0H A;  4KRT A;  1I1J A;  4Z88 A;  3H0F A;  5I2S A;  2EB5 A;  1MUZ A;  2ED0 A;  1YJ9 A;  1VQ8 Q;  1D1C A;  2QDL A;  2Q1A X;  1R0B G;  1BCM A;  4PLL A;  1VUB A;  5GAO n;  3FJ5 A;  1TG0 A;  2F5T X;  4AFZ C;  1Q86 C;  3E19 A;  5DY9 A;  3MPU B;  3CME T;  3I56 Q;  1YIJ T;  4PJO F;  1SSF A;  1WLP B;  3THK A;  2XDP A;  2RHY A;  2FZC B;  1BK2 A;  2LT1 A;  3U23 A;  4BDY A;  1AWX A;  1PM3 A;  4C0F A;  2DMO A;  4AG2 C;  2M0Y A;  3VS1 A;  2GF7 A;  1KD1 R;  3JCM b;  4P5N A;  3VS6 A;  3ER0 A;  2J05 A;  3QBY A;  2NUP B;  4DOV A;  2FVU A;  4HVU A;  2XU8 A;  3MEU A;  5I11 A;  1SV6 A;  3VS4 A;  4FYV B;  2PTK A;  3RBB B;  2VGN A;  2FZG B;  4L6V 5;  3DLL A;  1IXD A;  2NUZ A;  3NFC A;  2XIC A;  3PVQ A;  1JXO A;  2D6F A;  1K0X A;  4FYX B;  4RG2 A;  1MHN A;  2HCK A;  2RM4 A;  3CCL T;  3VS0 A;  1YNZ A;  1WHH A;  3ZBD A;  4HCC A;  3R6O A;  4JJN K;  3G4S Q;  4LDW A;  1KHI A;  1VIE A;  4BB7 A;  1VQN Q;  2HKQ B;  1JJ2 A;  3RIR A;  1VQ9 A;  1RAH B;  1I7O A;  1MNE A;  1K9M C;  1ZSZ A;  2YUQ A;  3IQL A;  4F7U B;  2QA4 T;  5GAN 7;  3OYY A;  2KSS A;  4QVC A;  4C5H A;  2CZ7 B;  3NGP A;  2KVQ G;  1UFF A;  3M54 A;  3BQB A;  4J7I A;  3M57 A;  3QWY A;  5GMK m;  3L2W A;  3OMG A;  1SSH A;  5GAN e;  3CCS T;  3EG0 A;  3CD6 Q;  3CC4 A;  1K76 A;  1Q82 C;  1D0X A;  3V77 A;  1VQO T;  4C5E A;  3G4S T;  1NPR A;  4C92 B;  2DZ9 A;  2E10 A;  3ZL7 C;  1S72 T;  3H0H A;  2AZV A;  4BE2 A;  1YHQ A;  4BE0 A;  3CCV A;  4N4H A;  2CH4 A;  2RK1 A;  3RUX A;  4QQD A;  1PD0 A;  2DF6 A;  3SHW A;  1PKT A;  1JBM A;  4AFQ C;  1JJ2 P;  1M1G A;  2SRC A;  3E9F A;  3QXE B;  2A7Y A;  4IIO A;  1P92 A;  5IHK A;  4JZ3 A;  3SB2 A;  1YN8 A;  4E7I A;  2LNV A;  1WX6 A;  5LL6 S;  5GAN f;  4RTW A;  1K8A R;  2QQB A;  4J7F A;  5GAM j;  5L8R E;  3EGD A;  4X9D A;  3VRZ A;  4FU6 A;  1KG1 A;  1ZUY A;  4JUV A;  4M78 D;  2QEX A;  4E7K A;  3CCE Q;  2GFU A;  4DQ2 A;  2JTE A;  1WA7 A;  1YJN Q;  5LJ3 j;  2QQS A;  2YLC A;  4NL2 A;  4M78 G;  1GXI E;  5A0G A;  1U06 A;  1TS9 A;  4R55 A;  2Q1D X;  4FM4 B;  1QKW A;  3CCQ A;  1LPL A;  3QYG B;  