2DFUA

Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
251
Chain Sequence
MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords probable 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
total genus 68
structure length 251
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 2dfuA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 2dfuA02
5D2JA 1HYOA 5D2FA 3BQBA 3R6OA 5D2IA 2EB5A 2Q1AX 5D2KA 1QCOA 2WQTA 4MAQA 1QQJA 2Q19X 3QDFA 1NKQA 1NR9A 2HZYA 2Q1CX 2Q1DX 1SV6A 5D2HA 3RR6A 2Q18X 4QKUA 4DBHA 1WZOA 4PFZA 2EB6A 1I7OA 2EB4A 3V77A 3S52A 4DBFA 2DFUA 3LZKA 1GTTA 1QCNA 5D2GA 1SAWA
chains in the Genus database with same CATH superfamily
3JB9H 2FRYA 2OTJA 4KH0B 3ULRB 4ORZA 1NKQA 2JTMA 1G8XA 4JRIA 3JCMW 1YITA 4JRKA 4M77G 2PQWA 1AT1B 1WJSA 2LTOA 3O8VA 3VS6A 1QVFA 2OTLT 1M8MA 3LZKA 3CC7A 2CYZB 1YJWT 3PGGA 2KDSA 3FRNA 2NYSA 4JJNK 1RL2A 5D2IA 1QVGA 4Y28E 1WPYA 1B34A 3VRZA 3HP9A 2P0PA 5DM7R 2KAFA 3M5AA 3CCQQ 3C0CA 2K6DA 1WQ7A 3V77A 4RCCA 5GAOn 4PJNA 3RMSA 4HCCA 1I4K1 3I5RA 5D2FA 4IUPA 2NUTB 2MK5A 1UGRB 4BACA 5I2SA 1G2BA 2EYYA 2YRVA 2ZPEB 1KG1A 3LYIA 3OYIA 2NWMA 1ZUUA 3L2VA 5LL6S 5EC7A 1HYOA 2YLCA 1QMCA 2FL7A 1YIJT 4BY6B 4OMLA 1QVGP 4FU6A 1QWEA 5IHKA 1M30A 4M7DB 1WIEA 4EMKB 2AIRB 1XJWB 5GAMf 1XQHA 1WHJA 4OB0B 2CREA 3JCMd 3CMAA 2K79A 1NE8A 5HKCA 2SRCA 2D8JA 2J6OA 1NJIR 3CCQA 2Q19X 2XD0A 3GBQA 2AKLA 2RQUA 2P0KA 4M78E 1D0YA 2K3YA 4E7KA 3CCEA 4PJOF 2DBMA 5GANd 4JRQA 1H3ZA 1HD3A 5CCAA 1VQ9T 5LJ5h 3INZA 2AZSA 2YUQA 1RAEB 1I0CA 2KRNA 5IHNA 3SEMA 1OZ2A 3PIOA 4KBMB 4JPBW 4OMQA 2VWFA 8ATCB 2WSCE 4F14A 1LJOA 2DD4A 1OX8A 4LUEA 1BI1A 1VQ9A 5IHIA 3OYMA 2J7IA 2KGTA 3HL8A 3QJYA 3V7CA 2HKNA 2KR3A 5J3BA 3OYHA 4RUGA 2RPNA 2KYMA 1PSEA 4AFZC 3GIBA 3UA7A 5FU6C 3CD6Q 4PJOE 2EJ9A 3HKSA 3C94A 2QA4A 3GP8A 2Y4XA 1NJIU 3SWNB 1T0HA 2DL3A 3MKDA 4PKCC 1IZ6A 1ZSGA 3FIFA 2YWWA 2X4XA 3GOXA 2Q1DX 1JJ2P 2EQMA 2RJDA 2WACA 2IG0A 4M77B 2LNHB 4FYVB 5GAOl 1K9MR 3SWNC 4XU2A 1M2VB 4C92C 2RM4A 2XI9A 4JDSA 3G4ST 4AG2C 1TWBA 2G3RA 3CCSQ 4JJCA 1SRLA 3J81E 4C8QA 3QSUA 1TH7A 1VQ4A 1PCXA 4M7AG 1YI2T 3QHSA 3OYEA 2YXYA 3MEWA 3OS5A 4A54A 3E9FA 1NPPA 1TU0B 4KGXB 3CD6A 1GRIA 3JB9G 2QA4T 2DNUA 2FHDA 4O6JA 1D3BA 4QW2A 4DEYA 1QCNA 1WXBA 1QCFA 1BU1A 3RERA 3JB9J 1LNXA 2CSIA 1RLPC 1BB9A 1MV3A 5KE3A 3LWHA 4XTYA 1Q82R 1YI2A 4LDWA 3MHXA 4M75C 4XAXB 4LN2A 1YFNA 1VQKQ 1B34B 4FIBA 4X9CA 4KUIA 2EKOA 4OGCA 5AT1B 5D6XA 5HK3A 2PNIA 4VUBA 3QXEB 5AYFA 5KYWA 2EPDA 2EBPA 2Y4YA 3MO8A 3IQLA 2FG0A 2CDTA 1VQOA 3REAB 4BE0A 2KQWA 1RAGB 2DMOA 1O75A 1Q86U 2DO3A 1WFWA 1Y07A 3OYLA 3QZ9B 4X34A 1W6XA 2OX7A 3R6NA 2DIGA 4DEXA 2PVGB 1TTHB 3MEUA 4ANJA 4XTWA 1MV0B 2HD0A 4J9GA 3X24B 3RDVA 3A8LB 5CO7A 2GNCA 1G5VA 1TUGB 2YSQA 1Q82U 1RAIB 2JMCA 4R0KA 1QP3A 2ZAEA 2EKHA 4MMKA 3AHUA 1AOJA 2XKOC 5D6YA 1X6BA 4D6WA 2HAXA 2D6FA 3GNGA 4DQ2A 2O88A 1ZBJA 1KC8C 2NUTA 3RBBB 4FYYB 2HL3A 1OZ3A 1KK7A 1BI0A 2Z0WA 2J06A 2EQKA 1P92A 1AEYA 3SFMA 2QEXT 2RQVA 3NMZC 3OYFA 2EYWA 4MZMA 4RG8A 5GAOp 3JB9I 5IXFA 3J80E 1M1GA 4FL6A 4E7JA 4ZGJB 3I35A 5FRMA 1OPKA 3EG0A 5FU7B 2MWOA 5CIUA 4HVUA 4Y91A 3A5ZB 2F69A 1PM3A 2ZCFB 4HVWA 3E1SA 3OYNA 5GAOm 4P5NA 3LH5A 1K8AC 4E7IA 1K9MC 3OYKA 4M78G 2L3QA 2LVMA 4B9WA 4ZTFA 1AD5A 1D1CA 1KSWA 2D1XA 1UHCA 3LH0A 2KYBA 3UWNA 2JXBA 2RJCA 2ATCB 1UGPB 5GJWB 2RJEA 3TSWA 5A0LA 4E47A 2E41A 7AT1B 1I07A 1YITQ 2EJGA 2EWNA 2BZYA 3CCVA 4X1VA 3HRUA 3L2RA 3C4SA 1YN8A 3ZBDA 2JNGA 2OTJQ 2DD5A 1IO6A 2QEXQ 4CC4B 2ESWA 1IB8A 2E3IA 4WCIA 2OTLQ 2EGEA 1NYFA 2CT4A 1R0BG 1VQ6A 2DFUA 1UHFA 4F04B 4HKEA 2VB6A 1X75C 4O5VA 3GPLA 3M58A 1VYTA 2RH2A 2O4XA 2ZPHB 2HMAA 1Y96B 2K7AA 3EGDA 4GLMA 2X4JA 2H8HA 4BI8B 2JTFA 1B3QA 2FRWA 4XU3A 4HCZA 4E7LA 4IUUA 1D0XA 2LCCA 4Z88A 6AT1B 1JJ2A 2L3PA 4QKUA 5I21A 3NPFA 1N8RC 1JRIA 3X20B 4CI0C 1RAAB 2DKGA 1SAWA 1CKBA 3SWNA 1VQ6T 1ACMB 2BTTA 5KYYA 1VQ4T 1M90R 4C0ZA 2K57A 3EGXA 1ZSZA 3JCMh 2YUOA 4KH1B 2V8IA 1WJQA 5CKBA 2QXFA 3OYGA 4HT9A 4DBHA 3QWXX 3M56A 2KEAA 3MP1A 4J6WA 1I7OA 2DXTA 1IHVA 1WDXA 1YJNA 4C92E 2VC8A 2KT8A 1FMKA 3RKXA 5CQXA 1LOJA 3CQTA 3FEOA 1W2BS 3BDLA 2K3BA 5GANh 1YWOA 3MP6A 3TU4K 3CBPA 4PNOA 2HBPA 3CEYA 1W70A 1FXXA 1UGVA 3TQ7P 1VQMQ 3QO3A 1JO8A 