2DFUA

Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
251
Chain Sequence
b'MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYRLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
publication title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 68
structure length 251
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.10: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 2dfuA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 2dfuA02
2Q1AX 1NR9A 4MAQA 5D2IA 5D2JA 1SAWA 5D2FA 2Q1DX 4DBFA 1WZOA 3V77A 1HYOA 2EB6A 1I7OA 5D2KA 2Q19X 3S52A 3BQBA 4PFZA 1QCNA 2EB4A 3LZKA 2Q18X 2Q1CX 5D2GA 4QKUA 1NKQA 1SV6A 1GTTA 3QDFA 3RR6A 3R6OA 2DFUA 2HZYA 2EB5A 2WQTA 4DBHA 5D2HA 1QCOA 1QQJA
chains in the Genus database with same CATH superfamily
3CPWS 2DTHA 4BDYA 2PQWA 3CBMA 2ZCFB 1G5VA 2KT1A 1NBEB 2EYZA 2PVDB 3MKDA 1YJ9A 4Z88A 3JV3A 3CXCA 3LH5A 1Q7YR 2XI9A 4DA4A 1MMNA 3G71Q 3EG1A 1PD1A 2D0QB 1V1CA 4PJOE 2LVMA 4O6JA 2MCNA 4C92D 1YHQA 4X34A 4QQ6A 3J81E 4J6XA 2HL3A 2L3SA 4HVUA 3I55Q 1UGRB 2DBMA 4KULA 4EPCA 1VQ5A 3HL8A 3JCMh 3EFOB 3HP9A 5CK9A 2H3JA 1Q81C 2DIGA 2K6DA 2RHIA 2Z0WA 2QI2A 3S3NA 5EG2A 2DNUA 1UJ0A 4XU2A 4DBHA 1AWOA 2KRSA 2HQXA 5I2MA 1YP5A 5DLOA 3PE0A 1QVFA 2RHZA 2DRKA 2X9HA 2V8KA 3ULRB 2GNCA 1Q86R 2LCSA 2VASA 3KFVA 4II1A 3RKYA 1K73U 2JUFA 3U23A 1YI2Q 2KEAA 1N27A 2JS0A 4L5GA 2RQRA 2RK2A 3ZFJA 1YBYA 3OYLA 5GMKe 3QWXX 1T3SA 3QKJA 2J6FA 3G1JA 1QMCA 1R8OB 5FU6C 1YITA 4J5YA 3C95A 2BIVA 1VQMA 1BIAA 4Y92A 4F7UE 1BI0A 3X25B 5LJ5f 4M77C 4BE0A 2HSEB 5D6XA 2Q19X 1WHJA 2EJFA 4PJJA 5AT1B 1N8RU 1PWTA 1JRIA 2E10A 5DLQE 1K1ZA 4EMKC 1AWWA 1B34B 1EFNA 4QVDA 3A1PA 3JB9H 3L2VA 2EBPA 4M7AA 5D2HA 4BY6C 5M9OA 3CCMA 2RA2A 1M1GA 1NR9A 1IGQA 5GANj 1BKBA 1G3SA 2A36A 