4JLG A;  3OA6 A;  3P8D A;  1Q7Y U;  2X4W A;  3JCM e;  5FU7 B;  3G6E T;  1VQ6 T;  1QVP A;  1RAA B;  2V8J A;  2EBP A;  1M30 A;  1VQ5 A;  1NR9 A;  5CCA A;  2DIQ A;  2O88 A;  1KJW A;  4C8Q E;  1BCO A;  7AT1 B;  1YJW Q;  2YSQ A;  2NUT A;  1YIT T;  2LTO A;  2B8A A;  2E64 A;  2XKO C;  4M78 A;  3CCE T;  2CH4 W;  2J6F A;  2CUB A;  2O2O A;  3EFO A;  4IIM A;  2D0Q B;  4M7A B;  3TCJ A;  1OZ3 A;  1WZO A;  4PJO C;  2E12 A;  1WXB A;  4O6J A;  4A4H A;  1OEB A;  1KC8 U;  1WJR A;  2KNB B;  2JS0 A;  3OSV A;  1XJW B;  1WQW A;  3JCM V;  1WIE A;  3OB9 A;  3PMT A;  3MKD A;  1VQM A;  3V8L A;  1SRM A;  5CKB A;  2BE9 B;  2E3I A;  4C0Z A;  1WFW A;  2MIO A;  1WJS A;  2RQU A;  5GAO p;  4M75 E;  9ATC B;  2LQ8 A;  5CKF A;  2COZ A;  1Q7Y C;  2Z0W A;  1R8O B;  4M77 D;  5IAY A;  5IH2 A;  2BKD N;  2VVK A;  3JSC A;  4XTV A;  3EH1 A;  4C0D B;  1ZA1 B;  3FDR A;  3I35 A;  5GAN 2;  3VUB A;  3D7S B;  4XTY A;  2LP5 A;  3MET A;  5GAN h;  1NE8 A;  3JB9 G;  3G1J A;  3PE0 A;  2RHX A;  4AG1 C;  1QCO A;  1SPK A;  4VUB A;  2QQA A;  1IRX A;  4ZGD B;  3QUI A;  2QTV A;  4GLK A;  1RI0 A;  3N5B B;  4L59 A;  2NUP A;  3OS5 A;  2KT8 A;  2DIL A;  2XK0 A;  3T9N A;  1BB9 A;  2L3S A;  3I5R A;  3RMS A;  2PU9 B;  4D8D A;  1PKS A;  1I8F A;  1X2Q A;  1WXU A;  4QQG A;  1GFD A;  1Z9Z A;  4ZNX A;  1OQK A;  4EMK C;  3CCR Q;  3BY7 A;  2MI6 A;  2FO0 A;  5D2G A;  3GNG A;  5GAM d;  3HHT B;  4PNO A;  1F1B B;  5KYW A;  5FRM A;  2I2L A;  1Q86 R;  4YTL A;  3MEW A;  3CXC S;  2RA2 A;  2ENM A;  1NJI C;  2QXF A;  1BU1 A;  1Q81 C;  5LJ3 d;  3GF5 A;  1QVG A;  1AHJ B;  2EYQ A;  4C92 G;  5D6Y A;  1YJ9 Q;  4F7U A;  4J9H A;  1G3S A;  2DVE A;  2CP5 A;  1ACM B;  3OYH A;  1U1T A;  4DBF A;  2DKG A;  4KGX B;  1HJD A;  3CC7 A;  5GAO m;  1KQS S;  3QII A;  1JO8 A;  3E2U A;  4E47 A;  1GFC A;  2M51 A;  2P0K A;  3LZK A;  2K7A A;  2QGF B;  1X27 A;  4PJN A;  4FT2 A;  3CPW A;  1WNL A;  2WSE E;  4C92 A;  2BTT A;  5KCH A;  4UC4 A;  2A28 A;  1FYN A;  1LJO A;  2P4T A;  5AT1 B;  3OYJ A;  4FW2 A;  2RJF A;  3Q1J A;  1YJ9 T;  2YRD A;  2LT4 A;  4KBM B;  