3OW2S 1ZBXA 2E65A 3CCLQ 3PIPA 3Q1JA 2C0OA 3VKIA 4FM4B 5CKDA 3M0TA 2CUBA 2CZ6B 4L59A 1SF9A 4A4GA 4PJLA 2MMPA 1ZA2B 3EFRA 4RKUE 2J6FA 1FMVA 4N4GA 1K0XA 1W2BA 4LDXA 1Z9QA 2C0IA 1KC8U 1NBEB 5LJ3f 2WSEE 4C0DB 1U1SA 1EZZB 4C0GA 1RAHB 4OP0A 2YRCA 2RI5A 2DX1A 2CS7A 3VS4A 1WXUA 2XG8D 3TVTA 4A4HA 1VQKA 3OMGA 3CMEQ 1I81A 3QWYA 4XTXA 1R8OB 1T3SA 3EFOB 4E7HA 3KXTA 5D2HA 4J9BA 1PG5B 4OF1A 1G3SA 1YIJQ 4M7DF 5M9OA 2X4YA 4M7AE 4PFZA 2A28A 2FPEA 4PL6A 3KBGA 1VQNT 1GTTA 1U8RA 1VQ5T 2M0OA 3ZL7C 1W4SA 4DOWA 3VS5A 1C0MA 2X9HA 2XK0A 3A8MB 1VQKT 2NUPB 4M78B 1UGQB 1M9SA 2YUNA 2HDAA 4IUTA 4EMGA 3JB9F 2E6ZA 2L3SA 1ZHIA 4QT7A 3OB9A 2K4YA 4LD9K 1W1FA 2EQJA 2ZGWA 3VYHB 3OMCA 1SPKA 2PUKB 1YHQT 1BK2A 2QDLA 1NEGA 1H92A 1QKWA 4M7AD 1Y96A 1AWXA 2LC4A 4F7UE 4Z89A 3FC3A 2DEUA 1TXQA 1BYMA 3I56Q 5GAOr 1Q82C 1D0ZA 4HVVA 2RD1A 5LJ3h 4EMKC 5J39A 2DIQA 2LZ6B 5KYUB 4KT0E 2E10A 2FPFA 1O9SA 1UECA 3FLGA 4DOVA 1HK9A 3S3OA 1K9AA 2OJ2A 4KULA 4BY6C 5LJ3e 2CZ0B 3VS0A 1XOVA 2L89A 1TUDA 1M3AA 1KHCA 2EFIA 2GQVA 2RHIA 5DLOA 2L3RA 2EGAA 1D1BA 1SG5A 1M1KC 3M0RA 4E7SA 2KSSA 1ZSZB 3CCJT 3HRTA 4OB2B 2LQKA 3X28B 3GF5A 2COZA 2EB4A 2CZ1B 1VOMA 2YRDA 2VUBA 3QYHB 4M75B 4C5EA 5GANf 2PU9B 2VXEA 2DF6A 1X43A 3G71A 1KQSS 2D0NA 2RQRA 4MDWA 4M77C 1FMWA 1VYVA 1M90C 1I5OB 2DA9A 1TSFA 3EGXB 1PC0A 4J7FA 4OMNA 3QG1A 2RHZA 3JCMQ 2EYXA 1LPLA 3PTAA 1YJ9Q 5GAN3 3H0IA 2RMOA 2V26A 1UJ0A 5HY6A 3CCRQ 3WVDB 1DJ7B 3OY9A 3VV0A 4PJOG 2EGCA 2QYZA 3CC4A 3OA6A 3H0FA 2M0YA 1OEBA 3CMAQ 2VV5A 5IN1A 4AT1B 1MHNA 1X2QA 3VS7A 2WQTA 2AKKA 3M9QA 4FT2A 1YITT 4KRTA 1RADB 3VUBA 1NEBA 2DYBA 1PKSA 4QVZA 2K9GA 1H3HA 1VQ8A 1M1KU 2MCNA 2ZPFB 3OS1A 4LDVA 1K8AR 2KE9A 4OB3B 1U1TA 2H3EB 2DXBA 3A98A 1K76A 1N9RA 2DETA 2FZCB 2QQRA 3EGUA 1G3YA 4BUGA 2RF0A 3I55T 1OI1A 2V8KA 2C06A 5GANe 2NUZA 4IIOA 2VXFA 2GF7A 4L6V5 2ECZA 1VQNQ 5GJVB 3HSBA 2LP5A 2HKQB 1FWZA 1VQNA 1AWWA 2HBWA 5GAN2 3A8OB 5D2GA 4OMMA 1GBQA 1RABB 2EQIA 1QCOA 3JCMJ 4BB7A 3QUIA 2JJ9A 2OI3A 3S3NA 1JBMA 4Q5WA 1VA7A 5GAMg 1PNJA 1X6GA 3S3MA 2BZXA 3PNWC 2CKKA 4E2FB 5IH2A 3CCST 3M4YA 1NYGA 1C1AA 4N4HA 2RO0A 4CC3A 3NTHA 1SKUB 2R58A 4FYWB 4JLIA 3BY7A 2LQ8A 3OYDA 3E19A 4C5IA 1W2BP 2DXUA 2W0ZA 1KQ1A 2YLBA 2ENMA 4ESRA 1KC8R 4ZGEB 1ABQA 4MZPA 3MJXA 3CC2T 3OQ5A 3CC4Q 1OULA 4ATOA 3EG3A 3SDZA 2K2VA 4M77D 3CCRA 1WX6A 5D2JA 1AZGB 1G3WA 3A8HB 4A53A 3RMQA 3TEEA 3EFOA 4J9IA 1GBRA 1M3BA 2HQHA 1EIFA 3OSSC 5GAOq 3G7ZA 3E2UA 3FB9A 2W10A 2BZ8A 1IRXA 1N8RU 5FWBA 2PVOB 5GAN7 2BE7D 3CCUA 4XK8E 3S52A 4J6YA 1V76A 2J05A 1AZEA 1YWPA 1N8RR 1JJ2S 3G71Q 4PFPA 3RNJA 1X69A 1JXMA 2EYQA 1WJRA 1AWOA 1SV6A 3CC2A 2X3XD 1JU5C 4QQ6A 3NTKA 2A37A 3BE3A 1VQPA 4C92B 3GNFB 3G4SQ 1YJWA 3UDCA 4A63B 2MWPA 4AMCA 1UG1A 4N0AC 1EFNA 3DB4A 2LX7A 3VS2A 1BCMA 2RHYA 1BI2A 1ZX6A 3GLXA 1SSFA 2RI2A 1VQ7A 1FYNA 4D8KA 5KYUA 1U06A 2MAMA 2CP3A 2DJQA 3I55Q 2FO0A 9ATCB 2M16A 5I2MA 4F7UA 5KCOA 1D3BB 2HEQA 4NOYA 1K4US 4FYXB 4E6RA 4CC7A 4PJMA 4PJJA 3C12A 4WTOB 2DL4A 5GAMj 2FVUA 5FWCA 4M77A 5D6WA 5KYWB 3L2WA 3OYJA 2JW4A 4AFQC 3EG9A 3OW2A 3OS2A 2O31A 4C8QB 2HCKA 2OAWA 2LJ1A 2HSPA 1VQLA 3M59A 1UB4A 1BI3A 4BE1A 4C5HA 3EHRA 5ECAA 1Q7YC 3OW2P 2QGFB 1PRMC 4F16A 4Y92A 5I11A 1QVGS 5GMKe 3ER0A 4EMHA 3EAEA 4AFUC 4JRPA 3L1AA 3PT9A 3I5SA 3CMEA 3CCMT 1UEBA 2R5AA 4FCYA 1YHQQ 4M75E 4PK4A 2JMAA 3CCET 1KHIA 1YCSB 2K5IA 3LW5E 1SRMA 1WZOA 3A8GB 1WHKA 4J6XA 1QVFS 5CKFA 2QQBA 3S6WA 1E6HA 1N5ZA 3CBOA 3JCMP 4C8QE 1Y7XA 2I0NA 4DBRA 3WVEB 1NJIC 1ZQ1A 3VS1A 2X51A 2P0QA 2FZGB 4HA8A 2DERA 2QDYB 2M51A 3LGFA 5C0MA 3G6EA 3HHTB 4RTUA 5IAYA 1KJWA 2KY9A 2X4WA 5I22A 3M0UA 4DBFA 2KBTA 1QP2A 1RACB 1RI0A 1IHWA 1OPLA 3CCMA 2DTIA 3I55A 4LE9A 3HTRA 3M4GA 2I2LA 1NG2A 4XU0A 2DZCA 3SD4A 4E7ZA 4V2SA 1RAFB 1YJNQ 5L23A 2QTXA 1K73R 1ZA1B 1Q81U 1KD1U 4BDYA 2XDDA 2XDPA 3PVQA 1JB0E 3E9GA 2J6KA 3HPWA 4J7IA 2VGMA 3G4SA 5KYXA 4C92D 3BQBA 2B86A 3JCMX 1WA7A 1LVKA 3OS0A 5IT9E 1BIBA 3QJ6A 2KK4A 2RNAA 3O5ZA 1VUBA 3MCAB 2RK1A 4Z8AA 1WYXA 2XICA 2JUFA 5LJ5f 3I9QA 4J9FA 4CC2A 5KYYB 3PFSA 2H3JA 4CRIA 4LD6A 1WQWA 2ABLA 3P8BB 4IIMA 2MI6A 1IXDA 2LQNA 2DE0X 3JCMf 1VQ7T 1UUEA 1H641 2ZPBB 2K3XA 2YUPA 1ZUYA 2OTLA 1I1JA 2MOXA 5FLXE 2CH4W 2IPOB 2XMFA 4JZ4A 4D8DA 1KFZA 