1JJ2A 2QQAA 2OTLT 1BU1A 4M78C 2MIOA 3C12A 4OGCA 3OS5A 4M75F 1M2OA 1AWJA 2ZPGB 1WA7A 3CPWP 4M7DC 3JB9J 1R0CB 3JAME 1FWZA 4PJMA 4NS5A 3G7ZA 3VS5A 5HK0A 3VV0A 1AT1B 4PNOA 3OYJA 3CMAQ 2ZPIB 2K4YA 3H9NA 2EJ9A 2A3LA 1WHHA 3TSWA 2DD5A 1M9SA 2MPXC 2D8HA 3UA6A 4JS4A 2CP2A 5HK3A 2LQNA 2MK5A 4AFZC 2DFUA 4IKFA 1D0ZA 2KRNA 2LC4A 3H0IA 4BI8B 5GAOq 1MUZA 1X2QA 4DEXA 2GFAA 1ACMB 4RTYA 4J9HA 2X3XD 3S52A 2HQHA 5GANh 2RN8A 1EIFA 2FEIA 4F04B 2VC8A 1M3CA 4LNPA 5FLXE 1BBZA 1QQJA 2F2VA 2ATCB 3OYCA 3AT1B 2JTFA 2XHCA 3HFNA 3X24B 5GAMd 4ZN3A 1KK7A 4F16A 4C92G 4XTWA 4Z02A 2CUDA 2FHDA 1KD1C 3FIFA 2V26A 3FJPA 4KGZB 1KC8C 1VQLA 1SKUB 3GF5A 3HTRA 3V7RA 3EGXA 2C06A 3AHUA 5D2GA 3BDLA 4BACA 2JT4A 2LQWA 1FX7A 3EGUA 4EIKA 3L42A 1GTTA 2ZPFB 2HNIA 3HKSA 3EFSA 1AZGB 1K8AR 2EKHA 1G3WA 3CCEA 1MGQA 5FRMA 4AFSC 2L89A 2QEXA 2DK3A 1PRLC 1KG1A 4Z89A 1G2BA 2KYMA 1G3TA 4QQGA 2B86A 4LDYA 2WSFE 4CC3A 4LXCA 2FB7A 3V7SA 3DLLA 2JMCA 5GAOm 2EGAA 3GNFB 1X6OA 5D6WA 1BI3A 2JJ9A 4J7IA 3CCJA 3L2WA 1M1KC 4KGVB 1TUCA 4M77A 4BE1A 2K7AA 5GAMf 2DM1A 2AZVA 4XK8E 1GFDA 4J6YA 3CCLT 4XTXA 4CC4B 1M30A 2AKKA 4EMKA 1W70A 1EX4A 1ZBXA 2PTKA 2LNVA 3CCUT 4OB0B 1ZUYA 1VIFA 2O2OA 4AG1C 2OTLQ 2BZXA 2P84A 5CIUA 3KXTA 3OW2S 2QDYB 2OI3A 1U1SA 5GJWB 2K5FA 3OQ5A 2CYZB 2GCXA 4M78A 4MZTA 2NUPA 4P5NA 2O4XA 2X3WD 4JJNK 1X75C 1K0XA 4M7DA 1WQ7A 4JRPA 4RTUA 2MOXA 1UG1A 5D2JA 4OVAA 3CCQA 2EQUA 1VQOA 1HD3A 4XU3A 3M0PA 4FM4B 2O9SA 2X4YA 4BB7A 2DL7A 3EFRA 1RADB 2EQMA 4DOVA 2AZSA 1K73R 4M7AF 2OTJA 3OMCA 4FYVB 4M7AB 1IHWA 5GAOn 4HVVA 2QQ9A 5CKBA 1VQ8A 1N9RA 4NOYA 3JCMX 2L3QA 3NTIA 4OMLA 3EG9A 4BE2A 3T9NA 1O75A 2CKKA 1YWOA 3Q1JA 2PVOB 2EIFA 3G6ET 2RH2A 4N4GA 1QKWA 5C6SA 2LJ0A 2HCKA 4TVRA 3A8MB 2DVJA 2M0YA 1NPRA 1N8RR 2F5TX 1VQ9T 3MJXA 2E12A 4JS5A 