5CR2 A;  2AHJ B;  2LQK A;  3E1S A;  2LQN A;  3EHQ A;  4PJO E;  4JZ4 A;  3MEA A;  1AOJ A;  1KIK A;  2RI3 A;  1X6B A;  4LDY A;  3L2Q A;  4F17 A;  2EJ9 A;  4ZGE B;  4E7L A;  4F14 A;  3J80 E;  1VQ9 Q;  1Y7X A;  2ABL A;  1QVF A;  3RKW A;  4OMP A;  3CBP A;  2DYI A;  1JB0 E;  2ZZD A;  4M7A D;  4LN2 A;  2K3B A;  4ORZ A;  3V8K A;  2BZY A;  4Q5W A;  2FEI A;  3RDV A;  1ABQ A;  1Q82 R;  3RER A;  2LDM A;  4M4Z A;  1UGP B;  3M9Q A;  4QQ6 A;  2X4J A;  4ZN3 A;  3V7S A;  3M59 A;  2FPE A;  2IPO B;  1WI7 A;  1C0M A;  1ZX6 A;  5FRN A;  1D3B B;  1I0C A;  2E5K A;  3CC4 Q;  2HMA A;  2KXD A;  5I21 A;  4JPB W;  1IO6 A;  3GOX A;  5A2Q E;  2LX9 A;  5KYX A;  1M90 U;  3OYA A;  2ECZ A;  4WTO B;  2RD1 A;  1WXT A;  2CKK A;  1O9S A;  1VQ9 T;  1IHW A;  4DA4 A;  1YHQ Q;  2DL3 A;  4FCY A;  3VS2 A;  3MCA B;  4HCK A;  5CAI A;  3UF4 A;  3CPF A;  1BYM A;  2DNU A;  1O75 A;  2DK3 A;  2GTJ A;  2X35 A;  2CT3 A;  2ZGW A;  4Y92 A;  1VQL Q;  4JS5 A;  3QKJ A;  1RI9 A;  1GBR A;  1BI3 A;  2R5M A;  3L2V A;  1YBY A;  1SEM A;  3EGX B;  2H3J A;  6AT1 B;  1T3L A;  1HSQ A;  2D9T A;  4KUD K;  3DLM A;  1QWF A;  3M55 A;  4JRP A;  1NM7 A;  3HL8 A;  1QCN A;  1VYV A;  4OML A;  3GPL A;  1YHQ T;  3CCV T;  3FC3 A;  1BI0 A;  3OS0 A;  1M90 C;  1K9A A;  4FIB A;  2KRO A;  1GBQ A;  2IIM A;  4MAQ A;  4E7Z A;  3TRE A;  4M78 F;  2F5K A;  4E7J A;  1KQS A;  3A1P A;  1YCY A;  5CKH A;  3CCQ Q;  1D1B A;  2CP2 A;  4RCC A;  3PFS A;  1N8R C;  1VQP A;  1K4U S;  2RF0 A;  4FYY B;  1RUW A;  1VQ5 Q;  4IKF A;  1ZBX A;  2GQV A;  5HY6 A;  2QGG A;  4NOY A;  2P0P A;  2DD4 A;  1QP2 A;  4FYW B;  1TH7 A;  3CME Q;  4KGV B;  4CC7 A;  1YIJ Q;  1K0S A;  1B7T A;  1QQJ A;  2K2V A;  1K73 C;  3EFO B;  3NPF A;  1C1A A;  3RNJ A;  1CKB A;  2QEX T;  2HEQ A;  2OTJ A;  3JCM P;  2FZK B;  1OV3 A;  3PNW C;  3EFS A;  1JQQ A;  4J83 A;  4MMK A;  3CCM A;  2XD0 A;  3CXC P;  3QDF A;  3VV0 A;  1Q7Y R;  2K5I A;  4LUE A;  1D0Y A;  3CCQ T;  3FLG A;  2EYW A;  2EB6 A;  4A4K A;  2A37 A;  4Y91 A;  4ATO A;  2VYT A;  3DKM A;  4OB3 B;  3CMA A;  1VQM Q;  1VQ5 T;  3MP6 A;  