1UTIA 5FU6B 1Q95G 4HXJA 1F1BB 1UE9A 4A4FA 5CQYA 1R0CB 2A0FB 4JZ3A 5FRNA 1TS9A 3UPUA 3OYCA 1WGSA 1E7OA 1X27A 2XIDA 1B7TA 1M4ZA 2JVVA 3EGDB 3QKJA 1UDLA 1M8VA 3F70A 4IURA 2CP7A 5GMKh 5GAN4 1AVZC 3QDFA 3CCJA 1C6VX 4OMPA 2HZYA 2IIMA 4JLGA 1GCQA 1WHGA 1AWJA 3BW1A 3H41A 3ME9A 4WF2A 2F2WA 2Y90A 4EMKA 2DZ9A 1OOTA 2MIOA 1M3CA 2RHUA 4M7DD 2JT4A 4LUDA 1T0JA 3CD6T 3JAME 4C92A 1B07A 1JXOA 1WI7A 1OQKA 4KGZB 2JS2A 3MPUB 2O4XB 5FROA 4B6MA 2V1RA 4JUVA 1VIFA 3G71T 4XTVA 3WXMB 3D7SB 4DA4A 2RJFA 3ZFJA 2X3WD 1NR9A 1S72Q 3EG1A 3JCMe 1X6OA 3RKWA 2AK5A 4BD3A 3CCLT 3V8LA 3OBWA 4GLKA 4F7UF 4PJOD 1VYUA 2JOYA 1LCKA 2LQWA 4FSSA 2JM8A 2C0TA 2QAZA 1IGQA 4M75D 2VASA 3NFCA 4M7DC 3OBYA 5L8RE 1BCOA 1QVPA 2DTOA 1YJ9T 3FDRA 1NZ9A 2E3HA 2YT6A 2KNBB 2EIFA 3RUXA 4BE2A 2ZPIB 1OU8A 5HK0A 4FW1A 3KFVA 2DJZA 1YHQA 1YBYA 1UGSB 4A4EA 4C92F 4ZN1A 2ED0A 5CR2A 2JM9A 2CUDA 1TUCA 4F17A 3VRYA 5LJ3g 2YDLA 5LJ5e 3JCMV 2DRMA 1YJ9A 2MYSA 3DB3A 1VQOQ 2NUPA 2PTKA 3TCJA 3CCRT 1U3OA 4FT4A 2EVRA 3CCUT 4A4KA 4J5YA 2CP2A 4HCBA 1MMNA 1VQLQ 2JN0A 1S72T 1Q7YU 4M7DA 4FSXA 2L2PA 4QVDA 3DKMA 1K9MU 1YCYA 4N0AA 2O9SA 1TG0A 4J9HA 4M77E 1FX7A 2CT3A 2A08A 2AHJB 2QASA 5A0GA 4RMOA 1M27C 1V29B 1NLPC 3JV3A 3M57A 2DILA 2MPXC 4LDYA 2XHCA 3H9NA 1X2KA 4IUQA 3CPWA 4KGVB 5GMKm 5J26A 2P4TA 4C0FA 4M7DE 2G6FX 1WHHA 4MZTA 4ZN3A 4PJOA 2R5MA 1WXTA 5KH6A 4C8QD 2GGRA 1UJYA 2QQ9A 2F2XA 2COYA 5DLQE 4J8OA 3V8KA 3ASKA 3OYAA 3LWIA 2K5FA 4EPCA 4X9DA 4LDUA 2FB7A 3LX7A 3QZ5B 1N6AA 2LJ3A 3EH2A 4PLIA 2DBKA 1KIKA 1AHJB 1YJWQ 1VQPQ 4PFOA 1ABOA 5HCKA 2EW3A 2HL5C 1QW1A 3CC2Q 4XTZA 4M7DG 5KYXB 2DPPB 5KCHA 3NTIA 1CKAA 4J83A 1ZSZC 5LJ3d 3LLRA 1OX9A 2VGNA 3QPHA 4RTXA 2HQEA 5LJ5g 4C8QC 2QA4Q 3CCUQ 4OVAA 4M78D 2DVEA 4C8QG 2HSEB 5GANg 2EB6A 4Z02A 2V8JA 4QQGA 4BDZA 4QVCA 3V8JA 2RB6A 4BI4A 5LJ5d 3P8HA 2E64A 4L5GA 2JZ2A 1I5LA 2Q1AX 1YIJA 2LJ0A 3DLMA 4J9DA 3EG2A 1VQ9Q 3JCMg 1M5Q1 5C6SA 3L42A 2NLUA 3HFNA 1M2VA 2BUDA 3PE0A 4JJDA 5EG2A 3JB9D 4XQ3A 2DLPA 4F7UG 2DXCA 2DRKA 4NL3A 4MAQA 4MDXA 1M2OA 4M78C 3CPFA 2EAYA 3H6ZA 1Q86C 2SEMA 4RTWA 4OMOA 5CK9A 3EHQA 1KQ2A 1H8KA 2WSFE 4RG2A 3CCEQ 2GBQA 3I56T 1GFDA 4ME7A 1J3TA 1Y57A 1NLOC 3ZEHA 2LDMA 1NM7A 1MNDA 5GMKj 1VIEA 4RTVA 3L2UA 3J7AF 1S72A 2KXDA 4IUVA 2Q1CX 2KXCA 2DAQA 2DTHA 1NPRA 3VS3A 4AFSC 4M75F 1VQOT 1IREB 1QKXA 2X35A 1YJNT 1YP5A 3QYGB 4OGEA 3M0SA 2L0AA 1Q86R 5GAMh 3AT1B 4J9CA 2A3LA 4M7AB 1K73U 2CZ7B 3VU3C 3HRSA 3CCJQ 2M02A 1HJDA 3KUFA 3V7RA 4PJOB 1VQ8Q 1UFFA 2RN8A 2ROLA 3H0HA 2O9VA 4BI3A 1KQSA 1GCPA 4EDUA 1TOVA 3CMET 2JS0A 3HFOA 1HSQA 3BDUA 2XDBA 2K5LA 1IGUA 2KRSA 2XU8A 1K0SA 2DL8A 1WHLA 1RUWA 2AZVA 1M1KR 3H8ZA 1K8AU 1OV3A 2BIVA 2E70A 4RTTA 2R57A 3OSVA 5GANj 3FJ5A 1Q81C 1KD1C 1D1AA 2CP6A 1N27A 1N9SA 4RTZA 2LT1A 1X01A 3CCQT 2CSQA 4LNPA 3UA6A 3CPWP 2EQUA 2DL7A 2FPDA 1GFCA 4QQDA 2QEXA 3CC7Q 2JTEA 4NS5A 3JCMc 1YNZA 5A2QE 1Z9ZA 3OYBA 1U5SA 2GTOA 4M78F 4LXCA 2E5QA 3RKYA 3G1JA 5IXBA 2GTJA 2E6NA 2QQSA 1GXIE 1PKTA 3CCVQ 1Q81R 1KD1R 3CXCS 4ELZC 4IKFA 3M0PA 1EX4A 4XTUA 3CBMA 3R6OA 2LT4A 3UATA 2COWA 1SEMA 3REBB 5CKHA 1PRLC 3A1PA 3DLLA 3JRZA 4MMLA 2RI3A 4M77F 2DYIA 1A0NB 2LRQA 4GY5A 5CKEA 3L2ZA 1K1ZA 1MGQA 8AT1B 1MUZA 3VUZA 3EG9B 3C95A 4PLLA 1M1FA 3SB2A 4OB1B 2LCSA 1V1CA 4J9EA 2E12A 2GFAA 4RCBA 1RI9A 4C92G 4XU1A 5GAN6 2FYKA 3CC4T 2KRMA 1OU9A 3SHWA 2M1HA 3FJPA 1PWTA 2F5KA 3V7SA 1VQ8T 1WLPB 5FU7C 3CCMQ 1PD1A 2ROTA 1K73C 3NHNA 1M90U 5FW9A 5GAMd 3QIIA 3I56A 4C5GA 2E4HA 1Q7YR 2DL5A 2FEIA 4OMFB 4AG1C 4B9XA 3N5BB 3EFSA 1E6GA 4ELYC 1MNEA 2F1LA 5CAIA 1XNIA 1JQQA 3MEVA 5KYNA 3G6EQ 3TSZA 3JSCA 2LMJA 4II1A 2RK2A 4M4ZA 1XTDA 2LX9A 2P84A 1ZUKA 1MMDA 4F7UB 3M0QA 1GL5A 1VQPT 2L5QA 4YTLA 1BBZA 4JS4A 4ZTJA 4HCKA 4R56A 2VVKA 4C8QF 3CC7T 2L8DA 2QI2A 3CXCP 5LJ3j 1GCQC 2FZKB 3URGA 5D2KA 5GMKl 1WNLA 2QGGA 1QQJA 4ZNXA 3BFMA 4M7AC 2O01E 2BE9B 1MMGA 1OYXA 1CSKA 2B8AA 4HT8A 3X25B 2F2VA 1BIAA 1RLQC 2RHXA 2PUOB 4C0DC 2GQIA 1S1NA 1JEGA 3EH1A 2HQXA 2RQWA 2GFUA 2CGHA 3T9NA 2RQTA 2EJFA 1ARKA 3RR6A 3META 1VQ5Q 2GCXA 2K2MA 3L2QA 3QDRB 1MMAA 4GBQA 5KE2A 4N4IA 1VQ5A 1KQSP 2KI7A 2VKNA 1SHFA 3UF4A 1VQLT 2QTVA 2MF2A 2KVQG 2QG9B 3OYYA 3PVLA 3THKA 4EIKA 2CH4A 3CPWS 1QVFP 4M7AF 2HNIA 2YHTA 1YI2Q 