2DFUA

Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
251
Chain Sequence
MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
publication title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 68
structure length 251
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 2dfuA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 2dfuA02
2Q1AX 5D2IA 3R6OA 5D2GA 2EB5A 5D2KA 2WQTA 5D2FA 1QQJA 1I7OA 2HZYA 1QCOA 5D2JA 1WZOA 3S52A 2Q1DX 1GTTA 3BQBA 2Q1CX 3LZKA 2EB4A 1NKQA 4DBHA 4DBFA 1NR9A 2Q18X 2DFUA 1SV6A 5D2HA 3V77A 4QKUA 3RR6A 4PFZA 4MAQA 1QCNA 1SAWA 1HYOA 3QDFA 2EB6A 2Q19X
chains in the Genus database with same CATH superfamily
4X9DA 3OA6A 1V76A 1M27C 3R6OA 1G3SA 1GFCA 1IGUA 1VUBA 3FC3A 2QA4T 1TUCA 1QVGP 5I2MA 1MGQA 1T3SA 3FJPA 5LJ5j 4JLIA 2QYZA 1YN8A 4BY6C 3CCSA 2K2MA 3PVQA 3V8JA 5FRNA 2YWWA 1BI1A 1I5OB 1YJWQ 1PC0A 4C8QD 3PVLA 2P0KA 1Y96A 4OB2B 1BB9A 5CKFA 4OP0A 1PKTA 1MNDA 1ZSZC 2KROA 2PUKB 1WQWA 1JXMA 1QLYA 3CMEA 3QSUA 1OZ2A 2CZ1B 4OMFB 4LD6A 2RQUA 1NEBA 4ATOA 4C92D 3CCEA 2B86A 5LJ3g 1KQ1A 3URGA 2OX7A 2Q18X 1W2BS 1B07A 1VQ9T 2DERA 1S72A 2LP5A 2CP6A 5HCKA 2RJFA 5KYXB 4GBQA 1SPKA 1TSFA 2DJZA 1M1KU 1TG0A 3CCJT 4M7AA 2P84A 1C0MA 1OYXA 2HBPA 2KDSA 1VQPT 4BACA 3QJYA 4EMKC 2JVVA 2ESWA 4D6WA 4E7LA 2W10A 5J39A 1VQ6T 4XQ3A 2MF2A 2F69A 3CD6Q 5GAN6 1HSQA 3CCRA 4M7DA 3V8LA 3I55Q 2K5IA 2DKGA 3RKWA 5KH6A 2O2OA 3CPWP 5IAYA 1I8FA 2ZPFB 3EGDA 4PJOD 3I9QA 1YIJQ 2XK0A 3H0IA 3CC7A 1VQ5A 3L2WA 4XTVA 3BW1A 4N4IA 4EMGA 1Y7XA 4KGVB 4AMCA 1WJRA 2KRNA 5GANf 1ACMB 1VQ4A 5D2IA 1VQ8A 3OBYA 1X6OA 5GAOn 2QTVA 3WVDB 1K76A 3NHNA 1PWTA 3JCMh 2L3QA 3DB3A 2YLCA 4JRIA 2DIQA 2XD0A 2RJEA 2H3JA 2V1RA 1MMGA 2K79A 2KY9A 3JB9I 3JCMe 3G4ST 1X6BA 2O9SA 1Q81R 2P0QA 2PVDB 2PQWA 3RBBB 2HD0A 2R5MA 5GMKe 4B6MA 3M58A 4KBMB 4DOVA 1Y57A 4MMKA 3PFSA 2OTJQ 1NYGA 2OI3A 4Z8AA 2Q1CX 1G83A 1VQKA 2HQHA 4FIBA 4JLGA 3M0RA 2PUOB 3I56A 4FL6A 2Z0WA 4QVDA 3A98A 3CMAT 4LDUA 7AT1B 2LMJA 4RKUE 3LW5E 2EYZA 4HA8A 2DZ9A 1CSKA 2DTIA 3EG1A 1ZQ1A 2BE9B 1PCXA 1UECA 1ZUUA 3UF4A 1KC8C 3HRUA 1AZGB 1CKBA 4A53A 2C0IA 2LJ0A 3EH2A 2DX1A 3M56A 5D7UA 1H3HA 2E41A 4KT0E 3VS6A 4C8QC 1K73C 2WSCE 1QKXA 1UGPB 3OMGA 3KBGA 2QDYB 5GMKm 2ED0A 4M77B 4R0KA 2QA4A 3VKIA 1G2BA 4C92C 5D2HA 2KT8A 2XHCA 1W70A 2GTJA 3M53A 1WNLA 2OTLQ 4FW1A 2WQTA 1YHQA 4OMLA 2PVGB 2X35A 3MP1A 2LQ8A 2QASA 1M90R 5KYYB 1EZZB 1WJSA 2DE0X 1O9SA 3QYGB 3CPFA 3QHSA 3EG2A 2DMOA 4A4KA 4TVRA 2F1LA 1Z9QA 1BU1A 1MV3A 1N9RA 1SAWA 1OX8A 2RI3A 4ESRA 4O5VA 4BE1A 2EQKA 1VQ9A 1FX7A 4E7ZA 1WHKA 5FWBA 2AHJB 2JOYA 3CCJA 3CC4T 4M78B 1OU9A 3JCMg 4N4GA 5KYXA 1VQPA 3QZ9B 1IHVA 4CC7A 2H3EB 2XI9A 4PJOC 1VA7A 4RTUA 1WXUA 3V77A 2CP5A 2YRVA 4F7UE 1VQ6A 3UA6A 3EG9B 3M54A 4C8QG 1QKWA 4N4HA 4LDVA 3SWNB 3OY9A 1ZBXA 1Q81U 1JJ2P 2M51A 4NL2A 2PU9B 2JTEA 3P8DA 1NJIU 3GBQA 4FSXA 2EAYA 1M3AA 2Y90A 2XDBA 2QDLA 4J9BA 3MKDA 2A0FB 4OB1B 1G3WA 1PHTA 3QG1A 4J83A 1T0HA 5D2FA 2EQJA 4XK8E 2JN0A 1NLOC 4C5IA 5FU6B 3TREA 3C0CA 2D9TA 4F7UF 2ZPBB 2HKNA 3JCMP 1YWOA 1N8RC 3A8MB 3X20B 1VQNQ 5IHIA 2ZPEB 2QQRA 2LT1A 4XU1A 3AT1B 1YP5A 3G4SA 5GAN7 4LDWA 4ELZC 1YIJT 1U3OA 2HQXA 3JB9F 1UGRB 3CCLQ 2ABLA 5CAIA 3VS4A 2FPEA 4PJOG 2QTXA 1ZBJA 5EC7A 2JTMA 4L5GA 4AT1B 3MPUB 5KE3A 4Z89A 4C8QE 3EGXB 2GGRA 4AFUC 5GANj 3VYGA 1JO8A 1KD1U 1PNJA 1MNEA 3CQTA 5FU7B 2K2VA 3CMAA 4C92E 1RAHB 5KYUA 1M90U 2OAWA 2K3YA 3MCAB 1JXOA 1YI2A 2F5TX 2DD5A 5GAOp 3OYKA 2VUBA 4LDXA 2DEUA 4OMPA 2E6ZA 1N5ZA 1DJ7B 1UHCA 5GAMf 1S1NA 1IREB 3ZFJA 3OMCA 1W1FA 4MMLA 2KYMA 2XDDA 2DBKA 3SWNC 1KQSS 2HKQB 4GLKA 1QVFS 3FLGA 1KC8R 1Y96B 1VIFA 2ZGWA 3KFVA 1K9MR 2O4XB 1YJNQ 1WX6A 2J05A 2LC4A 4KRTA 2RQVA 4PJJA 2EVRA 4J9GA 3H0HA 4L59A 2RJCA 4C92F 1K73R 3HRSA 1BK2A 4DBRA 1X27A 3U23A 3H8ZA 4PJOE 1XQHA 1OULA 5CKEA 3OYAA 2K5FA 1H3ZA 3RDVA 2ZAEA 2ENMA 5A0GA 2LCCA 2GFUA 2D0QB 1WDXA 2QGGA 5HY6A 2GNCA 5KYYA 3RNJA 2JMAA 1BYMA 1NZ9A 2L3RA 4FT2A 2X4YA 3UPUA 3CC2Q 4DBQA 3JCMX 2HDAA 5GAN4 5CVIA 2NUZA 3VS0A 2FG0A 2BZXA 2E70A 3CC4A 2OTLT 1HXDA 3OW2A 1FMWA 4ZNXA 2L2PA 2FL7A 2F2VA 4M78A 4J7FA 4YTLA 3CBPA 3EGDB 4JDSA 2YRDA 4B9WA 2MI6A 3A1PA 4M75D 3OW2S 3M0TA 5GJVB 4C0DB 1K1ZA 3AHUA 2L5QA 3UATA 2QI2A 5FU7C 