3VRYA 1WHKA 3LZKA 1WJSA 3SDZA 1UDLA 1U5SA 4D6WA 3I9QA 3VUBA 2V8JA 2HZYA 4LDVA 3LYIA 3MP1A 2K3YA 3FB9A 1UTIA 4JJBA 2X51A 1VQ6Q 3M0RA 3OYYA 1MNDA 3CC7T 1ZA1B 2KSSA 3ER0A 3OYEA 1VYUA 1Y71A 2CREA 1Q81U 4XTZA 4M7AD 2HD0A 1WFWA 3M0QA 1W2BA 5IHKA 4QW2A 2RQVA 2DL5A 1FMWA 2HMAA 5GAMj 1JBMA 2LQ8A 2KXCA 5LJ3e 3E9GA 3L1AA 5J26A 4LD9K 2WSCE 3CMEA 1OZ2A 2XDBA 3OW2P 3CD6T 4PLLA 1MV3A 4X9CA 3CCLQ 5LJ5g 3NTHA 2HBPA 2K79A 1VQ7T 1U1TA 2EB4A 1MMAA 4QKUA 4BUGA 1Q82C 1UUEA 3CCUQ 1NE8A 2DEUA 4LUDA 1SRLA 3FJ5A 2GTJA 3GPLA 4KUIA 4EMHA 4PJNA 5GAN2 3FC3A 4CC2A 1K9MC 2XMFA 2YUQA 3E9FA 2LCCA 5HCKA 2EB6A 5LJ3d 1QCNA 3TVTA 4OGEA 1PNJA 1OU9A 2QK0A 3MEAA 5KE2A 2BE7D 3MP6A 3CCRT 2DZ9A 4WF2A 1Y7XA 3SWNC 4C5HA 3PGGA 1QP2A 2RB6A 2O31A 4FSXA 2LX7A 1PG5B 1FMKA 5GAMh 3OS2A 1S72T 2DXBA 1J3TA 4JJCA 4LDWA 5FU6B 4XTVA 2FZGB 3CCVT 4A4FA 2C0TA 2E41A 4MMLA 5FU7C 3MHXA 4RTXA 4CRIA 4M77F 3VYHB 3A8OB 4Y91A 4OB1B 1IREB 4OMMA 4C0ZA 2EQIA 4RTTA 3M57A 1UHFA 2JM8A 8ATCB 3G71A 1VQNA 3CC4T 4BY6B 2GQVA 3M4YA 3SFMA 2KQWA 2EW3A 1WJQA 2HKNA 4QQDA 3I55A 2F69A 1T3LA 1K0SA 4M78F 2G6FX 1NJIC 4M78B 2R58A 3QHSA 2NUPB 3OBYA 1VQ9Q 2DL3A 4FSSA 3RDVA 1PSFA 4M7DF 2LDMA 1VQKT 4M7DB 2ZPHB 2DZCA 3UDCA 2YRCA 3PT9A 4C5GA 1AOJA 3TU4K 2J06A 1YJWA 3OB9A 1YJ9T 5KYWB 2YSQA 3CC7Q 3VU3C 3OYNA 4F14A 2RPNA 4ZGDB 1KD1U 4Y28E 3WVDB 1KQSS 2AHJB 1YJNA 1M27C 1YHQT 3O8VA 4IUVA 3OYAA 1GCPA 2DYBA 2X4WA 3ASKA 2ZPBB 2KVQG 4HT8A 2DA9A 4XTUA 1GFCA 1N5ZA 1IGUA 2DO3A 2EB5A 5D6YA 1VQ5T 2QASA 2ZAEA 3CD6Q 4ZTJA 3RIRA 3VS6A 4M7AG 5LJ5e 2E65A 4MAQA 3P8DA 1QVFS 4E2FB 1VQ7Q 5DM7R 3NHNA 2DTIA 4F7UA 2NWMA 3CBPA 4A53A 1B07A 4HA8A 4JZ3A 4B9XA 1LPLA 3NMZC 2L2PA 1D0YA 3H6ZA 4M7DD 3OYHA 1M8VA 3M53A 1ARKA 2D0NA 1TSFA 3JRZA 1KSWA 2F2WA 2JNGA 3CQTA 1UB4A 2RNAA 2V1RA 