4RTYA 1Y71A 2AT1B 4UC4A 4DBQA 3RESA 3CCLA 4FW2A 2EYZA 3M55A 1SSHA 3U23A 1R77A 3RIRA 1I8FA 4M7AA 1PD0A 3VYGA 2OAUA 1VQMA 2V1QA 3MP8A 4M75G 5A0DA 2RA2A 1G3TA 3LGLA 2F5TX 2EB5A 5GAMe 2CP0A 1D09B 2KT1A 2QK0A 1VQ7Q 2A7YA 2ED1A 2O2OA 4KUDK 1T3LA 2PZ1A 5GMKi 3P8DA 4JS5A 1VQ4Q 3CCVT 3CMAT 4K11A 2D0QB 2E1HA 3CCSA 2KROA 3M53A 3CXCA 3UT1A 1VQMT 3MEAA 2A36A 3X26B 2VYTA 2LNVA 2OTJT 4JJBA 3M54A 5LJ5j 2DM1A 2D8HA 3NGPA 3TREA 1SHGA 2BKDN 3G6ET 2QQAA 1BKBA 2Q18X 3PMTA 1Y0MA 2M9UA 3QBYA 1G83A 2D9TA 2PVDB 1WHMA 5D7UA 5CVIA 1HXDA 1QWFA 2DK3A 2E5KA 3VJPA 3PMIA 5GAN8 4R55A 3JCMb 4M78A 5DY9A 4PJOC 2CP5A 5GAN5 4NL2A 1PHTA 4ZGDB 2ZPGB 1VQ6Q 1QLYA 4M75A 2LCLA 2DEQA 2KMTA 2P4RA 4TVRA 2IVWA 1ZLMA 2DVJA 2ZZDA 1PSFA
chains in the Genus database with same CATH topology
5D2JA 1HYOA 5D2FA 3BQBA 3R6OA 5D2IA 2EB5A 2Q1AX 5D2KA 1QCOA 2WQTA 4MAQA 1QQJA 2Q19X 3QDFA 1NKQA 1NR9A 2HZYA 2Q1CX 2Q1DX 1SV6A 5D2HA 3RR6A 2Q18X 4QKUA 4DBHA 1WZOA 4PFZA 2EB6A 1I7OA 2EB4A 3V77A 3S52A 4DBFA 2DFUA 3LZKA 1GTTA 1QCNA 5D2GA 1SAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2J A;  1HYO A;  5D2F A;  3BQB A;  3R6O A;  5D2I A;  2EB5 A;  2Q1A X;  5D2K A;  1QCO A;  2WQT A;  4MAQ A;  1QQJ A;  2Q19 X;  3QDF A;  1NKQ A;  1NR9 A;  2HZY A;  2Q1C X;  2Q1D X;  1SV6 A;  5D2H A;  3RR6 A;  2Q18 X;  4QKU A;  4DBH A;  1WZO A;  4PFZ A;  2EB6 A;  1I7O A;  2EB4 A;  3V77 A;  3S52 A;  4DBF A;  2DFU A;  3LZK A;  1GTT A;  1QCN A;  5D2G A;  1SAW A; 
#chains in the Genus database with same CATH topology
 3JB9 H;  2FRY A;  2OTJ A;  4KH0 B;  3ULR B;  4ORZ A;  1NKQ A;  2JTM A;  1G8X A;  4JRI A;  3JCM W;  1YIT A;  4JRK A;  4M77 G;  2PQW A;  1AT1 B;  1WJS A;  2LTO A;  3O8V A;  3VS6 A;  1QVF A;  2OTL T;  1M8M A;  3LZK A;  3CC7 A;  2CYZ B;  1YJW T;  3PGG A;  2KDS A;  3FRN A;  2NYS A;  4JJN K;  1RL2 A;  5D2I A;  1QVG A;  4Y28 E;  1WPY A;  1B34 A;  3VRZ A;  3HP9 A;  2P0P A;  5DM7 R;  2KAF A;  3M5A A;  3CCQ Q;  3C0C A;  2K6D A;  1WQ7 A;  3V77 A;  4RCC A;  5GAO n;  4PJN A;  3RMS A;  4HCC A;  1I4K 1;  3I5R A;  5D2F A;  4IUP A;  2NUT B;  2MK5 A;  1UGR B;  4BAC A;  5I2S A;  1G2B A;  2EYY A;  2YRV A;  2ZPE B;  1KG1 A;  3LYI A;  3OYI A;  2NWM A;  1ZUU A;  3L2V A;  5LL6 S;  5EC7 A;  1HYO A;  2YLC A;  1QMC A;  2FL7 A;  1YIJ T;  4BY6 B;  4OML A;  1QVG P;  4FU6 A;  1QWE A;  5IHK A;  1M30 A;  4M7D B;  1WIE A;  4EMK B;  2AIR B;  1XJW B;  5GAM f;  1XQH A;  1WHJ A;  4OB0 B;  2CRE A;  3JCM d;  3CMA A;  2K79 A;  1NE8 A;  5HKC A;  2SRC A;  2D8J A;  2J6O A;  1NJI R;  3CCQ A;  2Q19 X;  2XD0 A;  3GBQ A;  2AKL A;  2RQU A;  2P0K A;  4M78 E;  1D0Y A;  2K3Y A;  4E7K A;  3CCE A;  4PJO F;  2DBM A;  5GAN d;  4JRQ A;  1H3Z A;  1HD3 A;  5CCA A;  1VQ9 T;  5LJ5 h;  3INZ A;  2AZS A;  2YUQ A;  1RAE B;  1I0C A;  2KRN A;  5IHN A;  3SEM A;  1OZ2 A;  3PIO A;  4KBM B;  4JPB W;  4OMQ A;  2VWF A;  8ATC B;  2WSC E;  4F14 A;  1LJO A;  2DD4 A;  1OX8 A;  4LUE A;  1BI1 A;  1VQ9 A;  5IHI A;  3OYM A;  2J7I A;  2KGT A;  3HL8 A;  3QJY A;  3V7C A;  2HKN A;  2KR3 A;  5J3B A;  3OYH A;  4RUG A;  2RPN A;  2KYM A;  1PSE A;  4AFZ C;  3GIB A;  3UA7 A;  5FU6 C;  3CD6 Q;  4PJO E;  2EJ9 A;  3HKS A;  3C94 A;  2QA4 A;  3GP8 A;  2Y4X A;  1NJI U;  3SWN B;  1T0H A;  2DL3 A;  3MKD A;  4PKC C;  1IZ6 A;  1ZSG A;  3FIF A;  2YWW A;  2X4X A;  3GOX A;  2Q1D X;  1JJ2 P;  2EQM A;  2RJD A;  2WAC A;  2IG0 A;  4M77 B;  2LNH B;  4FYV B;  5GAO l;  1K9M R;  3SWN C;  4XU2 A;  1M2V B;  4C92 C;  2RM4 A;  2XI9 A;  4JDS A;  3G4S T;  4AG2 C;  1TWB A;  2G3R A;  3CCS Q;  4JJC A;  1SRL A;  3J81 E;  4C8Q A;  3QSU A;  1TH7 A;  1VQ4 A;  1PCX A;  4M7A G;  1YI2 T;  3QHS A;  3OYE A;  2YXY A;  3MEW A;  3OS5 A;  4A54 A;  3E9F A;  1NPP A;  1TU0 B;  4KGX B;  3CD6 A;  1GRI A;  3JB9 G;  2QA4 T;  2DNU A;  2FHD A;  4O6J A;  1D3B A;  4QW2 A;  4DEY A;  1QCN A;  1WXB A;  1QCF A;  1BU1 A;  3RER A;  3JB9 J;  1LNX A;  2CSI A;  1RLP C;  1BB9 A;  1MV3 A;  5KE3 A;  3LWH A;  4XTY A;  1Q82 R;  1YI2 A;  4LDW A;  3MHX A;  4M75 C;  4XAX B;  4LN2 A;  1YFN A;  1VQK Q;  1B34 B;  4FIB A;  4X9C A;  4KUI A;  2EKO A;  4OGC A;  5AT1 B;  5D6X A;  5HK3 A;  2PNI A;  4VUB A;  3QXE B;  