3EG9A 4BDZA 1Q7YC 2RI2A 3HP9A 1UUEA 2K57A 3EHQA 2LDMA 1M2OA 3ME9A 2WACA 2RK1A 2A7YA 2DO3A 3QYHB 3A8GB 2CZ6B 1X2QA 4ZN3A 2QEXQ 1M1FA 3O8VA 1I07A 1I0CA 2MWPA 1AZEA 2JJ9A 4PJLA 3CCVQ 1NKQA 5DLQE 4GY5A 1K0SA 3OYLA 2VYTA 3CCMQ 2M0YA 2NLUA 1RLPC 2AT1B 2DL7A 4M77F 3DKMA 9ATCB 4OB0B 1NPRA 4RCBA 1EX4A 1LOJA 1JQQA 2VGNA 2ZZDA 3L2RA 3CBMA 1N8RR 2RB6A 2D8HA 3VS2A 3CCUQ 2M02A 5CK9A 4F16A 1K9MU 4M7AC 1RABB 1RUWA 2KMTA 3JB9D 2JZ2A 3OS0A 2F2WA 4E47A 2D6FA 4ZGDB 1JRIA 2CH4W 3UDCA 1VIEA 3NTHA 2LQKA 3SHWA 3EGXA 1SHGA 1EFNA 4LUDA 1TUDA 5GAOq 3VS1A 1F1BB 3OQ5A 2AK5A 4M7DC 2LRQA 2V26A 1AEYA 1PG5B 4XU2A 2ATCB 3HL8A 5GMKl 2LCLA 5CQXA 2Q1AX 3CCLT 4ZTJA 2DETA 3OS2A 4FW2A 4HCCA 2CKKA 1R77A 2LQNA 4HVUA 2O9VA 2VASA 3OSVA 2BE7D 4BE0A 5FW9A 5AT1B 4PFZA 5LJ5h 2KQWA 5GJWB 1YJ9Q 1KD1C 1JEGA 2EB6A 4JZ3A 1FMVA 5LJ5e 1AOJA 2O4XA 1TH7A 4E7SA 3S3MA 1W2BA 2OJ2A 1OQKA 1IXDA 2KXDA 2IPOB 2K7AA 5A2QE 1WPYA 1WLPB 1Q82C 4HVVA 2KK4A 5IH2A 2DBMA 3ULRB 2DRMA 5GAMj 4RTVA 2FRYA 2RQRA 5ECAA 2X4WA 3TVTA 3MP6A 2FEIA 2YUQA 3E2UA 5GAMh 3EAEA 1Y71A 1I7OA 4KUDK 4M75C 2MOXA 1YJNT 2DAQA 4IUVA 1D3BA 2K5LA 2EJ9A 4IIMA 4E7IA 4IUPA 1SSFA 1VQOT 3SFMA 2HNIA 3QZ5B 1KG1A 3RKYA 1OEBA 1HK9A 3NTKA 2JS0A 2ECZA 1T3LA 3BE3A 4NL3A 4EMHA 3C95A 1YCSB 2J6FA 5GAOl 2GTOA 5A0DA 3G1JA 3MEAA 1VYUA 2VV5A 1H92A 1GL5A 1WI7A 4AFQC 4OMQA 2FPFA 2CP0A 2YRCA 2BUDA 1V1CA 2MPXC 4O6JA 2ROTA 1YITT 2GBQA 2ZPIB 5I22A 1RAAB 5C6SA 3M5AA 1UHFA 5KYWA 2AKLA 2EBPA 1ZSGA 1KQSP 1QVFP 3TCJA 1H8KA 3VS3A 1Q86U 1OPKA 3MEWA 1W4SA 2DJQA 1FYNA 3A8OB 1ZSZA 1MMAA 4FM4B 1IB8A 4KGZB 3PNWC 2MIOA 4X1VA 2R58A 5GAN8 2JW4A 4OMMA 2HBWA 4M77D 4DEXA 1K8AR 3GPLA 3NTIA 3OB9A 2QG9B 3WVEB 5KYUB 2K9GA 1E6GA 3H0FA 1RI9A 4M7AF 1D0ZA 2BKDN 2KYBA 3CCVT 3MHXA 3INZA 2FB7A 3FIFA 4PFOA 4JRPA 3L42A 3OS5A 3VUBA 1E6HA 5CR2A 2WSEE 3CCMT 2QQ9A 1KHIA 1VQLT 3CCSQ 1PSEA 2KBTA 3DLMA 2XMFA 4M7DF 3PIPA 1GRIA 2CH4A 2VB6A 3C12A 5J26A 1LJOA 2VXEA 3THKA 4F7UG 3CMEQ 1WGSA 2DLPA 1B34A 2SRCA 3OW2P 2DVEA 4QQDA 1D1CA 3VYHB 4FYYB 3QBYA 3I5RA 3I5SA 4PFPA 3NGPA 4BI4A 1S72Q 1SV6A 2QQSA 2GFAA 2EYQA 3TSWA 1UG1A 4M75E 4JJNK 3JB9G 1TUGB 2YUPA 4HT8A 1QWFA 3DB4A 1GFDA 3NFCA 2MYSA 1NE8A 3RERA 1D1AA 3M55A 3VV0A 1X43A 5KCOA 4MDWA 3PGGA 2ZPGB 4QW2A 3NMZC 3PT9A 1XTDA 1IHWA 3CCRQ 2DILA 1U1SA 3JB9H 4PL6A 2ED1A 2NUPB 2X3XD 2MAMA 2Q19X 3TU4K 3BY7A 2RF0A 3OS1A 3J7AF 2A28A 1QQJA 5DM7R 4FCYA 2GF7A 4RG8A 5LJ3f 2CGHA 4M75F 3X28B 3CC7Q 1VQ5Q 1YJWT 4XAXB 1JU5C 3H6ZA 3S3OA 3LYIA 1YFNA 5CKHA 5D6XA 1O75A 2CS7A 1VQOA 3OSSC 1PRMC 1NM7A 5LJ5d 2R5AA 1VQ4Q 3G7ZA 2E5KA 2EYXA 4RMOA 3MO8A 1VQ8Q 3MP8A 1UB4A 1RI0A 4FU6A 2RQTA 1IZ6A 2EB4A 3C94A 5EG2A 4C92G 3P8HA 2HSEB 3OYMA 2A3LA 1LCKA 5GAOm 4R55A 2BZ8A 1K8AU 5KE2A 4JRQA 4J9FA 3JRZA 3JB9J 1QVGS 1B3QA 2EGAA 5CKDA 1M1KC 5I2SA 1T0JA 4ZGEB 2JM9A 2R57A 2KXCA 4KH1B 2FZGB 4IUTA 2JXBA 2NWMA 4C8QA 3CCQQ 1WHLA 3OYFA 5GAMd 3QUIA 1KFZA 3CD6T 1YITA 3JCMV 3I55T 2O01E 4ZN1A 4X9CA 3SEMA 4A54A 4HKEA 4E2FB 3I56Q 3EGUA 4M77C 3L2ZA 2RO0A 1GCQA 4BE2A 3QO3A 1M8MA 3L2QA 2IVWA 4LNPA 1V29B 2KVQG 3UA7A 2DZCA 4RTZA 2A36A 1QCOA 4QVCA 1WHHA 3HHTB 5D6WA 3LZKA 2K6DA 5C0MA 3JSCA 5IHKA 1N9SA 2LZ6B 3GF5A 4LXCA 4PLLA 3QDFA 1W2BP 1M1GA 1VYTA 2C06A 3HTRA 4RTWA 2HCKA 5GANh 1OOTA 5D2JA 2EFIA 2QA4Q 2C0TA 3CCVA 5GANe 4M7AD 4M78C 1SG5A 5GAOr 4PJOA 3CCMA 3M0PA 4ELYC 4WTOB 4JS4A 1VQLA 1NEGA 1YHQQ 2K3BA 4FYXB 1KQSA 3GP8A 1QVFA 3OYNA 2CDTA 2KRMA 1OPLA 2OTJT 2M9UA 1GXIE 1UJ0A 3E1SA 4C5GA 3HSBA 4M7DD 3PMIA 4M77G 4AG1C 2LJ1A 3E19A 2QQBA 2J6OA 3EFRA 2CZ0B 1VQ9Q 2DTOA 4IURA 3X25B 3X26B 1YWPA 5GMKi 2D0NA 2DK3A 2KEAA 4JJCA 3CCJQ 1HJDA 3M4YA 2XU8A 3HPWA 3QKJA 1PSFA 1VQPQ 1LNXA 1FMKA 1AT1B 1K9AA 1J3TA 1N27A 2EYWA 1UTIA 2RHYA 3REAB 1WFWA 2DFUA 3HFNA 2FPDA 2XG8D 5FU6C 1R0BG 1C1AA 1M9SA 4IIOA 4XTYA 3M59A 2CREA 2JNGA 1D3BB 1IGQA 4JUVA 3ZEHA 1YNZA 3LWIA 1ZX6A 4L6V5 4C5EA 2A37A 2Y4YA 3BQBA 2NUPA 2D8JA 1OV3A 1RLQC 1K0XA 1UEBA 1BKBA 2L8DA 4DQ2A 1QW1A 4C0GA 1YJWA 4HT9A 3H41A 1RACB 5CKBA 5HK0A 3PIOA 2DD4A 2M1HA 2DA9A 2RK2A 2EIFA 3IQLA 1NPPA 2GQIA 2HL3A 2B8AA 3JCMf 1X75C 2QK0A 1RADB 3QWYA 2J06A 4Y28E 3G6EQ 5KYNA 4M77E 1WIEA 2QGFB 4HXJA 1VQMQ 1M8VA 1AWWA 1BI2A 5IXBA 4Q5WA 3VJPA 