1YITT 2ZZDA 3HRTA 4NL3A 3CCRQ 1FXXA 1VYTA 3JCMQ 2ROLA 1VQMT 4ZTFA 1Q86C 4O5VA 1RAIB 3MPUB 3EGDA 1I4K1 1S72Q 2CS7A 2A0FB 2Y90A 3SB2A 2CZ1B 2JM9A 3SWNA 3CCVQ 2RJEA 4FYWB 2G3RA 2Y4YA 2DBKA 3QDRB 4ZGJB 2E64A 3MEVA 3CCMT 4QT7A 1WLPB 3BE3A 1GBQA 4GLMA 5CKEA 1WYXA 2A08A 1NM7A 3BW1A 4J9IA 2A37A 1UGPB 3URGA 2L3RA 3X20B 3CPWA 3QXEB 3CC4Q 2RQWA 4XTYA 2CGHA 1Q81R 1K76A 3H8ZA 1WHMA 2E5KA 1WQWA 1AZEA 1I5OB 1NLPC 2FPFA 2F5KA 2IPOB 2EAYA 3WXMB 3EAEA 5CVIA 5CR2A 5A0LA 2LX9A 1VQKQ 1KQSP 1KJWA 4KH1B 3ZEHA 2DERA 4ZN1A 2RK1A 2QGFB 4J6WA 2KNBB 1RAAB 2QQSA 4JUVA 4K11A 3WVEB 2DAQA 5I11A 1M90C 1D3BA 2BE9B 1LCKA 4YTLA 1YJ9Q 3EG3A 3L2UA 4E47A 2RHUA 5J3BA 2CT4A 4M75B 1NEBA 4C8QC 4A54A 3I56T 1QP3A 2WSEE 4J9CA 1VQ4T 4CC7A 1YHQQ 5D2IA 1W6XA 1AWXA 2GQIA 4QVZA 2I2LA 3A5ZB 3C0CA 8AT1B 3QZ9B 1RAGB 1TU0B 3TQ7P 2EFIA 1I7OA 3QYHB 2P4RA 1WXTA 1VQ5Q 3TCJA 3J80E 2V1QA 1KFZA 3SHWA 4KH0B 4C92C 2VKNA 1Z9ZA 2RQTA 3OMGA 4Q5WA 2JMAA 3OYFA 3VUZA 4MDWA 3JCMg 4DQ2A 1AEYA 1OPLA 2CT3A 3MEUA 1MMGA 1IHVA 1PKTA 3CCET 1B7TA 2EJGA 2VGMA 2QEXT 2CDTA 2JOYA 4M78G 2M1HA 2KI7A 3I35A 2QTXA 3THKA 1I0CA 2J6OA 1YITQ 2LNHB 4M7DG 4M75D 1MHNA 2E6NA 3OYDA 4E7HA 4R56A 3FRNA 1BYMA 2L3PA 1VQMQ 4FT4A 1M5Q1 1K8AC 4M7AE 2M9UA 1KQ1A 1QVGS 4GLKA 5GAOp 4PKCC 1C6VX 3S3OA 5EC7A 2KDSA 1K9MU 3CCJT 1VQPA 2P0QA 1D1AA 2VUBA 4C0GA 3S6WA 1X2KA 2KMTA 3CCMQ 1RUWA 4JLIA 3META 3QG1A 5KYYA 3F70A 1VQ6T 3VYGA 3L2QA 4J9BA 2KY9A 2HEQA 4AFUC 1KD1R 5KYUA 3OYIA 4NL2A 2OX7A 2JS2A 1ZQ1A 1RAFB 4LUEA 4N4HA 3P8HA 4BD3A 1K9AA 2VV5A 1HJDA 2JW4A 3L2ZA 4EMGA 4FW2A 3CCQT 3M59A 5IHNA 4A63B 2X35A 1ZUKA 3D7SB 1VQOT 3EGDB 2YHTA 1BI1A 2GTOA 2P4TA 2KR3A 4AFQC 1QVPA 3SWNB 5IHIA 2HQEA 3RKWA 1CKAA 3QSUA 1X01A 2OAWA 5L8RE 2R57A 4PFZA 3I56Q 1U06A 2OTJT 5CKHA 1VQ4Q 2P0KA 3VKIA 