2DVJ A;  2M02 A;  1KQS P;  3OYM A;  2BE7 D;  3M0R A;  1MMG A;  1FMV A;  1YI2 A;  1BIB A;  4OP0 A;  1WHM A;  4D8K A;  3CCL Q;  1K9M U;  5D2J A;  4KT0 E;  2BUD A;  4LNP A;  2ZPE B;  3X28 B;  1U3O A;  2YT6 A;  4DBQ A;  1OOT A;  2KRM A;  1PCX A;  3UA7 A;  1KC8 R;  1D09 B;  4M77 F;  4C8Q C;  5LJ5 e;  3GP8 A;  3QG1 A;  2VXE A;  2LCL A;  1FMW A;  5DM7 R;  5CVI A;  2QA4 Q;  2L2P A;  3EG9 A;  4ZTJ A;  4E7H A;  4TVR A;  3A8O B;  1PSE A;  3S6W A;  4RKU E;  2KK4 A;  3PIO A;  4MML A;  1Q82 U;  2O9V A;  1VQM T;  2OTL A;  5C0M A;  3JCM c;  4OMO A;  4PJO B;  4EMH A;  4KUL A;  4M7D E;  3CCS Q;  3BE3 A;  1RLQ C;  2EPD A;  5GAN j;  1TWB A;  4OMQ A;  4EMG A;  3RR6 A;  4F7U F;  2RI5 A;  1VQO Q;  1RAF B;  1X43 A;  2WSC E;  4DOW A;  1KSW A;  5KYW B;  1GRI A;  2L0A A;  3X20 B;  4C8Q G;  2EIF A;  1S72 Q;  4M75 C;  2L3Q A;  4JRQ A;  1X2K A;  4FSS A;  1M1K C;  1TUC A;  2BIV A;  2L3P A;  3VUZ A;  5LJ5 f;  2JM9 A;  2MAM A;  1JEG A;  2QYZ A;  4C0G A;  1MMA A;  1OI1 A;  1G83 A;  3JB9 H;  2FRY A;  2RJE A;  1SG5 A;  4BE1 A;  1OU8 A;  4OB1 B;  2HZY A;  5GMK l;  4RMO A;  2FHD A;  2C0I A;  4IUP A;  4OGC A;  3UA6 A;  2JS2 A;  3VS5 A;  2C06 A;  5KE2 A;  4JJC A;  2E4H A;  1H3H A;  4C8Q A;  1H92 A;  1N9S A;  4R56 A;  1D3B A;  1HD3 A;  1DJ7 B;  2J6K A;  1TOV A;  2YRV A;  5IXB A;  5IHI A;  3OY9 A;  1PG5 B;  4OMN A;  4ZGJ B;  2LZ6 B;  3OYB A;  2AKK A;  4M75 G;  2DBM A;  4BD3 A;  2CSI A;  4KUI A;  3G71 A;  1RAC B;  2LMJ A;  2V8K A;  2MMP A;  4EMK B;  4OMF B;  3MEV A;  3M4Y A;  3F70 A;  4XQ3 A;  2DZC A;  4HXJ A;  4PFO A;  3OS1 A;  3CEY A;  3G6E Q;  1VQ6 Q;  3S3O A;  5FRO A;  1G3Y A;  2X9H A;  5GAO q;  2WSF E;  2BZ8 A;  3CC7 T;  3TVT A;  5GJW B;  4E6R A;  4M75 A;  3OYF A;  1YIT Q;  3EGX A;  1X6G A;  2JM8 A;  2DTO A;  2P0Q A;  2K2M A;  2HL5 C;  1UE9 A;  3UAT A;  1NKQ A;  2OI3 A;  4NL3 A;  2DX1 A;  5KYY B;  2CZ6 B;  4XU1 A;  2DL4 A;  5D7U A;  1M8V A;  1B07 A;  2ESW A;  3LLR A;  2KYM A;  4HCZ A;  5DLO A;  3QSU A;  5FWB A;  3O8V A;  1VQ4 A;  3I5S A;  1N5Z A;  1OPL A;  1QCF A;  1NEG A;  2EYX A;  