5AYF A;  5KYW A;  2EPD A;  2EBP A;  2Y4Y A;  3MO8 A;  3IQL A;  2FG0 A;  2CDT A;  1VQO A;  3REA B;  4BE0 A;  2KQW A;  1RAG B;  2DMO A;  1O75 A;  1Q86 U;  2DO3 A;  1WFW A;  1Y07 A;  3OYL A;  3QZ9 B;  4X34 A;  1W6X A;  2OX7 A;  3R6N A;  2DIG A;  4DEX A;  2PVG B;  1TTH B;  3MEU A;  4ANJ A;  4XTW A;  1MV0 B;  2HD0 A;  4J9G A;  3X24 B;  3RDV A;  3A8L B;  5CO7 A;  2GNC A;  1G5V A;  1TUG B;  2YSQ A;  1Q82 U;  1RAI B;  2JMC A;  4R0K A;  1QP3 A;  2ZAE A;  2EKH A;  4MMK A;  3AHU A;  1AOJ A;  2XKO C;  5D6Y A;  1X6B A;  4D6W A;  2HAX A;  2D6F A;  3GNG A;  4DQ2 A;  2O88 A;  1ZBJ A;  1KC8 C;  2NUT A;  3RBB B;  4FYY B;  2HL3 A;  1OZ3 A;  1KK7 A;  1BI0 A;  2Z0W A;  2J06 A;  2EQK A;  1P92 A;  1AEY A;  3SFM A;  2QEX T;  2RQV A;  3NMZ C;  3OYF A;  2EYW A;  4MZM A;  4RG8 A;  5GAO p;  3JB9 I;  5IXF A;  3J80 E;  1M1G A;  4FL6 A;  4E7J A;  4ZGJ B;  3I35 A;  5FRM A;  1OPK A;  3EG0 A;  5FU7 B;  2MWO A;  5CIU A;  4HVU A;  4Y91 A;  3A5Z B;  2F69 A;  1PM3 A;  2ZCF B;  4HVW A;  3E1S A;  3OYN A;  5GAO m;  4P5N A;  3LH5 A;  1K8A C;  4E7I A;  1K9M C;  3OYK A;  4M78 G;  2L3Q A;  2LVM A;  4B9W A;  4ZTF A;  1AD5 A;  1D1C A;  1KSW A;  2D1X A;  1UHC A;  3LH0 A;  2KYB A;  3UWN A;  2JXB A;  2RJC A;  2ATC B;  1UGP B;  5GJW B;  2RJE A;  3TSW A;  5A0L A;  4E47 A;  2E41 A;  7AT1 B;  1I07 A;  1YIT Q;  2EJG A;  2EWN A;  2BZY A;  3CCV A;  4X1V A;  3HRU A;  3L2R A;  3C4S A;  1YN8 A;  3ZBD A;  2JNG A;  2OTJ Q;  2DD5 A;  1IO6 A;  2QEX Q;  4CC4 B;  2ESW A;  1IB8 A;  2E3I A;  4WCI A;  2OTL Q;  2EGE A;  1NYF A;  2CT4 A;  1R0B G;  1VQ6 A;  2DFU A;  1UHF A;  4F04 B;  4HKE A;  2VB6 A;  1X75 C;  4O5V A;  3GPL A;  3M58 A;  1VYT A;  2RH2 A;  2O4X A;  2ZPH B;  2HMA A;  1Y96 B;  2K7A A;  3EGD A;  4GLM A;  2X4J A;  2H8H A;  4BI8 B;  2JTF A;  1B3Q A;  2FRW A;  4XU3 A;  4HCZ A;  4E7L A;  4IUU A;  1D0X A;  2LCC A;  4Z88 A;  6AT1 B;  1JJ2 A;  2L3P A;  4QKU A;  5I21 A;  3NPF A;  1N8R C;  1JRI A;  3X20 B;  4CI0 C;  1RAA B;  2DKG A;  1SAW A;  1CKB A;  3SWN A;  1VQ6 T;  1ACM B;  2BTT A;  5KYY A;  1VQ4 T;  1M90 R;  4C0Z A;  2K57 A;  3EGX A;  1ZSZ A;  3JCM h;  2YUO A;  4KH1 B;  2V8I A;  1WJQ A;  5CKB A;  2QXF A;  3OYG A;  4HT9 A;  4DBH A;  3QWX X;  3M56 A;  2KEA A;  3MP1 A;  4J6W A;  1I7O A;  2DXT A;  1IHV A;  1WDX A;  1YJN A;  4C92 E;  2VC8 A;  2KT8 A;  1FMK A;  3RKX A;  5CQX A;  1LOJ A;  3CQT A;  3FEO A;  1W2B S;  3BDL A;  2K3B A;  5GAN h;  1YWO A;  3MP6 A;  3TU4 K;  3CBP A;  4PNO A;  2HBP A;  3CEY A;  1W70 A;  1FXX A;  1UGV A;  3TQ7 P;  1VQM Q;  3QO3 A;  1JO8 A;  3OW2 S;  1ZBX A;  2E65 A;  3CCL Q;  3PIP A;  3Q1J A;  2C0O A;  3VKI A;  4FM4 B;  5CKD A;  3M0T A;  2CUB A;  2CZ6 B;  4L59 A;  1SF9 A;  4A4G A;  4PJL A;  2MMP A;  1ZA2 B;  3EFR A;  4RKU E;  2J6F A;  1FMV A;  4N4G A;  1K0X A;  1W2B A;  4LDX A;  1Z9Q A;  2C0I A;  1KC8 U;  1NBE B;  5LJ3 f;  2WSE E;  4C0D B;  1U1S A;  1EZZ B;  4C0G A;  1RAH B;  4OP0 A;  2YRC A;  2RI5 A;  2DX1 A;  2CS7 A;  3VS4 A;  1WXU A;  2XG8 D;  3TVT A;  4A4H A;  1VQK A;  3OMG A;  3CME Q;  1I81 A;  3QWY A;  4XTX A;  1R8O B;  1T3S A;  3EFO B;  4E7H A;  3KXT A;  5D2H A;  4J9B A;  1PG5 B;  4OF1 A;  1G3S A;  1YIJ Q;  4M7D F;  5M9O A;  2X4Y A;  4M7A E;  4PFZ A;  2A28 A;  2FPE A;  4PL6 A;  3KBG A;  1VQN T;  1GTT A;  1U8R A;  1VQ5 T;  2M0O A;  3ZL7 C;  1W4S A;  4DOW A;  3VS5 A;  1C0M A;  2X9H A;  2XK0 A;  3A8M B;  1VQK T;  2NUP B;  4M78 B;  1UGQ B;  1M9S A;  2YUN A;  2HDA A;  4IUT A;  4EMG A;  3JB9 F;  2E6Z A;  2L3S A;  1ZHI A;  4QT7 A;  3OB9 A;  2K4Y A;  4LD9 K;  1W1F A;  2EQJ A;  2ZGW A;  3VYH B;  3OMC A;  1SPK A;  2PUK B;  1YHQ T;  1BK2 A;  2QDL A;  1NEG A;  1H92 A;  1QKW A;  4M7A D;  1Y96 A;  1AWX A;  2LC4 A;  4F7U E;  4Z89 A;  3FC3 A;  2DEU A;  1TXQ A;  1BYM A;  3I56 Q;  5GAO r;  1Q82 C;  1D0Z A;  4HVV A;  2RD1 A;  5LJ3 h;  4EMK C;  5J39 A;  2DIQ A;  2LZ6 B;  5KYU B;  4KT0 E;  2E10 A;  2FPF A;  1O9S A;  1UEC A;  3FLG A;  4DOV A;  1HK9 A;  3S3O A;  1K9A A;  2OJ2 A;  4KUL A;  4BY6 C;  5LJ3 e;  2CZ0 B;  3VS0 A;  1XOV A;  2L89 A;  1TUD A;  1M3A A;  1KHC A;  2EFI A;  2GQV A;  2RHI A;  5DLO A;  2L3R A;  2EGA A;  1D1B A;  