2KT8A 1VQ8T 4C8QA 1RAEB 2LQKA 3QO3A 5D7UA 5A0GA 3OS0A 1LOJA 2RMOA 4DBFA 5GANg 4JRKA 5CAIA 3PIOA 2CZ6B 3E1SA 3JCMJ 4JRQA 2RD1A 3V8KA 1IZ6A 4OMFB 5KCOA 5I2SA 3QJ6A 2NUTA 3JCMe 3EH1A 5GMKm 3A98A 5GMKj 4FW1A 2DXCA 4C92A 5KE3A 3M4GA 5KYXA 4BI4A 5D2FA 2O9VA 3FDRA 3LW5E 1S1NA 4KGXB 2K2VA 3CCEQ 2QEXQ 3REAB 1RACB 2LT1A 1QVGP 4JLGA 4BDZA 2VB6A 4PJOC 2COZA 1D3BB 2O01E 3R6OA 1VUBA 2A28A 2E4HA 1C0MA 1ZSGA 3G4SA 4OF1A 2COYA 2FL7A 1GBRA 3OW2A 3DB4A 4M77E 1TWBA 2XU8A 1X27A 1Y96A 2RI5A 3PNWC 2KROA 3CMET 4M75G 1RI0A 3CCJQ 2RHYA 1SRMA 3UF4A 1P92A 3GOXA 3O5ZA 1D1BA 2R5MA 4ORZA 2Q1AX 4RCBA 5C0MA 3CCSA 1KQ2A 5GMKh 2KYBA 2FZKB 2K5IA 4L59A 4ESRA 1ZLMA 5GMKl 1QW1A 1YIJA 3QUIA 4M78E 3PVQA 1ZX6A 1NZ9A 4OMOA 1M4ZA 2QQRA 1X6BA 4JDSA 4M7DE 4D8KA 4HCBA 3PMTA 2BZYA 2HSPA 1V76A 2RF0A 4PJLA 3G6EA 1PC0A 4RTWA 3M54A 3OYBA 2VXEA 4HXJA 3CCQQ 2E5QA 3LGFA 1E6GA 1UFFA 1SEMA 2AT1B 2LMJA 3JCMb 1VQOQ 1RL2A 1UGVA 1Y57A 2M0OA 3EGXB 2GBQA 3QBYA 3I5SA 1AD5A 2QA4A 4IUUA 2LCLA 4JJDA 4LD6A 2RJCA 2PUKB 1SSFA 2OTJQ 2H3EB 2EQJA 2SRCA 4R55A 1HK9A 2BTTA 1QKXA 2ENMA 1VQ8Q 3TSZA 1PKSA 4IIOA 6AT1B 2IIMA 5GANe 1VQNT 3RMQA 4RMOA 1BCOA 5KYUB 1ZBJA 4HT9A 2CSQA 3OYKA 5KCHA 1Q82R 3H0HA 3UPUA 2RJFA 3MP8A 1M90U 1ZSZC 3LX7A 2FYKA 1N6AA 1WHGA 1T0JA 1K9MR 1CSKA 1NKQA 2QAZA 3N5BB 4FYYB 2K57A 4M77B 2JTMA 3CC2T 1WX6A 1NLOC 5GAN5 2WQTA 3REBB 2JN0A 5HY6A 2CP0A 2XG8D 2RI2A 4HCCA 4F17A 4LDUA 2LTOA 4HKEA 4EMKB 4E7ZA 3UWNA 2RM4A 2MI6A 2NLUA 4FCYA 4A4KA 2EYYA 2VYTA 2DL8A 4UC4A 3OY9A 3A8GB 1YJNT 3NPFA 1UGQB 4PJOA 2RJDA 5LJ3f 2HBWA 2O4XB 2F1LA 4C8QF 4C5IA 4C8QB 2JXBA 1WXUA 3CMEQ 2D6FA 3CXCS 2COWA 1S72A 1GL5A 3EHRA 1Q95G 3M0TA 3M9QA 2KXDA 2PUOB 4HCKA 2C0IA 2ROTA 4RKUE 1IXDA 2NUTB 1YI2A 1G83A 1B3QA 1M2VA 4M77D 4C92F 4C92B 1WI7A 5KYXB 