1M27 C;  5CKD A;  5LJ5 h;  2EVR A;  4M7A F;  1Y07 A;  2DXC A;  4KH1 B;  5KYX B;  3MP1 A;  1G2B A;  1T0J A;  2HDA A;  1VQK A;  3HRT A;  5IXF A;  2EJG A;  3EFR A;  2CP6 A;  2LNH B;  3A8H B;  3V8J A;  3MHX A;  1H64 1;  5J26 A;  1ARK A;  1XQH A;  3JB9 I;  5GAN d;  3I9Q A;  4QKU A;  4B9X A;  4ELZ C;  4LXC A;  3C0C A;  3I55 A;  1NLO C;  2EYY A;  3LYI A;  1GTT A;  2GCX A;  2YRC A;  1ZA2 B;  3CCU A;  2WQT A;  2IVW A;  4RTV A;  2HAX A;  4M77 C;  5D6W A;  2K5L A;  3JCM f;  1LVK A;  2DJQ A;  3CQT A;  3QPH A;  3LH5 A;  3HP9 A;  3A8M B;  2DXU A;  1V1C A;  3E9G A;  5CQY A;  1UEB A;  1UTI A;  4OB2 B;  1M90 R;  2F2X A;  3PVL A;  4M7D F;  1GCQ C;  2JMA A;  4PJO D;  2KT1 A;  2R57 A;  1AT1 B;  3OW2 S;  3JB9 D;  1NJI U;  2DTI A;  1N9R A;  4N0A C;  1Q81 U;  2L5Q A;  4PJO G;  2CGH A;  3I56 A;  2LCS A;  2XG8 D;  3SD4 A;  4FSX A;  2JJ9 A;  3QZ5 B;  1AEY A;  1WHK A;  1M3B A;  2DXB A;  1W2B S;  1NPP A;  2DA9 A;  5FU6 C;  5I2M A;  4XAX B;  1RAI B;  3S3N A;  1UGV A;  1AWJ A;  2RH2 A;  1TU0 B;  1PD1 A;  1G3T A;  2J7I A;  3H6Z A;  2PUK B;  2E41 A;  3JB9 J;  2ROL A;  1KFZ A;  4F04 B;  5GMK e;  1NLP C;  4PJO A;  1J3T A;  3JCM d;  1FX7 A;  1KK7 A;  3CBM A;  3QO3 A;  2A08 A;  3C4S A;  2JZ2 A;  4J5Y A;  1KD1 C;  1I5O B;  3LGF A;  1XNI A;  2XDD A;  4C92 D;  2OJ2 A;  1VIF A;  4XU2 A;  2PVD B;  1TSF A;  5EC7 A;  2EQM A;  4M78 E;  1BBZ A;  4IUR A;  1EIF A;  4K11 A;  2AZS A;  2DXT A;  5LJ5 g;  2P84 A;  3M0P A;  4IUQ A;  4ZN1 A;  1PSF A;  1IZ6 A;  1QLY A;  3UWN A;  3C94 A;  3NTK A;  1VQN A;  1VQP T;  2W10 A;  2DRK A;  3J7A F;  2QG9 B;  3CMA Q;  4BI3 A;  2K3Y A;  5ECA A;  1OU9 A;  3L1A A;  1JXM A;  3OYK A;  5IT9 E;  4NS5 A;  2W0Z A;  1U8R A;  4XU3 A;  1OUL A;  4WCI A;  5GAO l;  2M1H A;  4E7S A;  4LDX A;  4PFP A;  4J9G A;  2O4X A;  2OTJ T;  1EX4 A;  2HQX A;  3M56 A;  3JCM h;  2PVG B;  5J39 A;  3HRS A;  4JRK A;  2DBK A;  3BDL A;  3CCM T;  2XHC A;  1TUD A;  2QQ9 A;  3EG9 B;  1WHG A;  3UPU A;  2X3W D;  1N27 A;  2A3L A;  5AYF A;  3CC2 T;  4BI4 A;  2PZ1 A;  3HPW A;  5FLX E;  3QZ9 B;  3GLX A;  