8ATCB 5KYWB 1NYFA 2NUTA 5L8RE 1SF9A 3ZL7C 4M4ZA 4BY6B 3A8HB 1VQ5T 5LJ3j 1FWZA 2RH2A 2E64A 3V7RA 2E65A 1GTTA 3RKXA 4LD9K 4FSSA 3H9NA 3E9GA 1PKSA 2DVJA 1M5Q1 1ZSZB 3EFOB 3CD6A 3EHRA 3QJ6A 3I55A 2M16A 2FZKB 5DY9A 2RN8A 1OI1A 4CI0C 4ZGJB 1Q81C 1OU8A 2RNAA 3FB9A 3X24B 5IN1A 1N6AA 3TQ7P 2KSSA 5HKCA 1NJIC 1RAEB 1YI2Q 2YXYA 1YIJA 1KC8U 4PJMA 1IRXA 2XICA 3I35A 3QXEB 2AIRB 3V8KA 2MWOA 4MZMA 4E7HA 2YDLA 4EMKB 3CCQT 3VUZA 1W6XA 2NYSA 1K73U 1QVPA 1BI3A 2PVOB 2G6FX 2JMCA 1ZA1B 4IUUA 3OYGA 4JPBW 4BUGA 1VQNT 2M0OA 4DOWA 4N0AA 1B34B 3S3NA 4M78F 2CP7A 1TS9A 3JCMb 2YHTA 4QT7A 4RTXA 1UGVA 4K11A 1QP2A 1UJYA 2COZA 2F2XA 3MJXA 4CRIA 2QXFA 4RCCA 3CEYA 4A63B 3LGFA 1KSWA 1TOVA 3JV3A 4FT4A 4C0DC 2OTJA 2EJGA 2LVMA 3FEOA 2JS2A 4HCKA 5FWCA 4HCBA 4QVZA 3REBB 2LX9A 4MDXA 1QCNA 3V7SA 4ZTFA 1ZA2B 4F7UB 1GBQA 1G5VA 2L3PA 3O5ZA 2DF6A 3OYJA 2P4RA 3VS5A 4RUGA 2RI5A 2DTHA 4RTTA 3SD4A 5GANd 2Q1DX 1M90C 5HK3A 3CC4Q 1M2VB 2BZYA 1YHQT 1RL2A 4M7AG 2COWA 3KUFA 1D0XA 2L0AA 2X4XA 1FXXA 4QQ6A 3EFSA 2X51A 2COYA 3DLLA 1NG2A 4F17A 1CKAA 2HZYA 2JUFA 2X3WD 5GAMe 1KK7A 3JCMJ 4XTWA 4M7DG 2CSIA 4AFSC 1G8XA 4KGXB 2YUOA 3L2VA 3N5BB 2OTLA 4BI8B 2LX7A 2HQEA 2RA2A 1AHJB 1QP3A 1TWBA 2V8JA 3G71Q 1ZUKA 4RG2A 2V8IA 3CXCA 3OYYA 1N8RU 4Z88A 2LJ3A 2DXUA 2YLBA 4C8QB 1MUZA 2CYZB 3CXCS 5GAN5 2FRWA 3CC2T 4DEYA 2E3IA 1OX9A 4LN2A 2K4YA 3VRYA 1JB0E 1SSHA 1Q7YR 1E7OA 1VQ7Q 4A4HA 3QDRB 2KNBB 4C92B 1TTHB 2F5KA 2ZPHB 3S52A 4M7AE 3BFMA 4KUIA 3A8LB 1YBYA 1U1TA 1TXQA 1X69A 4PLIA 1ZLMA 3VS7A 4VUBA 4A4GA 4AFZC 3G6ET 3FDRA 5A0LA 1ABOA 2DXCA 2DM1A 4M75G 1PD0A 4M7DE 3EFOA 1VYVA 2EJFA 1VQMT 4IUQA 1UGQB 5GMKj 5FRMA 1AWOA 4D8KA 2KGTA 1U8RA 4IKFA 4J6XA 5GMKh 5LJ5g 4R56A 3JCMQ 2QEXT 2DNUA 2EW3A 1ARKA 4MZTA 2E1HA 2BIVA 2YSQA 3T9NA 3GNFB 4JRKA 5GAN3 4BD3A 3CCQA 1NJIR 3RUXA 4PJOB 3HRTA 2EGEA 3S6WA 1WZOA 1KIKA 4M75A 3L1AA 4V2SA 3LWHA 4C0ZA 4E6RA 4EMKA 1M4ZA 2LTOA 2HEQA 2QAZA 5CCAA 4DA4A 3M9QA 1AWJA 2E6NA 2RM4A 3R6NA 4WCIA 1VQNA 4JJBA 5LJ3d 4D8DA 4ANJA 1KHCA 2K3XA 2RHXA 3JCMc 1R8OB 2EPDA 1XNIA 2EYYA 2D1XA 5GAMg 8AT1B 1YI2T 1BCOA 1AWXA 4M78D 3CCLA 4J9HA 3CCUT 3CCEQ 2ROLA 1ABQA 1G3TA 4RTYA 2A08A 3UWNA 3PE0A 1KJWA 4FYWB 2LQWA 4QQGA 4WF2A 1NLPC 4QKUA 1K9MC 1VOMA 3E9FA 3LH5A 1IO6A 1BI0A 4J9DA 3M57A 5LL6S 3LX7A 4HCZA 4F04B 4F7UA 1KQ2A 1M3CA 4PNOA 4Z02A 2HL5C 2EQUA 3EG0A 3P8BB 1GCQC 2X4JA 1Y07A 2RHIA 1KD1R 4J7IA 4OGCA 4C0FA 2AZVA 5GAN2 3UT1A 1M2VA 4AG2C 2KR3A 3BDLA 5FLXE 4XU3A 1I4K1 1BBZA 1Q7YU 4J6WA 4JZ4A 2MMPA 3M0QA 1SKUB 1Q82R 1LVKA 2DYIA 3M4GA 4ORZA 2VVKA 1YJNA 2DL3A 2RJDA 1YJ9T 3LH0A 4BDYA 3RIRA 2RD1A 3OBWA 4OB3B 2CSQA 4II1A 3PTAA 1WXBA 2P4TA 4A4EA 2C0OA 2CUBA 2SEMA 1QVGA 2NUTB 2E5QA 5AYFA 2AZSA 4OVAA 4XTUA 2DL4A 2CT3A 4KULA 4CC4B 3SDZA 1M3BA 4NS5A 4OMOA 2HAXA 2E4HA 3CC2A 5CIUA 2L89A 2YUNA 1VQKQ 3J80E 3META 3SB2A 1P92A 3OYIA 1EIFA 1PM3A 4C92A 1UE9A 1WJQA 4XU0A 3Q1JA 1QMCA 1HD3A 3LGLA 2VXFA 3G71T 2QQAA 2KI7A 2RHUA 3GIBA 2RPNA 4P5NA 3JAME 3G6EA 1NBEB 1YCYA 2JTFA 2E3HA 5L23A 1XJWB 2DXBA 4J8OA 4LDYA 2L3SA 3V7CA 4CC2A 4DBFA 3GNGA 1VQMA 2VGMA 3L2UA 2E10A 1SRLA 3FJ5A 1VQ7T 2O88A 2CZ7B 2QEXA 4C5HA 2XKOC 3FRNA 2KRSA 3TEEA 3EH1A 2FVUA 1ZHIA 4JS5A 1M30A 3CPWA 2AKKA 3ER0A 2KE9A 1AD5A 2PZ1A 5LJ5f 2VKNA 4A4FA 5IXFA 3ZBDA 3CPWS 1Q86C 3C4SA 1BIAA 1QCFA 1BIBA 1RAIB 2FO0A 3JCMW 2PNIA 1A0NB 5D2GA 2X9HA 1U5SA 1D1BA 4F14A 2IIMA 4Y92A 2DPPB 1QWEA 3JCMd 1WA7A 1Q82U 3CCUA 2EWNA 5DLOA 4PKCC 2CP3A 4OF1A 4EIKA 1WHGA 1SRMA 2J7IA 1MMNA 1UFFA 2EB5A 3QPHA 3CXCP 4PK4A 2LNVA 1Z9ZA 2I2LA 4X34A 4C8QF 2EQIA 3CCST 2JM8A 3WXMB 1D0YA 2KAFA 3EG3A 3MEVA 4LE9A 1G3YA 3RMQA 2MCNA 4HVWA 1VQ6Q 1HYOA 4EDUA 3CMET 1VQOQ 1SHFA 4M77A 2GCXA 2I0NA 2DL8A 2CP2A 1Q95G 3CCET 2HSPA 2CT4A 1ZUYA 4J9IA 1PRLC 3J81E 4M7AB 1S72T 4M78G 2VWFA 2IG0A 2RHZA 2KT1A 6AT1B 5CO7A 2V1QA 5KCHA 3VU3C 1X01A 1B7TA 2EKHA 2GQVA 4XTXA 2H8HA 3MEUA 1YJ9A 5FROA 2FYKA 1BCMA 1WYXA 5D2KA 1MMDA 3HFOA 3RMSA 2EGCA 4Y91A 4M7DB 3M0SA 4J9CA 3LLRA 2DEQA 1YITQ 3CCRT 4E7KA 4N0AC 4DBHA 3OYBA 2BTTA 4ME7A 4BB7A 3OYCA 4PJOF 3A5ZB 5I21A 5I11A 4XTZA 4CC3A 2V8KA 2XDPA 1MV0B 3G4SQ 3RESA 2WSFE 2P0PA 1SEMA 2RQWA 3F70A 5GANg 1I5LA 3GLXA 4NOYA 2CUDA 3TSZA 1RAGB 3CC7T 2DYBA 4BI3A 