1SG5 A;  1M1K C;  3M0R A;  4E7S A;  2KSS A;  1ZSZ B;  3CCJ T;  3HRT A;  4OB2 B;  2LQK A;  3X28 B;  3GF5 A;  2COZ A;  2EB4 A;  2CZ1 B;  1VOM A;  2YRD A;  2VUB A;  3QYH B;  4M75 B;  4C5E A;  5GAN f;  2PU9 B;  2VXE A;  2DF6 A;  1X43 A;  3G71 A;  1KQS S;  2D0N A;  2RQR A;  4MDW A;  4M77 C;  1FMW A;  1VYV A;  1M90 C;  1I5O B;  2DA9 A;  1TSF A;  3EGX B;  1PC0 A;  4J7F A;  4OMN A;  3QG1 A;  2RHZ A;  3JCM Q;  2EYX A;  1LPL A;  3PTA A;  1YJ9 Q;  5GAN 3;  3H0I A;  2RMO A;  2V26 A;  1UJ0 A;  5HY6 A;  3CCR Q;  3WVD B;  1DJ7 B;  3OY9 A;  3VV0 A;  4PJO G;  2EGC A;  2QYZ A;  3CC4 A;  3OA6 A;  3H0F A;  2M0Y A;  1OEB A;  3CMA Q;  2VV5 A;  5IN1 A;  4AT1 B;  1MHN A;  1X2Q A;  3VS7 A;  2WQT A;  2AKK A;  3M9Q A;  4FT2 A;  1YIT T;  4KRT A;  1RAD B;  3VUB A;  1NEB A;  2DYB A;  1PKS A;  4QVZ A;  2K9G A;  1H3H A;  1VQ8 A;  1M1K U;  2MCN A;  2ZPF B;  3OS1 A;  4LDV A;  1K8A R;  2KE9 A;  4OB3 B;  1U1T A;  2H3E B;  2DXB A;  3A98 A;  1K76 A;  1N9R A;  2DET A;  2FZC B;  2QQR A;  3EGU A;  1G3Y A;  4BUG A;  2RF0 A;  3I55 T;  1OI1 A;  2V8K A;  2C06 A;  5GAN e;  2NUZ A;  4IIO A;  2VXF A;  2GF7 A;  4L6V 5;  2ECZ A;  1VQN Q;  5GJV B;  3HSB A;  2LP5 A;  2HKQ B;  1FWZ A;  1VQN A;  1AWW A;  2HBW A;  5GAN 2;  3A8O B;  5D2G A;  4OMM A;  1GBQ A;  1RAB B;  2EQI A;  1QCO A;  3JCM J;  4BB7 A;  3QUI A;  2JJ9 A;  2OI3 A;  3S3N A;  1JBM A;  4Q5W A;  1VA7 A;  5GAM g;  1PNJ A;  1X6G A;  3S3M A;  2BZX A;  3PNW C;  2CKK A;  4E2F B;  5IH2 A;  3CCS T;  3M4Y A;  1NYG A;  1C1A A;  4N4H A;  2RO0 A;  4CC3 A;  3NTH A;  1SKU B;  2R58 A;  4FYW B;  4JLI A;  3BY7 A;  2LQ8 A;  3OYD A;  3E19 A;  4C5I A;  1W2B P;  2DXU A;  2W0Z A;  1KQ1 A;  2YLB A;  2ENM A;  4ESR A;  1KC8 R;  4ZGE B;  1ABQ A;  4MZP A;  3MJX A;  3CC2 T;  3OQ5 A;  3CC4 Q;  1OUL A;  4ATO A;  3EG3 A;  3SDZ A;  2K2V A;  4M77 D;  3CCR A;  1WX6 A;  5D2J A;  1AZG B;  1G3W A;  3A8H B;  4A53 A;  3RMQ A;  3TEE A;  3EFO A;  4J9I A;  1GBR A;  1M3B A;  2HQH A;  1EIF A;  3OSS C;  5GAO q;  3G7Z A;  3E2U A;  3FB9 A;  2W10 A;  2BZ8 A;  1IRX A;  1N8R U;  5FWB A;  2PVO B;  5GAN 7;  2BE7 D;  3CCU A;  4XK8 E;  3S52 A;  4J6Y A;  1V76 A;  2J05 A;  1AZE A;  1YWP A;  1N8R R;  1JJ2 S;  3G71 Q;  4PFP A;  3RNJ A;  1X69 A;  1JXM A;  2EYQ A;  1WJR A;  1AWO A;  1SV6 A;  3CC2 A;  2X3X D;  1JU5 C;  4QQ6 A;  3NTK A;  2A37 A;  3BE3 A;  1VQP A;  4C92 B;  3GNF B;  3G4S Q;  1YJW A;  3UDC A;  4A63 B;  2MWP A;  4AMC A;  1UG1 A;  4N0A C;  1EFN A;  3DB4 A;  2LX7 A;  3VS2 A;  1BCM A;  2RHY A;  1BI2 A;  1ZX6 A;  3GLX A;  1SSF A;  2RI2 A;  1VQ7 A;  1FYN A;  4D8K A;  5KYU A;  1U06 A;  2MAM A;  2CP3 A;  2DJQ A;  3I55 Q;  2FO0 A;  9ATC B;  2M16 A;  5I2M A;  4F7U A;  5KCO A;  1D3B B;  2HEQ A;  4NOY A;  1K4U S;  4FYX B;  4E6R A;  4CC7 A;  4PJM A;  4PJJ A;  3C12 A;  4WTO B;  2DL4 A;  5GAM j;  2FVU A;  5FWC A;  4M77 A;  5D6W A;  5KYW B;  3L2W A;  3OYJ A;  2JW4 A;  4AFQ C;  3EG9 A;  3OW2 A;  3OS2 A;  2O31 A;  4C8Q B;  2HCK A;  2OAW A;  2LJ1 A;  2HSP A;  1VQL A;  3M59 A;  1UB4 A;  1BI3 A;  4BE1 A;  4C5H A;  3EHR A;  5ECA A;  1Q7Y C;  3OW2 P;  2QGF B;  1PRM C;  4F16 A;  4Y92 A;  5I11 A;  1QVG S;  5GMK e;  3ER0 A;  4EMH A;  3EAE A;  4AFU C;  4JRP A;  3L1A A;  3PT9 A;  3I5S A;  3CME A;  3CCM T;  1UEB A;  2R5A A;  4FCY A;  1YHQ Q;  4M75 E;  4PK4 A;  2JMA A;  3CCE T;  1KHI A;  1YCS B;  2K5I A;  3LW5 E;  1SRM A;  1WZO A;  3A8G B;  1WHK A;  4J6X A;  1QVF S;  5CKF A;  2QQB A;  3S6W A;  1E6H A;  1N5Z A;  3CBO A;  3JCM P;  4C8Q E;  1Y7X A;  2I0N A;  4DBR A;  3WVE B;  1NJI C;  1ZQ1 A;  3VS1 A;  2X51 A;  2P0Q A;  2FZG B;  4HA8 A;  2DER A;  2QDY B;  2M51 A;  3LGF A;  5C0M A;  3G6E A;  3HHT B;  4RTU A;  5IAY A;  1KJW A;  2KY9 A;  2X4W A;  5I22 A;  3M0U A;  4DBF A;  2KBT A;  1QP2 A;  1RAC B;  1RI0 A;  1IHW A;  1OPL A;  3CCM A;  2DTI A;  3I55 A;  4LE9 A;  3HTR A;  3M4G A;  2I2L A;  1NG2 A;  4XU0 A;  2DZC A;  3SD4 A;  4E7Z A;  4V2S A;  1RAF B;  1YJN Q;  5L23 A;  2QTX A;  1K73 R;  1ZA1 B;  1Q81 U;  1KD1 U;  4BDY A;  2XDD A;  2XDP A;  3PVQ A;  1JB0 E;  3E9G A;  2J6K A;  3HPW A;  4J7I A;  2VGM A;  3G4S A;  5KYX A;  4C92 D;  3BQB A;  2B86 A;  3JCM