1KC8U 2CZ0B 3VRZA 1MV0B 1M1FA 1TUDA 2K3XA 5GAN4 1F1BB 4RG8A 4DEYA 2OAUA 3QYGB 1D09B 1WXBA 4L6V5 1WDXA 2OJ2A 3EG9B 3RBBB 4C0FA 3JB9F 2EYWA 1JU5C 1Q7YC 1H641 2MAMA 4J9GA 1R77A 3JCMP 3BFMA 2DEQA 4RCCA 3V77A 1HXDA 4ZGEB 3MCAB 4GY5A 4M75E 4M78D 2EGEA 1SG5A 4LE9A 2KK4A 3OA6A 4N4IA 2L0AA 3NFCA 4ZNXA 4C8QD 5GMKi 1BB9A 2X4JA 4E7IA 2LZ6B 5AYFA 5GAMg 4N0AC 2DTOA 3VS4A 4MDXA 4E7KA 1RLQC 1XJWB 1QWEA 1XOVA 3DKMA 5CQXA 2EKOA 5ECAA 5GAN8 4J9DA 3MEWA 4MZPA 1IRXA 2AIRB 1YNZA 4JPBW 1H8KA 2XICA 1M1KU 3ZL7C 1OU8A 3ZBDA 2FPDA 1NPPA 1VQNQ 1QLYA 3M56A 5LJ5d 3IQLA 3CMAA 3OS1A 1AHJB 3OSVA 4BI3A 2DMOA 1KQSA 1BIBA 4ELZC 1JJ2S 2CH4W 3JB9D 3JCMc 1SSHA 3CC2Q 1ZSZA 2K3BA 1SF9A 2ED1A 5DY9A 1TTHB 3VS2A 3GBQA 1WJRA 1I8FA 1Z9QA 2FRYA 2MF2A 4A4GA 4X1VA 2DXTA 2JZ2A 2XIDA 2GF7A 5A2QE 3JCMW 1YJWQ 1KHIA 5LJ3j 2L8DA 3CXCP 1TG0A 4PL6A 3RESA 1I07A 3H0FA 3VS1A 1YJNQ 2Q1CX 3QIIA 1KIKA 4OB2B 1QCFA 2YDLA 3GLXA 3C94A 2GFUA 4IUQA 2VWFA 1SHFA 1RABB 5FWCA 1YN8A 3V8LA 4Z8AA 2X4XA 2CSIA 2R5AA 3BY7A 4OMQA 3TEEA 4C0DC 1IB8A 5IXBA 2NUZA 4E7JA 3LWIA 2DX1A 1GRIA 1QVFP 3DLMA 2PZ1A 5IXFA 1RLPC 5GAN6 2KGTA 1XQHA 1TUGB 2LJ3A 4WCIA 1JXOA 1HYOA 1O9SA 2DE0X 3JCMV 5D2KA 2ECZA 5LJ3h 1OX8A 4M77G 4AG2C 5CO7A 3UT1A 1M90R 2CP5A 2IVWA 4FYXB 1VQLT 4PJOF 4E7LA 4PJOB 2QTVA 4IUPA 1U8RA 4ELYC 1MNEA 1GCQC 5GAMe 3RERA 2NYSA 4DOWA 3E2UA 4DBRA 3J7AF 1XTDA 1VQPT 1OZ3A 2L5QA 1I5LA 3PVLA 1NYFA 4B9WA 2OTLA 1E7OA 4J9FA 2K9GA 1QCOA 5CKDA 2CP7A 2PVGB 4N0AA 3BDUA 2XK0A 2O88A 2PU9B 1G3YA 4C8QG 1JJ2P 1LJOA 3I56A 4ATOA 1TOVA 2FRWA 1M2VB 1VQ4A 3HSBA 1SHGA 1OOTA 4RTVA 5IT9E 1Q82U 2DJQA 2VGNA 5GJVB 4RG2A 2HL5C 4IUTA 2KE9A 2XDPA 4PK4A 1JEGA 1WIEA 4FT2A 2DYIA 3RMSA 2MYSA 3JSCA 2AK5A 2YXYA 4PJOD 2CP6A 4F7UF 4F7UB 4FL6A 3PFSA 2DILA 1N9SA 1YFNA 2DPPB 