2W0ZA 3SWNA 2E12A 4MZPA 4E7JA 1OZ3A 5M9OA 1NR9A 4B9XA 3OYDA 4J5YA 1AVZC 4J6YA 5LJ3h 1WHJA 3HKSA 1M1KR 3RR6A 1VQ4T 1RAFB 4KH0B 3GOXA 2ZCFB 1VQ8T 1JBMA 1WQ7A 5LJ3e 3D7SB 3BDUA 2DRKA 2LT4A 3NPFA 4PJNA 3CMAQ 4M78E 2DL5A 4J9EA 3G71A 2VC8A 2RMOA 4JJDA 3QIIA 2JT4A 1WHMA 4FYVB 5IT9E 2EQMA 4OMNA 1VQLQ 1K8AC 2FHDA 3OYHA 1C6VX 4M75B 4EPCA 3CBOA 1I1JA 4OGEA 2O31A 5IHNA 1H641 1X6GA 1UDLA 1TU0B 5CQYA 1VQ7A 1VQKT 1D09B 1LPLA 3QWXX 2XIDA 3M0UA 1JJ2A 3I56T 5J3BA 1PD1A 2G3RA 1I81A 5D6YA 2MK5A 1MHNA 3KXTA 1JJ2S 2J6KA 2DXTA 4MAQA 1R0CB 1K4US 1XOVA 1X2KA 1WXTA 4LUEA 2HMAA 2DIGA 2LNHB 4UC4A 2YT6A 1GBRA 3VRZA 2LCSA 3OYEA 2OAUA 2PTKA 1Y0MA 1Q86R 1UGSB 2FZCB 1GCPA 3PMTA 3ASKA 4GLMA 2EKOA 2Y4XA 1U06A
chains in the Genus database with same CATH topology
2Q1AX 5D2IA 3R6OA 5D2GA 2EB5A 5D2KA 2WQTA 5D2FA 1QQJA 1I7OA 2HZYA 1QCOA 5D2JA 1WZOA 3S52A 2Q1DX 1GTTA 3BQBA 2Q1CX 3LZKA 2EB4A 1NKQA 4DBHA 4DBFA 1NR9A 2Q18X 2DFUA 1SV6A 5D2HA 3V77A 4QKUA 3RR6A 4PFZA 4MAQA 1QCNA 1SAWA 1HYOA 3QDFA 2EB6A 2Q19X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1A X;  5D2I A;  3R6O A;  5D2G A;  2EB5 A;  5D2K A;  2WQT A;  5D2F A;  1QQJ A;  1I7O A;  2HZY A;  1QCO A;  5D2J A;  1WZO A;  3S52 A;  2Q1D X;  1GTT A;  3BQB A;  2Q1C X;  3LZK A;  2EB4 A;  1NKQ A;  4DBH A;  4DBF A;  1NR9 A;  2Q18 X;  2DFU A;  1SV6 A;  5D2H A;  3V77 A;  4QKU A;  3RR6 A;  4PFZ A;  4MAQ A;  1QCN A;  1SAW A;  1HYO A;  3QDF A;  2EB6 A;  2Q19 X; 
#chains in the Genus database with same CATH topology
 4X9D A;  3OA6 A;  1V76 A;  1M27 C;  3R6O A;  1G3S A;  1GFC A;  1IGU A;  1VUB A;  3FC3 A;  2QA4 T;  1TUC A;  1QVG P;  5I2M A;  1MGQ A;  1T3S A;  3FJP A;  5LJ5 j;  4JLI A;  2QYZ A;  1YN8 A;  4BY6 C;  3CCS A;  2K2M A;  3PVQ A;  3V8J A;  5FRN A;  2YWW A;  1BI1 A;  1I5O B;  1YJW Q;  1PC0 A;  4C8Q D;  3PVL A;  2P0K A;  1Y96 A;  4OB2 B;  1BB9 A;  5CKF A;  4OP0 A;  1PKT A;  1MND A;  1ZSZ C;  2KRO A;  2PUK B;  1WQW A;  1JXM A;  1QLY A;  3CME A;  3QSU A;  1OZ2 A;  2CZ1 B;  4OMF B;  4LD6 A;  2RQU A;  1NEB A;  4ATO A;  4C92 D;  3CCE A;  2B86 A;  5LJ3 g;  1KQ1 A;  3URG A;  2OX7 A;  2Q18 X;  1W2B S;  1B07 A;  1VQ9 T;  2DER A;  1S72 A;  2LP5 A;  2CP6 A;  5HCK A;  2RJF A;  5KYX B;  4GBQ A;  1SPK A;  1TSF A;  2DJZ A;  1M1K U;  1TG0 A;  3CCJ T;  4M7A A;  2P84 A;  1C0M A;  1OYX A;  2HBP A;  2KDS A;  1VQP T;  4BAC A;  3QJY A;  4EMK C;  2JVV A;  2ESW A;  4D6W A;  4E7L A;  2W10 A;  5J39 A;  1VQ6 T;  4XQ3 A;  2MF2 A;  2F69 A;  3CD6 Q;  5GAN 6;  1HSQ A;  3CCR A;  4M7D A;  3V8L A;  3I55 Q;  2K5I A;  2DKG A;  3RKW A;  5KH6 A;  2O2O A;  3CPW P;  5IAY A;  1I8F A;  2ZPF B;  3EGD A;  4PJO D;  3I9Q A;  1YIJ Q;  2XK0 A;  3H0I A;  3CC7 A;  1VQ5 A;  3L2W A;  4XTV A;  3BW1 A;  4N4I A;  4EMG A;  1Y7X A;  4KGV B;  4AMC A;  1WJR A;  2KRN A;  5GAN f;  1ACM B;  1VQ4 A;  5D2I A;  1VQ8 A;  3OBY A;  1X6O A;  5GAO n;  2QTV A;  3WVD B;  1K76 A;  3NHN A;  1PWT A;  3JCM h;  2L3Q A;  3DB3 A;  2YLC A;  4JRI A;  2DIQ A;  2XD0 A;  2RJE A;  2H3J A;  2V1R A;  1MMG A;  2K79 A;  2KY9 A;  3JB9 I;  3JCM e;  3G4S T;  1X6B A;  2O9S A;  1Q81 R;  2P0Q A;  2PVD B;  2PQW A;  3RBB B;  2HD0 A;  2R5M A;  5GMK e;  4B6M A;  3M58 A;  4KBM B;  4DOV A;  1Y57 A;  4MMK A;  3PFS A;  2OTJ Q;  1NYG A;  2OI3 A;  4Z8A A;  2Q1C X;  1G83 A;  1VQK A;  2HQH A;  4FIB A;  4JLG A;  3M0R A;  2PUO B;  3I56 A;  4FL6 A;  2Z0W A;  4QVD A;  3A98 A;  3CMA T;  4LDU A;  7AT1 B;  2LMJ A;  4RKU E;  3LW5 E;  2EYZ A;  4HA8 A;  2DZ9 A;  1CSK A;  2DTI A;  3EG1 A;  1ZQ1 A;  2BE9 B;  1PCX A;  1UEC A;  1ZUU A;  3UF4 A;  1KC8 C;  3HRU A;  1AZG B;  1CKB A;  4A53 A;  2C0I A;  2LJ0 A;  3EH2 A;  2DX1 A;  3M56 A;  5D7U A;  1H3H A;  2E41 A;  4KT0 E;  3VS6 A;  4C8Q C;  1K73 C;  2WSC E;  1QKX A;  1UGP B;  3OMG A;  3KBG A;  2QDY B;  5GMK m;  2ED0 A;  4M77 B;  4R0K A;  2QA4 A;  3VKI A;  1G2B A;  4C92 C;  5D2H A;  2KT8 A;  2XHC A;  1W70 A;  2GTJ A;  3M53 A;  1WNL A;  2OTL Q;  4FW1 A;  2WQT A;  1YHQ A;  4OML A;  2PVG B;  2X35 A;  3MP1 A;  2LQ8 A;  2QAS A;  1M90 R;  5KYY B;  1EZZ B;  1WJS A;  2DE0 X;  1O9S A;  3QYG B;  3CPF A;  3QHS A;  3EG2 A;  2DMO A;  4A4K A;  4TVR