X;  1WA7 A;  1LVK A;  3OS0 A;  5IT9 E;  1BIB A;  3QJ6 A;  2KK4 A;  2RNA A;  3O5Z A;  1VUB A;  3MCA B;  2RK1 A;  4Z8A A;  1WYX A;  2XIC A;  2JUF A;  5LJ5 f;  3I9Q A;  4J9F A;  4CC2 A;  5KYY B;  3PFS A;  2H3J A;  4CRI A;  4LD6 A;  1WQW A;  2ABL A;  3P8B B;  4IIM A;  2MI6 A;  1IXD A;  2LQN A;  2DE0 X;  3JCM f;  1VQ7 T;  1UUE A;  1H64 1;  2ZPB B;  2K3X A;  2YUP A;  1ZUY A;  2OTL A;  1I1J A;  2MOX A;  5FLX E;  2CH4 W;  2IPO B;  2XMF A;  4JZ4 A;  4D8D A;  1KFZ A;  1UTI A;  5FU6 B;  1Q95 G;  4HXJ A;  1F1B B;  1UE9 A;  4A4F A;  5CQY A;  1R0C B;  2A0F B;  4JZ3 A;  5FRN A;  1TS9 A;  3UPU A;  3OYC A;  1WGS A;  1E7O A;  1X27 A;  2XID A;  1B7T A;  1M4Z A;  2JVV A;  3EGD B;  3QKJ A;  1UDL A;  1M8V A;  3F70 A;  4IUR A;  2CP7 A;  5GMK h;  5GAN 4;  1AVZ C;  3QDF A;  3CCJ A;  1C6V X;  4OMP A;  2HZY A;  2IIM A;  4JLG A;  1GCQ A;  1WHG A;  1AWJ A;  3BW1 A;  3H41 A;  3ME9 A;  4WF2 A;  2F2W A;  2Y90 A;  4EMK A;  2DZ9 A;  1OOT A;  2MIO A;  1M3C A;  2RHU A;  4M7D D;  2JT4 A;  4LUD A;  1T0J A;  3CD6 T;  3JAM E;  4C92 A;  1B07 A;  1JXO A;  1WI7 A;  1OQK A;  4KGZ B;  2JS2 A;  3MPU B;  2O4X B;  5FRO A;  4B6M A;  2V1R A;  4JUV A;  1VIF A;  3G71 T;  4XTV A;  3WXM B;  3D7S B;  4DA4 A;  2RJF A;  3ZFJ A;  2X3W D;  1NR9 A;  1S72 Q;  3EG1 A;  3JCM e;  1X6O A;  3RKW A;  2AK5 A;  4BD3 A;  3CCL T;  3V8L A;  3OBW A;  4GLK A;  4F7U F;  4PJO D;  1VYU A;  2JOY A;  1LCK A;  2LQW A;  4FSS A;  2JM8 A;  2C0T A;  2QAZ A;  1IGQ A;  4M75 D;  2VAS A;  3NFC A;  4M7D C;  3OBY A;  5L8R E;  1BCO A;  1QVP A;  2DTO A;  1YJ9 T;  3FDR A;  1NZ9 A;  2E3H A;  2YT6 A;  2KNB B;  2EIF A;  3RUX A;  4BE2 A;  2ZPI B;  1OU8 A;  5HK0 A;  4FW1 A;  3KFV A;  2DJZ A;  1YHQ A;  1YBY A;  1UGS B;  4A4E A;  4C92 F;  4ZN1 A;  2ED0 A;  5CR2 A;  2JM9 A;  2CUD A;  1TUC A;  4F17 A;  3VRY A;  5LJ3 g;  2YDL A;  5LJ5 e;  3JCM V;  2DRM A;  1YJ9 A;  2MYS A;  3DB3 A;  1VQO Q;  2NUP A;  2PTK A;  3TCJ A;  3CCR T;  1U3O A;  4FT4 A;  2EVR A;  3CCU T;  4A4K A;  4J5Y A;  2CP2 A;  4HCB A;  1MMN A;  1VQL Q;  2JN0 A;  1S72 T;  1Q7Y U;  4M7D A;  4FSX A;  2L2P A;  4QVD A;  3DKM A;  1K9M U;  1YCY A;  4N0A A;  2O9S A;  1TG0 A;  4J9H A;  4M77 E;  1FX7 A;  2CT3 A;  2A08 A;  2AHJ B;  2QAS A;  5A0G A;  4RMO A;  1M27 C;  1V29 B;  1NLP C;  3JV3 A;  3M57 A;  2DIL A;  2MPX C;  4LDY A;  2XHC A;  3H9N A;  1X2K A;  4IUQ A;  3CPW A;  4KGV B;  5GMK m;  5J26 A;  2P4T A;  4C0F A;  4M7D E;  2G6F X;  1WHH A;  4MZT A;  4ZN3 A;  4PJO A;  2R5M A;  1WXT A;  5KH6 A;  4C8Q D;  2GGR A;  1UJY A;  2QQ9 A;  2F2X A;  2COY A;  5DLQ E;  4J8O A;  3V8K A;  3ASK A;  3OYA A;  3LWI A;  2K5F A;  4EPC A;  4X9D A;  4LDU A;  2FB7 A;  3LX7 A;  3QZ5 B;  1N6A A;  2LJ3 A;  3EH2 A;  4PLI A;  2DBK A;  1KIK A;  1AHJ B;  1YJW Q;  1VQP Q;  4PFO A;  1ABO A;  5HCK A;  2EW3 A;  2HL5 C;  1QW1 A;  3CC2 Q;  4XTZ A;  4M7D G;  5KYX B;  2DPP B;  5KCH A;  3NTI A;  1CKA A;  4J83 A;  1ZSZ C;  5LJ3 d;  3LLR A;  1OX9 A;  2VGN A;  3QPH A;  4RTX A;  2HQE A;  5LJ5 g;  4C8Q C;  2QA4 Q;  3CCU Q;  4OVA A;  4M78 D;  2DVE A;  4C8Q G;  2HSE B;  5GAN g;  2EB6 A;  4Z02 A;  2V8J A;  4QQG A;  4BDZ A;  4QVC A;  3V8J A;  2RB6 A;  4BI4 A;  5LJ5 d;  3P8H A;  2E64 A;  4L5G A;  2JZ2 A;  1I5L A;  2Q1A X;  1YIJ A;  2LJ0 A;  3DLM A;  4J9D A;  3EG2 A;  1VQ9 Q;  3JCM g;  1M5Q 1;  5C6S A;  3L42 A;  2NLU A;  3HFN A;  1M2V A;  2BUD A;  3PE0 A;  4JJD A;  5EG2 A;  3JB9 D;  4XQ3 A;  2DLP A;  4F7U G;  2DXC A;  2DRK A;  4NL3 A;  4MAQ A;  4MDX A;  1M2O A;  4M78 C;  3CPF A;  2EAY A;  3H6Z A;  1Q86 C;  2SEM A;  4RTW A;  4OMO A;  5CK9 A;  3EHQ A;  1KQ2 A;  1H8K A;  2WSF E;  4RG2 A;  3CCE Q;  2GBQ A;  3I56 T;  1GFD A;  4ME7 A;  1J3T A;  1Y57 A;  1NLO C;  3ZEH A;  2LDM A;  1NM7 A;  1MND A;  5GMK j;  1VIE A;  4RTV A;  3L2U A;  3J7A F;  1S72 A;  2KXD A;  4IUV A;  2Q1C X;  2KXC A;  2DAQ A;  2DTH A;  1NPR A;  3VS3 A;  4AFS C;  4M75 F;  1VQO T;  1IRE B;  1QKX A;  2X35 A;  1YJN T;  1YP5 A;  3QYG B;  4OGE A;  3M0S A;  2L0A A;  1Q86 R;  5GAM h;  3AT1 B;  4J9C A;  2A3L A;  4M7A B;  1K73 U;  2CZ7 B;  3VU3 C;  3HRS A;  3CCJ Q;  2M02 A;  1HJD A;  3KUF A;  3V7R A;  4PJO B;  1VQ8 