2FVUA 3HPWA 2M51A 3RR6A 2K2MA 4J8OA 1D0XA 1UGSB 3JB9G 2YUNA 1KC8R 1PRMC 3INZA 1UE9A 3QJYA 2ESWA 3LLRA 3RNJA 2B8AA 1BI2A 4J83A 2J05A 1WZOA 3ME9A 3SEMA 2EPDA 4XU0A 2W0ZA 5I22A 5LJ5j 3E19A 3FEOA 2EVRA 2E6ZA 5CKFA 1WGSA 5GAOr 2DVEA 4J9EA 5L23A 3CEYA 3QZ5B 3VS3A 1PHTA 3OSSC 3GIBA 5LJ3g 1LVKA 2EWNA 4KUDK 3VJPA 2KRMA 2WACA 2BZ8A 4E7SA 1QVGA 2IG0A 4XU1A 7AT1B 1NJIU 1VQ6A 1ZSZB 3X26B 1KHCA 1WNLA 1M1KR 5FU7B 3M55A 1OPKA 3V8JA 1FYNA 2QG9B 1JXMA 2KAFA 2LT4A 2QDLA 4KBMB 1BCMA 4KRTA 2F2XA 4PFOA 1Y07A 3A8HB 4XQ3A 1WPYA 3JB9I 1K73C 1U3OA 3H41A 3G4ST 2D1XA 5LJ5h 3OYMA 3R6NA 1VQLQ 3HRUA 1YWPA 1VYVA 2BUDA 2M02A 1X69A 3CCLA 5J39A 2J6KA 2GGRA 4AT1B 2Y4XA 2E70A 1NG2A 4M75C 5HKCA 2DXUA 2RI3A 4OB3B 2ED0A 1VQPQ 5A0DA 5GAOl 1ZA2B 3CCUA 1GCQA 1MMDA 5KYWA 1W2BS 3CPFA 3FLGA 5FWBA 4D8DA 3CCST 3M58A 1N8RC 1GXIE 1Q7YU 2I0NA 1YCYA 1YIJT 1JB0E 3S3MA 1X43A 2C0OA 2XKOC 2YRVA 3HHTB 1V29B 3JCMd 1OV3A 4KT0E 1W1FA 2Q18X 1OQKA 2FZCB 1UECA 4MMKA 2DLPA 2SEMA 2YLCA 1M3AA 2DL4A 1I1JA 2LP5A 1G8XA 2FO0A 4A4EA 1TS9A 3OBWA 3P8BB 2LRQA 3TREA 2YT6A 1C1AA 2QA4T 5GAN3 1Q86U 4C5EA 1SPKA 1PSEA 2JTEA 4C8QE 1ZHIA 3VS0A 1AVZC 3M0SA 1VOMA 4OMPA 1X6GA 2A7YA 4PJOG 4CI0C 1CKBA 5KH6A 4B6MA 2DETA 1OX9A 3EFOA 5KYNA 2KBTA 3KUFA 2MMPA 3C4SA 3MO8A 3UATA 4QVCA 2H8HA 4JZ4A 3EH2A 4R0KA 5LL6S 5GAN7 2YWWA 4EDUA 4RTZA 1JO8A 2ABLA 1VQ9A 3QDFA 4C92E 2D9TA 3X28B 1NEGA 3EG0A 3NGPA 3JCMf 2DJZA 3A8LB 2K5LA 1OYXA 2RHXA 3LH0A 4OMNA 9ATCB 3CBOA 2CUBA 1PCXA 1T0HA 1H3HA 4A4HA 1UEBA 4X9DA 5I21A 3CC7A 5KYYB 1E6HA 2QGGA 1LNXA 3I5RA 3HRSA 1VA7A 2YUPA 3G71T 2PNIA 3QPHA 3VS7A 3V7CA 1WHLA 1Y0MA 1IO6A 4VUBA 2RO0A 5IH2A 1SAWA 2Q1DX 1ZUUA 2JVVA 3I55T 2EQKA 3G4SQ 2EYXA 3LGLA 1VIEA 1W2BP 1B34A 4F7UG 4WTOB 5FRNA 3BQBA 2XD0A 4FIBA 1RAHB 4FU6A 3EHQA 