3KFV A;  4EMK A;  3CMA T;  1AZE A;  2HQE A;  2CSQ A;  4QVD A;  1G8X A;  1KQ2 A;  4FT4 A;  4LDU A;  2V1R A;  1YI2 T;  2CYZ B;  3URG A;  1X69 A;  1K9M R;  1WQ7 A;  2AIR B;  5GAN g;  3M5A A;  4IUT A;  1ZUU A;  4QVZ A;  1JU5 C;  1PNJ A;  2ATC B;  4M77 E;  4L5G A;  3CCJ T;  3AHU A;  4QT7 A;  4JJB A;  1QW1 A;  4EDU A;  4PLI A;  3OSS C;  1W4S A;  3MP8 A;  2EKO A;  5EG2 A;  2RHI A;  4J6W A;  4X34 A;  1OYX A;  5KYY A;  3L2Z A;  2KE9 A;  1ZQ1 A;  1SKU B;  4BDZ A;  4V2S A;  1YJN A;  2OTL T;  4IUV A;  2KRN A;  2EYZ A;  2RMO A;  3S3M A;  4C8Q B;  4RTX A;  1K8A C;  2CS7 A;  3KUF A;  4Z8A A;  2EGA A;  4A4F A;  4F7U E;  5HK3 A;  2COW A;  4J6Y A;  3JCM X;  3OYE A;  2V1Q A;  4J9F A;  4EPC A;  3SEM A;  1ZHI A;  5L23 A;  3CCV Q;  1N8R U;  3SFM A;  4M7D C;  3HRU A;  1UHC A;  1M2O A;  1VA7 A;  3QYH B;  5KE3 A;  5D2K A;  3PIP A;  2YUN A;  4ESR A;  2E70 A;  1IGQ A;  1MMN A;  2K9G A;  3X25 B;  5KH6 A;  3JCM J;  2HNI A;  3PT9 A;  1K73 U;  2XID A;  1CSK A;  4B9W A;  2D8J A;  2H8H A;  3LWI A;  2CRE A;  4M75 B;  3JCM g;  1M9S A;  1KQ1 A;  2PUO B;  3A8L B;  2AKL A;  2H3E B;  3OW2 P;  3CXC A;  3RES A;  4C5I A;  3OQ5 A;  1V76 A;  1BIA A;  2G6F X;  4HCB A;  4E2F B;  4XK8 E;  4JS4 A;  4FL6 A;  2QEX Q;  2HSE B;  2E65 A;  5KYU A;  2JTF A;  2ED1 A;  2X3X D;  4A53 A;  2EQJ A;  3G71 T;  5C6S A;  2GNC A;  1W2B P;  2EKH A;  1LCK A;  1VQ7 A;  2QDY B;  2JW4 A;  1QP3 A;  4N4I A;  3UDC A;  1RAD B;  3OS2 A;  2JT4 A;  2RN8 A;  2DET A;  2DM1 A;  2F1L A;  1QKX A;  3EHR A;  1UG1 A;  1YFN A;  1QWE A;  2IG0 A;  2QQR A;  3H8Z A;  1H3Z A;  1VQK Q;  1Y57 A;  2HBP A;  3JAM E;  3KXT A;  3EG1 A;  3LGL A;  2FL7 A;  4LUD A;  1M5Q 1;  2DE0 X;  4B6M A;  4J9E A;  2YLB A;  1TXQ A;  2EGE A;  2L8D A;  3H9N A;  4J9B A;  2JUF A;  4HT8 A;  4II1 A;  4LDV A;  2P4R A;  1D1A A;  3HSB A;  3INZ A;  2Y4Y A;  5LJ5 j;  3SWN B;  2R5A A;  4Z02 A;  3CCR A;  3CC2 A;  4PKC C;  2K4Y A;  3JCM W;  2RNA A;  2D0N A;  1VQ4 T;  1M8M A;  3CBO A;  5GAN 5;  1M2V B;  4M7A E;  5GMK i;  1WHJ A;  4AMC A;  1UHF A;  2LJ0 A;  3NTI A;  3AT1 B;  