A;  2F1L A;  1Z9Q A;  1BU1 A;  1MV3 A;  1N9R A;  1SAW A;  1OX8 A;  2RI3 A;  4ESR A;  4O5V A;  4BE1 A;  2EQK A;  1VQ9 A;  1FX7 A;  4E7Z A;  1WHK A;  5FWB A;  2AHJ B;  2JOY A;  3CCJ A;  3CC4 T;  4M78 B;  1OU9 A;  3JCM g;  4N4G A;  5KYX A;  1VQP A;  3QZ9 B;  1IHV A;  4CC7 A;  2H3E B;  2XI9 A;  4PJO C;  1VA7 A;  4RTU A;  1WXU A;  3V77 A;  2CP5 A;  2YRV A;  4F7U E;  1VQ6 A;  3UA6 A;  3EG9 B;  3M54 A;  4C8Q G;  1QKW A;  4N4H A;  4LDV A;  3SWN B;  3OY9 A;  1ZBX A;  1Q81 U;  1JJ2 P;  2M51 A;  4NL2 A;  2PU9 B;  2JTE A;  3P8D A;  1NJI U;  3GBQ A;  4FSX A;  2EAY A;  1M3A A;  2Y90 A;  2XDB A;  2QDL A;  4J9B A;  3MKD A;  2A0F B;  4OB1 B;  1G3W A;  1PHT A;  3QG1 A;  4J83 A;  1T0H A;  5D2F A;  2EQJ A;  4XK8 E;  2JN0 A;  1NLO C;  4C5I A;  5FU6 B;  3TRE A;  3C0C A;  2D9T A;  4F7U F;  2ZPB B;  2HKN A;  3JCM P;  1YWO A;  1N8R C;  3A8M B;  3X20 B;  1VQN Q;  5IHI A;  2ZPE B;  2QQR A;  2LT1 A;  4XU1 A;  3AT1 B;  1YP5 A;  3G4S A;  5GAN 7;  4LDW A;  4ELZ C;  1YIJ T;  1U3O A;  2HQX A;  3JB9 F;  1UGR B;  3CCL Q;  2ABL A;  5CAI A;  3VS4 A;  2FPE A;  4PJO G;  2QTX A;  1ZBJ A;  5EC7 A;  2JTM A;  4L5G A;  4AT1 B;  3MPU B;  5KE3 A;  4Z89 A;  4C8Q E;  3EGX B;  2GGR A;  4AFU C;  5GAN j;  3VYG A;  1JO8 A;  1KD1 U;  1PNJ A;  1MNE A;  3CQT A;  5FU7 B;  2K2V A;  3CMA A;  4C92 E;  1RAH B;  5KYU A;  1M90 U;  2OAW A;  2K3Y A;  3MCA B;  1JXO A;  1YI2 A;  2F5T X;  2DD5 A;  5GAO p;  3OYK A;  2VUB A;  4LDX A;  2DEU A;  4OMP A;  2E6Z A;  1N5Z A;  1DJ7 B;  1UHC A;  5GAM f;  1S1N A;  1IRE B;  3ZFJ A;  3OMC A;  1W1F A;  4MML A;  2KYM A;  2XDD A;  2DBK A;  3SWN C;  1KQS S;  2HKQ B;  4GLK A;  1QVF S;  3FLG A;  1KC8 R;  1Y96 B;  1VIF A;  2ZGW A;  3KFV A;  1K9M R;  2O4X B;  1YJN Q;  1WX6 A;  2J05 A;  2LC4 A;  4KRT A;  2RQV A;  4PJJ A;  2EVR A;  4J9G A;  3H0H A;  4L59 A;  2RJC A;  4C92 F;  1K73 R;  3HRS A;  1BK2 A;  4DBR A;  1X27 A;  3U23 A;  3H8Z A;  4PJO E;  1XQH A;  1OUL A;  5CKE A;  3OYA A;  2K5F A;  1H3Z A;  3RDV A;  2ZAE A;  2ENM A;  5A0G A;  2LCC A;  2GFU A;  2D0Q B;  1WDX A;  2QGG A;  5HY6 A;  2GNC A;  5KYY A;  3RNJ A;  2JMA A;  1BYM A;  1NZ9 A;  2L3R A;  4FT2 A;  2X4Y A;  3UPU A;  3CC2 Q;  4DBQ A;  3JCM X;  2HDA A;  5GAN 4;  5CVI A;  2NUZ A;  3VS0 A;  2FG0 A;  2BZX A;  2E70 A;  3CC4 A;  2OTL T;  1HXD A;  3OW2 A;  1FMW A;  4ZNX A;  2L2P A;  2FL7 A;  2F2V A;  4M78 A;  4J7F A;  4YTL A;  3CBP A;  3EGD B;  4JDS A;  2YRD A;  4B9W A;  2MI6 A;  3A1P A;  4M75 D;  3OW2 S;  3M0T A;  5GJV B;  4C0D B;  1K1Z A;  3AHU A;  2L5Q A;  3UAT A;  2QI2 A;  5FU7 C;  3EG9 A;  4BDZ A;  1Q7Y C;  2RI2 A;  3HP9 A;  1UUE A;  2K57 A;  3EHQ A;  2LDM A;  1M2O A;  3ME9 A;  2WAC A;  2RK1 A;  2A7Y A;  2DO3 A;  3QYH B;  3A8G B;  2CZ6 B;  1X2Q A;  4ZN3 A;  2QEX Q;  1M1F A;  3O8V A;  1I07 A;  1I0C A;  2MWP A;  1AZE A;  2JJ9 A;  4PJL A;  3CCV Q;  1NKQ A;  5DLQ E;  4GY5 A;  1K0S A;  3OYL A;  2VYT A;  3CCM Q;  2M0Y A;  2NLU A;  1RLP C;  2AT1 B;  2DL7 A;  4M77 F;  3DKM A;  9ATC B;  4OB0 B;  1NPR A;  4RCB A;  1EX4 A;  1LOJ A;  1JQQ A;  2VGN A;  2ZZD A;  3L2R A;  3CBM A;  1N8R R;  2RB6 A;  2D8H A;  3VS2 A;  3CCU Q;  2M02 A;  5CK9 A;  4F16 A;  1K9M U;  4M7A C;  1RAB B;  1RUW A;  2KMT A;  3JB9 D;  2JZ2 A;  3OS0 A;  2F2W A;  4E47 A;  2D6F A;  4ZGD B;  1JRI A;  2CH4 W;  3UDC A;  1VIE A;  3NTH A;  2LQK A;  3SHW A;  3EGX A;  1SHG A;  1EFN A;  4LUD A;  1TUD A;  5GAO q;  3VS1 A;  1F1B B;  3OQ5 A;  2AK5 A;  4M7D C;  2LRQ A;  2V26 A;  1AEY A;  1PG5 B;  4XU2 A;  2ATC B;  3HL8 A;  5GMK l;  2LCL A;  5CQX A;  2Q1A X;  3CCL T;  4ZTJ A;  2DET A;  3OS2 A;  4FW2 A;  4HCC A;  2CKK A;  1R77 A;  2LQN A;  4HVU A;  2O9V A;  2VAS A;  3OSV A;  2BE7 D;  4BE0 A;  5FW9 A;  5AT1 B;  4PFZ A;  5LJ5 h;  2KQW A;  5GJW B;  1YJ9 Q;  1KD1 C;  1JEG A;  2EB6 A;  4JZ3 A;  1FMV A;  5LJ5 e;  1AOJ A;  2O4X A;  1TH7 A;  4E7S A;  3S3M A;  1W2B A;  2OJ2 A;  1OQK A;  1IXD A;  2KXD A;  2IPO B;  2K7A A;  5A2Q E;  1WPY A;  1WLP B;  1Q82 C;  4HVV A;  2KK4 A;  5IH2 A;  2DBM A;  3ULR B;  2DRM A;  5GAM j;  4RTV A;  2FRY A;  2RQR A;  5ECA A;  2X4W A;  3TVT A;  3MP6 A;  2FEI A;  2YUQ A;  3E2U A;  5GAM h;  3EAE