Q;  1UFF A;  2RN8 A;  2ROL A;  3H0H A;  2O9V A;  4BI3 A;  1KQS A;  1GCP A;  4EDU A;  1TOV A;  3CME T;  2JS0 A;  3HFO A;  1HSQ A;  3BDU A;  2XDB A;  2K5L A;  1IGU A;  2KRS A;  2XU8 A;  1K0S A;  2DL8 A;  1WHL A;  1RUW A;  2AZV A;  1M1K R;  3H8Z A;  1K8A U;  1OV3 A;  2BIV A;  2E70 A;  4RTT A;  2R57 A;  3OSV A;  5GAN j;  3FJ5 A;  1Q81 C;  1KD1 C;  1D1A A;  2CP6 A;  1N27 A;  1N9S A;  4RTZ A;  2LT1 A;  1X01 A;  3CCQ T;  2CSQ A;  4LNP A;  3UA6 A;  3CPW P;  2EQU A;  2DL7 A;  2FPD A;  1GFC A;  4QQD A;  2QEX A;  3CC7 Q;  2JTE A;  4NS5 A;  3JCM c;  1YNZ A;  5A2Q E;  1Z9Z A;  3OYB A;  1U5S A;  2GTO A;  4M78 F;  4LXC A;  2E5Q A;  3RKY A;  3G1J A;  5IXB A;  2GTJ A;  2E6N A;  2QQS A;  1GXI E;  1PKT A;  3CCV Q;  1Q81 R;  1KD1 R;  3CXC S;  4ELZ C;  4IKF A;  3M0P A;  1EX4 A;  4XTU A;  3CBM A;  3R6O A;  2LT4 A;  3UAT A;  2COW A;  1SEM A;  3REB B;  5CKH A;  1PRL C;  3A1P A;  3DLL A;  3JRZ A;  4MML A;  2RI3 A;  4M77 F;  2DYI A;  1A0N B;  2LRQ A;  4GY5 A;  5CKE A;  3L2Z A;  1K1Z A;  1MGQ A;  8AT1 B;  1MUZ A;  3VUZ A;  3EG9 B;  3C95 A;  4PLL A;  1M1F A;  3SB2 A;  4OB1 B;  2LCS A;  1V1C A;  4J9E A;  2E12 A;  2GFA A;  4RCB A;  1RI9 A;  4C92 G;  4XU1 A;  5GAN 6;  2FYK A;  3CC4 T;  2KRM A;  1OU9 A;  3SHW A;  2M1H A;  3FJP A;  1PWT A;  2F5K A;  3V7S A;  1VQ8 T;  1WLP B;  5FU7 C;  3CCM Q;  1PD1 A;  2ROT A;  1K73 C;  3NHN A;  1M90 U;  5FW9 A;  5GAM d;  3QII A;  3I56 A;  4C5G A;  2E4H A;  1Q7Y R;  2DL5 A;  2FEI A;  4OMF B;  4AG1 C;  4B9X A;  3N5B B;  3EFS A;  1E6G A;  4ELY C;  1MNE A;  2F1L A;  5CAI A;  1XNI A;  1JQQ A;  3MEV A;  5KYN A;  3G6E Q;  3TSZ A;  3JSC A;  2LMJ A;  4II1 A;  2RK2 A;  4M4Z A;  1XTD A;  2LX9 A;  2P84 A;  1ZUK A;  1MMD A;  4F7U B;  3M0Q A;  1GL5 A;  1VQP T;  2L5Q A;  4YTL A;  1BBZ A;  4JS4 A;  4ZTJ A;  4HCK A;  4R56 A;  2VVK A;  4C8Q F;  3CC7 T;  2L8D A;  2QI2 A;  3CXC P;  5LJ3 j;  1GCQ C;  2FZK B;  3URG A;  5D2K A;  5GMK l;  1WNL A;  2QGG A;  1QQJ A;  4ZNX A;  3BFM A;  4M7A C;  2O01 E;  2BE9 B;  1MMG A;  1OYX A;  1CSK A;  2B8A A;  4HT8 A;  3X25 B;  2F2V A;  1BIA A;  1RLQ C;  2RHX A;  2PUO B;  4C0D C;  2GQI A;  1S1N A;  1JEG A;  3EH1 A;  2HQX A;  2RQW A;  2GFU A;  2CGH A;  3T9N A;  2RQT A;  2EJF A;  1ARK A;  3RR6 A;  3MET A;  1VQ5 Q;  2GCX A;  2K2M A;  3L2Q A;  3QDR B;  1MMA A;  4GBQ A;  5KE2 A;  4N4I A;  1VQ5 A;  1KQS P;  2KI7 A;  2VKN A;  1SHF A;  3UF4 A;  1VQL T;  2QTV A;  2MF2 A;  2KVQ G;  2QG9 B;  3OYY A;  3PVL A;  3THK A;  4EIK A;  2CH4 A;  3CPW S;  1QVF P;  4M7A F;  2HNI A;  2YHT A;  1YI2 Q;  4RTY A;  1Y71 A;  2AT1 B;  4UC4 A;  4DBQ A;  3RES A;  3CCL A;  4FW2 A;  2EYZ A;  3M55 A;  1SSH A;  3U23 A;  1R77 A;  3RIR A;  1I8F A;  4M7A A;  1PD0 A;  3VYG A;  2OAU A;  1VQM A;  2V1Q A;  3MP8 A;  4M75 G;  5A0D A;  2RA2 A;  1G3T A;  3LGL A;  2F5T X;  2EB5 A;  5GAM e;  2CP0 A;  1D09 B;  2KT1 A;  2QK0 A;  1VQ7 Q;  2A7Y A;  2ED1 A;  2O2O A;  4KUD K;  1T3L A;  2PZ1 A;  5GMK i;  3P8D A;  4JS5 A;  1VQ4 Q;  3CCV T;  3CMA T;  4K11 A;  2D0Q B;  2E1H A;  3CCS A;  2KRO A;  3M53 A;  3CXC A;  3UT1 A;  1VQM T;  3MEA A;  2A36 A;  3X26 B;  2VYT A;  2LNV A;  2OTJ T;  4JJB A;  3M54 A;  5LJ5 j;  2DM1 A;  2D8H A;  3NGP A;  3TRE A;  1SHG A;  2BKD N;  3G6E T;  2QQA A;  1BKB A;  2Q18 X;  3PMT A;  1Y0M A;  2M9U A;  3QBY A;  1G83 A;  2D9T A;  2PVD B;  1WHM A;  5D7U A;  5CVI A;  1HXD A;  1QWF A;  2DK3 A;  2E5K A;  3VJP A;  3PMI A;  5GAN 8;  4R55 A;  3JCM b;  4M78 A;  5DY9 A;  4PJO C;  2CP5 A;  5GAN 5;  4NL2 A;  1PHT A;  4ZGD B;  2ZPG B;  1VQ6 Q;  1QLY A;  4M75 A;  2LCL A;  2DEQ A;  2KMT A;  2P4R A;  4TVR A;  2IVW A;  1ZLM A;  2DVJ A;  2ZZD A;  1PSF A; 
#chains in the Genus database with same CATH homology
 5D2J A;  1HYO A;  5D2F A;  3BQB A;  3R6O A;  5D2I A;  2EB5 A;  2Q1A X;  5D2K A;  1QCO A;  2WQT A;  4MAQ A;  1QQJ A;  2Q19 X;  3QDF A;  1NKQ A;  1NR9 A;  2HZY A;  2Q1C X;  2Q1D X;  1SV6 A;  5D2H A;  3RR6 A;  2Q18 X;  4QKU A;  4DBH A;  1WZO A;  4PFZ A;  2EB6 A;  1I7O A;  2EB4 A;  3V77 A;  3S52 A;  4DBF A;  2DFU A;  3LZK A;  1GTT A;  1QCN A;  5D2G A;  1SAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...