1W70 A;  2CP7 A;  1I5L A;  5CQX A;  3OYG A;  1UEC A;  1R0C B;  3P8B B;  2RI2 A;  1VQK T;  4RTZ A;  1B34 A;  1W6X A;  1X75 C;  1M1K U;  1T3S A;  3ZFJ A;  4ME7 A;  2XI9 A;  1ZSZ C;  1NBE B;  2QAZ A;  5M9O A;  3CCJ A;  1WYX A;  1I81 A;  3R6N A;  4R0K A;  2CDT A;  2FPF A;  3I55 T;  4XTZ A;  1MND A;  3WXM B;  2KXC A;  3JB9 F;  1ZSG A;  4KH0 B;  2J06 A;  3CCU T;  4OB0 B;  3REB B;  1GL5 A;  1PWT A;  1U5S A;  2KRS A;  3LX7 A;  2KR3 A;  3G7Z A;  2YHT A;  1ZUK A;  1UB4 A;  2M0O A;  2ZPH B;  2E5Q A;  2PQW A;  1VQ8 T;  1XOV A;  2DRM A;  3NTH A;  3ZEH A;  4PJM A;  1NJI R;  3V7R A;  4C8Q D;  2NYS A;  2CZ0 B;  1Q81 R;  2K5F A;  5J3B A;  4M77 B;  3PTA A;  1B3Q A;  4BY6 C;  1MMD A;  2NWM A;  3RMQ A;  1CKA A;  3I56 T;  2F2V A;  2R58 A;  2RHZ A;  2GGR A;  3OMC A;  5GAN 8;  2Y4X A;  5KYN A;  2DAQ A;  2E6N A;  4A63 B;  2DO3 A;  2RO0 A;  5CO7 A;  2RQW A;  1A0N B;  2GTO A;  2OAW A;  2X4X A;  3JRZ A;  4C92 F;  4LD9 K;  2PVO B;  2RB6 A;  5GAO r;  2EWN A;  2JOY A;  2C0O A;  1SF9 A;  3MO8 A;  2VV5 A;  2QI2 A;  2O4X B;  3CC7 Q;  1Z9Q A;  1SHF A;  2RJD A;  4M75 D;  4C5G A;  1M3C A;  2WAC A;  2OX7 A;  2LJ3 A;  2FB7 A;  5FU6 B;  2ZCF B;  2BZX A;  2OAU A;  3FJP A;  2DYB A;  1BI2 A;  4ANJ A;  2D8H A;  4HKE A;  2DPP B;  2K6D A;  5FW9 A;  2ZPF B;  2DFU A;  3P8H A;  1NYG A;  5CK9 A;  5A0L A;  3L42 A;  1NZ9 A;  4O5V A;  4X9C A;  3OYN A;  1VQN T;  3VJP A;  4HA8 A;  2LC4 A;  4N4G A;  1MV3 A;  3KBG A;  5HK0 A;  5LJ5 d;  1V29 B;  1IRE B;  4XU0 A;  2VAS A;  3BDU A;  4M78 C;  2O31 A;  1UJ0 A;  2CT4 A;  3SWN C;  2JXB A;  1IGU A; 
#chains in the Genus database with same CATH homology
 3LZK A;  1QCO A;  1WZO A;  1NR9 A;  4QKU A;  1SAW A;  1HYO A;  5D2K A;  4PFZ A;  1QCN A;  1NKQ A;  3RR6 A;  5D2G A;  2Q19 X;  1SV6 A;  3R6O A;  4DBH A;  1GTT A;  3BQB A;  3S52 A;  4DBF A;  2EB4 A;  2Q18 X;  3QDF A;  5D2F A;  2Q1D X;  2HZY A;  2WQT A;  2EB5 A;  1QQJ A;  1I7O A;  5D2J A;  4MAQ A;  5D2I A;  2Q1A X;  5D2H A;  2EB6 A;  2DFU A;  2Q1C X;  3V77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...