A;  1Y71 A;  1I7O A;  4KUD K;  4M75 C;  2MOX A;  1YJN T;  2DAQ A;  4IUV A;  1D3B A;  2K5L A;  2EJ9 A;  4IIM A;  4E7I A;  4IUP A;  1SSF A;  1VQO T;  3SFM A;  2HNI A;  3QZ5 B;  1KG1 A;  3RKY A;  1OEB A;  1HK9 A;  3NTK A;  2JS0 A;  2ECZ A;  1T3L A;  3BE3 A;  4NL3 A;  4EMH A;  3C95 A;  1YCS B;  2J6F A;  5GAO l;  2GTO A;  5A0D A;  3G1J A;  3MEA A;  1VYU A;  2VV5 A;  1H92 A;  1GL5 A;  1WI7 A;  4AFQ C;  4OMQ A;  2FPF A;  2CP0 A;  2YRC A;  2BUD A;  1V1C A;  2MPX C;  4O6J A;  2ROT A;  1YIT T;  2GBQ A;  2ZPI B;  5I22 A;  1RAA B;  5C6S A;  3M5A A;  1UHF A;  5KYW A;  2AKL A;  2EBP A;  1ZSG A;  1KQS P;  1QVF P;  3TCJ A;  1H8K A;  3VS3 A;  1Q86 U;  1OPK A;  3MEW A;  1W4S A;  2DJQ A;  1FYN A;  3A8O B;  1ZSZ A;  1MMA A;  4FM4 B;  1IB8 A;  4KGZ B;  3PNW C;  2MIO A;  4X1V A;  2R58 A;  5GAN 8;  2JW4 A;  4OMM A;  2HBW A;  4M77 D;  4DEX A;  1K8A R;  3GPL A;  3NTI A;  3OB9 A;  2QG9 B;  3WVE B;  5KYU B;  2K9G A;  1E6G A;  3H0F A;  1RI9 A;  4M7A F;  1D0Z A;  2BKD N;  2KYB A;  3CCV T;  3MHX A;  3INZ A;  2FB7 A;  3FIF A;  4PFO A;  4JRP A;  3L42 A;  3OS5 A;  3VUB A;  1E6H A;  5CR2 A;  2WSE E;  3CCM T;  2QQ9 A;  1KHI A;  1VQL T;  3CCS Q;  1PSE A;  2KBT A;  3DLM A;  2XMF A;  4M7D F;  3PIP A;  1GRI A;  2CH4 A;  2VB6 A;  3C12 A;  5J26 A;  1LJO A;  2VXE A;  3THK A;  4F7U G;  3CME Q;  1WGS A;  2DLP A;  1B34 A;  2SRC A;  3OW2 P;  2DVE A;  4QQD A;  1D1C A;  3VYH B;  4FYY B;  3QBY A;  3I5R A;  3I5S A;  4PFP A;  3NGP A;  4BI4 A;  1S72 Q;  1SV6 A;  2QQS A;  2GFA A;  2EYQ A;  3TSW A;  1UG1 A;  4M75 E;  4JJN K;  3JB9 G;  1TUG B;  2YUP A;  4HT8 A;  1QWF A;  3DB4 A;  1GFD A;  3NFC A;  2MYS A;  1NE8 A;  3RER A;  1D1A A;  3M55 A;  3VV0 A;  1X43 A;  5KCO A;  4MDW A;  3PGG A;  2ZPG B;  4QW2 A;  3NMZ C;  3PT9 A;  1XTD A;  1IHW A;  3CCR Q;  2DIL A;  1U1S A;  3JB9 H;  4PL6 A;  2ED1 A;  2NUP B;  2X3X D;  2MAM A;  2Q19 X;  3TU4 K;  3BY7 A;  2RF0 A;  3OS1 A;  3J7A F;  2A28 A;  1QQJ A;  5DM7 R;  4FCY A;  2GF7 A;  4RG8 A;  5LJ3 f;  2CGH A;  4M75 F;  3X28 B;  3CC7 Q;  1VQ5 Q;  1YJW T;  4XAX B;  1JU5 C;  3H6Z A;  3S3O A;  3LYI A;  1YFN A;  5CKH A;  5D6X A;  1O75 A;  2CS7 A;  1VQO A;  3OSS C;  1PRM C;  1NM7 A;  5LJ5 d;  2R5A A;  1VQ4 Q;  3G7Z A;  2E5K A;  2EYX A;  4RMO A;  3MO8 A;  1VQ8 Q;  3MP8 A;  1UB4 A;  1RI0 A;  4FU6 A;  2RQT A;  1IZ6 A;  2EB4 A;  3C94 A;  5EG2 A;  4C92 G;  3P8H A;  2HSE B;  3OYM A;  2A3L A;  1LCK A;  5GAO m;  4R55 A;  2BZ8 A;  1K8A U;  5KE2 A;  4JRQ A;  4J9F A;  3JRZ A;  3JB9 J;  1QVG S;  1B3Q A;  2EGA A;  5CKD A;  1M1K C;  5I2S A;  1T0J A;  4ZGE B;  2JM9 A;  2R57 A;  2KXC A;  4KH1 B;  2FZG B;  4IUT A;  2JXB A;  2NWM A;  4C8Q A;  3CCQ Q;  1WHL A;  3OYF A;  5GAM d;  3QUI A;  1KFZ A;  3CD6 T;  1YIT A;  3JCM V;  3I55 T;  2O01 E;  4ZN1 A;  4X9C A;  3SEM A;  4A54 A;  4HKE A;  4E2F B;  3I56 Q;  3EGU A;  4M77 C;  3L2Z A;  2RO0 A;  1GCQ A;  4BE2 A;  3QO3 A;  1M8M A;  3L2Q A;  2IVW A;  4LNP A;  1V29 B;  2KVQ G;  3UA7 A;  2DZC A;  4RTZ A;  2A36 A;  1QCO A;  4QVC A;  1WHH A;  3HHT B;  5D6W A;  3LZK A;  2K6D A;  5C0M A;  3JSC A;  5IHK A;  1N9S A;  2LZ6 B;  3GF5 A;  4LXC A;  4PLL A;  3QDF A;  1W2B P;  1M1G A;  1VYT A;  2C06 A;  3HTR A;  4RTW A;  2HCK A;  5GAN h;  1OOT A;  5D2J A;  2EFI A;  2QA4 Q;  2C0T A;  3CCV A;  5GAN e;  4M7A D;  4M78 C;  1SG5 A;  5GAO r;  4PJO A;  3CCM A;  3M0P A;  4ELY C;  4WTO B;  4JS4 A;  1VQL A;  1NEG A;  1YHQ Q;  2K3B A;  4FYX B;  1KQS A;  3GP8 A;  1QVF A;  3OYN A;  2CDT A;  2KRM A;  1OPL A;  2OTJ T;  2M9U A;  1GXI E;  1UJ0 A;  3E1S A;  4C5G A;  3HSB A;  4M7D D;  3PMI A;  4M77 G;  4AG1 C;  2LJ1 A;  3E19 A;  2QQB A;  2J6O A;  3EFR A;  2CZ0 B;  1VQ9 Q;  2DTO A;  4IUR A;  3X25 B;  3X26 B;  1YWP A;  5GMK i;  2D0N A;  2DK3 A;  2KEA A;  4JJC A;  3CCJ Q;  1HJD A;  3M4Y A;  2XU8 A;  3HPW A;  3QKJ A;  1PSF A;  1VQP Q;  1LNX A;  1FMK A;  1AT1 B;  1K9A A;  1J3T A;  1N27 A;  2EYW A;  1UTI A;  2RHY A;  3REA B;  1WFW A;  2DFU A;  3HFN A;  2FPD A;  2XG8 D;  5FU6 C;  1R0B G;  1C1A A;  1M9S A;  4IIO A;  4XTY A;  3M59 A;  2CRE A;  2JNG A;  1D3B B;  1IGQ A;  4JUV A;  3ZEH A;  1YNZ A;  3LWI A;  1ZX6 A;  4L6V 5;  4C5E A;  2A37 A;  2Y4Y A;  3BQB A;  2NUP A;  2D8J A;  1OV3 A;  1RLQ C;  1K0X A;  1UEB A;  1BKB A;  2L8D A;  4DQ2 A;  1QW1 A;  4C0G A;  1YJW A;  4HT9 A;  3H41 A;  1RAC B;  5CKB A;  5HK0 A;  3PIO A;  2DD4 A;  2M1H A;  2DA9 A;  2RK2 A;  2EIF A;  3IQL A;  1NPP A;  2GQI A;  2HL3 A;  2B8A A;  3JCM f;  1X75 C;  2QK0 A;  1RAD B;  3QWY A;  2J06 A;  4Y28 E;  3G6E Q;  5KYN A;  4M77 E;  1WIE A;  2QGF B;  4HXJ A;  1VQM Q;  1M8V A;  1AWW A;  1BI2 A;  5IXB A;  4Q5W A;  3VJP A;  8ATC B;  5KYW B;  1NYF A;  2NUT A;  5L8R E;  1SF9 A;  3ZL7 C;  4M4Z A;  4BY6 B;  3A8H B;  1VQ5 T;  5LJ3 j;  1FWZ A;  2RH2 A;  2E64 A;  3V7R A;  2E65 A;  1GTT A;  3RKX A;  4LD9 K;  4FSS A;  3H9N A;  3E9G A;  1PKS A;  2DVJ A;  1M5Q 1;  1ZSZ B;  3EFO B;  3CD6 A;  3EHR A;  3QJ6 A;  3I55 A;  2M16 A;  2FZK B;  5DY9 A;  2RN8 A;  1OI1 A;  4CI0 C;  4ZGJ B;  1Q81 C;  1OU8 A;  2RNA A;  3FB9 A;  3X24 B;  5IN1 A;  1N6A A;  3TQ7 P;  2KSS A;  5HKC A;  1NJI C;  1RAE B;  1YI2 Q;  2YXY A;  1YIJ A;  1KC8 U;  4PJM A;  1IRX A;  2XIC A;  3I35 A;  3QXE B;  2AIR B;  3V8K A;  2MWO A;  4MZM A;  4E7H A;  2YDL A;  4EMK B;  3CCQ T;  3VUZ A;  1W6X A;  2NYS A;  1K73 U;  1QVP A;  1BI3 A;  2PVO B;  2G6F X;  2JMC A;  1ZA1 B;  4IUU A;  3OYG A;  4JPB W;  4BUG A;  1VQN T;  2M0O A;  4DOW A;  4N0A A;  1B34 B;  3S3N A;  4M78 F;  2CP7 A;  1TS9 A;  3JCM b;  2YHT A;  4QT7 A;  4RTX A;  1UGV A;  4K11 A;  1QP2 A;  1UJY A;  2COZ A;  2F2X A;  3MJX A;  4CRI A;  2QXF A;  4RCC A;  3CEY A;  4A63 B;  3LGF A;  1KSW A;  1TOV A;  3JV3 A;  4FT4 A;  4C0D C;  2OTJ A;  2EJG A;  2LVM A;  3FEO A;  2JS2 A;  4HCK A;  5FWC A;  4HCB A;  4QVZ A;  3REB B;  2LX9 A;  4MDX A;  1QCN A;  3V7S A;  4ZTF A;  1ZA2 B;  4F7U B;  1GBQ A;  1G5V A;  2L3P A;  3O5Z A;  2DF6 A;  3OYJ A;  2P4R A;  3VS5 A;  4RUG A;  2RI5 A;  2DTH A;  4RTT A;  3SD4 A;  5GAN d;  2Q1D X;  1M90 C;  5HK3 A;  3CC4 Q;  1M2V B;  2BZY A;  1YHQ T;  1RL2 A;  4M7A G;  2COW A;  3KUF A;  1D0X A;  2L0A A;  2X4X A;  1FXX A;  4QQ6 A;  3EFS A;  2X51 A;  2COY A;  3DLL A;  1NG2 A;  4F17 A;  1CKA A;  2HZY A;  2JUF A;  2X3W D;  5GAM e;  1KK7 A;  3JCM J;  4XTW A;  4M7D G;  2CSI A;  4AFS C;  1G8X A;  4KGX B;  2YUO A;  3L2V A;  3N5B B;  2OTL A;  4BI8 B;  2LX7 A;  2HQE A;  2RA2 A;  1AHJ B;  1QP3 A;  1TWB A;  2V8J A;  3G71 Q;  1ZUK A;  4RG2 A;  2V8I A;  3CXC A;  3OYY A;  1N8R U;  4Z88 A;  2LJ3 A;  2DXU A;  2YLB A;  4C8Q B;  1MUZ A;  2CYZ B;  3CXC S;  5GAN 5;  2FRW A;  3CC2 T;  4DEY A;  2E3I A;  1OX9 A;  4LN2 A;  2K4Y A;  3VRY A;  1JB0 E;  1SSH A;  1Q7Y R;  1E7O A;  1VQ7 Q;  4A4H A;  3QDR B;  2KNB B;  4C92 B;  1TTH B;  2F5K A;  2ZPH B;  3S52 A;  4M7A E;  3BFM A;  4KUI A;  3A8L B;  1YBY A;  1U1T A;  1TXQ A;  1X69 A;  4PLI A;  1ZLM A;  3VS7 A;  4VUB A;  4A4G A;  4AFZ C;  3G6E T;  3FDR A;  5A0L A;  1ABO A;  2DXC A;  2DM1 A;  4M75 G;  1PD0 A;  4M7D E;  3EFO A;  1VYV A;  2EJF A;  1VQM T;  4IUQ A;  1UGQ B;  5GMK j;  5FRM A;  1AWO A;  4D8K A;  2KGT A;  1U8R A;  4IKF A;  4J6X A;  5GMK h;  5LJ5 g;  4R56 A;  3JCM Q;  2QEX T;  2DNU A;  2EW3 A;  1ARK A;  4MZT A;  2E1H A;  2BIV A;  2YSQ A;  3T9N A;  3GNF B;  4JRK A;  5GAN 3;  4BD3 A;  3CCQ A;  1NJI R;  3RUX A;  4PJO B;  3HRT A;  2EGE A;  3S6W A;  1WZO A;  1KIK A;  4M75 A;  3L1A A;  4V2S A;  3LWH A;  4C0Z A;  4E6R A;  4EMK A;  1M4Z A;  2LTO A;  2HEQ A;  2QAZ A;  5CCA A;  4DA4 A;  3M9Q A;  1AWJ A;  2E6N A;  2RM4 A;  3R6N A;  4WCI A;  1VQN A;  4JJB A;  5LJ3 d;  4D8D A;  4ANJ A;  1KHC A;  2K3X A;  2RHX A;  3JCM c;  1R8O B;  2EPD A;  1XNI A;  2EYY A;  2D1X A;  5GAM g;  8AT1 B;  1YI2 T;  1BCO A;  1AWX A;  4M78 D;  3CCL A;  4J9H A;  3CCU T;  3CCE Q;  2ROL A;  1ABQ A;  1G3T A;  4RTY A;  2A08 A;  3UWN A;  3PE0 A;  1KJW A;  4FYW B;  2LQW A;  4QQG A;  4WF2 A;  1NLP C;  4QKU A;  1K9M C;  1VOM A;  3E9F A;  3LH5 A;  1IO6 A;  1BI0 A;  4J9D A;  3M57 A;  5LL6 S;  3LX7 A;  4HCZ A;  4F04 B;  4F7U A;  1KQ2 A;  1M3C A;  4PNO A;  4Z02 A;  2HL5 C;  2EQU A;  3EG0 A;  3P8B B;  1GCQ C;  2X4J A;  1Y07 A;  2RHI A;  1KD1 R;  4J7I A;  4OGC A;  4C0F A;  2AZV A;  5GAN 2;  3UT1 A;  1M2V A;  4AG2 C;  2KR3 A;  3BDL A;  5FLX E;  4XU3 A;  1I4K 1;  1BBZ A;  1Q7Y U;  4J6W A;  4JZ4 A;  2MMP A;  3M0Q A;  1SKU B;  1Q82 R;  1LVK A;  2DYI A;  3M4G A;  4ORZ A;  2VVK A;  1YJN A;  2DL3 A;  2RJD A;  1YJ9 T;  3LH0 A;  4BDY A;  3RIR A;  2RD1 A;  3OBW A;  4OB3 B;  2CSQ A;  4II1 A;  3PTA A;  1WXB A;  2P4T A;  4A4E A;  2C0O A;  2CUB A;  2SEM A;  1QVG A;  2NUT B;  2E5Q A;  5AYF A;  2AZS A;  4OVA A;  4XTU A;  2DL4 A;  2CT3 A;  4KUL A;  4CC4 B;  3SDZ A;  1M3B A;  4NS5 A;  4OMO A;  2HAX A;  2E4H A;  3CC2 A;  5CIU A;  2L89 A;  2YUN A;  1VQK Q;  3J80 E;  3MET A;  3SB2 A;  1P92 A;  3OYI A;  1EIF A;  1PM3 A;  4C92 A;  1UE9 A;  1WJQ A;  4XU0 A;  3Q1J A;  1QMC A;  1HD3 A;  3LGL A;  2VXF A;  3G71 T;  2QQA A;  2KI7 A;  2RHU A;  3GIB A;  2RPN A;  4P5N A;  3JAM E;  3G6E A;  1NBE B;  1YCY A;  2JTF A;  2E3H A;  5L23 A;  1XJW B;  2DXB A;  4J8O A;  4LDY A;  2L3S A;  3V7C A;  4CC2 A;  4DBF A;  3GNG A;  1VQM A;  2VGM A;  3L2U A;  2E10 A;  1SRL A;  3FJ5 A;  1VQ7 T;  2O88 A;  2CZ7 B;  2QEX A;  4C5H A;  2XKO C;  3FRN A;  2KRS A;  3TEE A;  3EH1 A;  2FVU A;  1ZHI A;  4JS5 A;  1M30 A;  3CPW A;  2AKK A;  3ER0 A;  2KE9 A;  1AD5 A;  2PZ1 A;  5LJ5 f;  2VKN A;  4A4F A;  5IXF A;  3ZBD A;  3CPW S;  1Q86 C;  3C4S A;  1BIA A;  1QCF A;  1BIB A;  1RAI B;  2FO0 A;  3JCM W;  2PNI A;  1A0N B;  5D2G A;  2X9H A;  1U5S A;  1D1B A;  4F14 A;  2IIM A;  4Y92 A;  2DPP B;  1QWE A;  3JCM d;  1WA7 A;  1Q82 U;  3CCU A;  2EWN A;  5DLO A;  4PKC C;  2CP3 A;  4OF1 A;  4EIK A;  1WHG A;  1SRM A;  2J7I A;  1MMN A;  1UFF A;  2EB5 A;  3QPH A;  3CXC P;  4PK4 A;  2LNV A;  1Z9Z A;  2I2L A;  4X34 A;  4C8Q F;  2EQI A;  3CCS T;  2JM8 A;  3WXM B;  1D0Y A;  2KAF A;  3EG3 A;  3MEV A;  4LE9 A;  1G3Y A;  3RMQ A;  2MCN A;  4HVW A;  1VQ6 Q;  1HYO A;  4EDU A;  3CME T;  1VQO Q;  1SHF A;  4M77 A;  2GCX A;  2I0N A;  2DL8 A;  2CP2 A;  1Q95 G;  3CCE T;  2HSP A;  2CT4 A;  1ZUY A;  4J9I A;  1PRL C;  3J81 E;  4M7A B;  1S72 T;  4M78 G;  2VWF A;  2IG0 A;  2RHZ A;  2KT1 A;  6AT1 B;  5CO7 A;  2V1Q A;  5KCH A;  3VU3 C;  1X01 A;  1B7T A;  2EKH A;  2GQV A;  4XTX A;  2H8H A;  3MEU A;  1YJ9 A;  5FRO A;  2FYK A;  1BCM A;  1WYX A;  5D2K A;  1MMD A;  3HFO A;  3RMS A;  2EGC A;  4Y91 A;  4M7D B;  3M0S A;  4J9C A;  3LLR A;  2DEQ A;  1YIT Q;  3CCR T;  4E7K A;  4N0A C;  4DBH A;  3OYB A;  2BTT A;  4ME7 A;  4BB7 A;  3OYC A;  4PJO F;  3A5Z B;  5I21 A;  5I11 A;  4XTZ A;  4CC3 A;  2V8K A;  2XDP A;  1MV0 B;  3G4S Q;  3RES A;  2WSF E;  2P0P A;  1SEM A;  2RQW A;  3F70 A;  5GAN g;  1I5L A;  3GLX A;  4NOY A;  2CUD A;  3TSZ A;  1RAG B;  3CC7 T;  2DYB A;  4BI3 A;  2W0Z A;  3SWN A;  2E12 A;  4MZP A;  4E7J A;  1OZ3 A;  5M9O A;  1NR9 A;  4B9X A;  3OYD A;  4J5Y A;  1AVZ C;  4J6Y A;  5LJ3 h;  1WHJ A;  3HKS A;  1M1K R;  3RR6 A;  1VQ4 T;  1RAF B;  4KH0 B;  3GOX A;  2ZCF B;  1VQ8 T;  1JBM A;  1WQ7 A;  5LJ3 e;  3D7S B;  3BDU A;  2DRK A;  2LT4 A;  3NPF A;  4PJN A;  3CMA Q;  4M78 E;  2DL5 A;  4J9E A;  3G71 A;  2VC8 A;  2RMO A;  4JJD A;  3QII A;  2JT4 A;  1WHM A;  4FYV B;  5IT9 E;  2EQM A;  4OMN A;  1VQL Q;  1K8A C;  2FHD A;  3OYH A;  1C6V X;  4M75 B;  4EPC A;  3CBO A;  1I1J A;  4OGE A;  2O31 A;  5IHN A;  1H64 1;  1X6G A;  1UDL A;  1TU0 B;  5CQY A;  1VQ7 A;  1VQK T;  1D09 B;  1LPL A;  3QWX X;  2XID A;  3M0U A;  1JJ2 A;  3I56 T;  5J3B A;  1PD1 A;  2G3R A;  1I81 A;  5D6Y A;  2MK5 A;  1MHN A;  3KXT A;  1JJ2 S;  2J6K A;  2DXT A;  4MAQ A;  1R0C B;  1K4U S;  1XOV A;  1X2K A;  1WXT A;  4LUE A;  2HMA A;  2DIG A;  2LNH B;  4UC4 A;  2YT6 A;  1GBR A;  3VRZ A;  2LCS A;  3OYE A;  2OAU A;  2PTK A;  1Y0M A;  1Q86 R;  1UGS B;  2FZC B;  1GCP A;  3PMT A;  3ASK A;  4GLM A;  2EKO A;  2Y4X A;  1U06 A; 
#chains in the Genus database with same CATH homology
 2Q1A X;  5D2I A;  3R6O A;  5D2G A;  2EB5 A;  5D2K A;  2WQT A;  5D2F A;  1QQJ A;  1I7O A;  2HZY A;  1QCO A;  5D2J A;  1WZO A;  3S52 A;  2Q1D X;  1GTT A;  3BQB A;  2Q1C X;  3LZK A;  2EB4 A;  1NKQ A;  4DBH A;  4DBF A;  1NR9 A;  2Q18 X;  2DFU A;  1SV6 A;  5D2H A;  3V77 A;  4QKU A;  3RR6 A;  4PFZ A;  4MAQ A;  1QCN A;  1SAW A;  1HYO A;  3QDF A;  2EB6 A;  2Q19 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...