2HKQB 3UA7A 3CD6A 4LDXA 1RI9A 2M16A 1VQ7A 3PMIA 2E1HA 1UJYA 2QYZA 2BKDN 1FMVA 1I81A 3EG2A 4GBQA 1BK2A 2EGCA 4MZMA 3RUXA 4ME7A 1YCSB 1PD0A 1TH7A 2CP3A 1YJWT 3CCSQ 4M75A 5GANd 2MWOA 4PFPA 2CZ7B 2CH4A 2E3IA 4JRIA 1YI2T 3RKXA 1YIJQ 1UHCA 1HSQA 2QQBA 3HFOA 1D1CA 2ZPEB 1W4SA 2HDAA 4C0DB 4J7FA 3PIPA 3CCRA 3KBGA 2YLBA 2DF6A 1NYGA 3G6EQ 4IURA 2YUOA 3DB3A 1OI1A 1DJ7B 4HCZA 2AKLA 1ABQA 4M7AC 3CCVA 1K4US 2E3HA 4PLIA 4ANJA 5CCAA 4E6RA 2VXFA 2V8IA 2DIQA 2RQUA 1A0NB 1R0BG 5IN1A 2DD4A 3M5AA 4XAXB 1EZZB 4IIMA 3LWHA 5FW9A 3NTKA 3PTAA 3CC2A 5FROA 4OP0A 2LJ1A 2ZGWA 2QA4Q 2MWPA 1XNIA 1K8AU 2HAXA 1NJIR 4LN2A 1M8MA 2YRDA 3M0UA 3CC4A 3GP8A 4HVWA 2W10A 1TXQA 2P0PA 4RUGA 2XDDA 5GANf 3OYGA 5CQYA 1H92A 1M3BA 3L2RA 3GNGA 1JQQA 2DKGA 2VVKA 1OEBA 2DRMA 2FG0A 2EYQA 4AMCA 1ABOA 3QWYA 3CMAT 2QXFA 2D8JA 4V2SA 1H3ZA 4DBQA 1VQKA 2J7IA 1PM3A 3SD4A 1QWFA 1Y96B 4M4ZA 1SV6A 5IAYA 2FPEA 1OULA
chains in the Genus database with same CATH topology
2Q1AX 1NR9A 4MAQA 5D2IA 5D2JA 1SAWA 5D2FA 2Q1DX 4DBFA 1WZOA 3V77A 1HYOA 2EB6A 1I7OA 5D2KA 2Q19X 3S52A 3BQBA 4PFZA 1QCNA 2EB4A 3LZKA 2Q18X 2Q1CX 5D2GA 4QKUA 1NKQA 1SV6A 1GTTA 3QDFA 3RR6A 3R6OA 2DFUA 2HZYA 2EB5A 2WQTA 4DBHA 5D2HA 1QCOA 1QQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1A X;  1NR9 A;  4MAQ A;  5D2I A;  5D2J A;  1SAW A;  5D2F A;  2Q1D X;  4DBF A;  1WZO A;  3V77 A;  1HYO A;  2EB6 A;  1I7O A;  5D2K A;  2Q19 X;  3S52 A;  3BQB A;  4PFZ A;  1QCN A;  2EB4 A;  3LZK A;  2Q18 X;  2Q1C X;  5D2G A;  4QKU A;  1NKQ A;  1SV6 A;  1GTT A;  3QDF A;  3RR6 A;  3R6O A;  2DFU A;  2HZY A;  2EB5 A;  2WQT A;  4DBH A;  5D2H A;  1QCO A;  1QQJ A; 
#chains in the Genus database with same CATH topology
 3CPW S;  2DTH A;  4BDY A;  2PQW A;  3CBM A;  2ZCF B;  1G5V A;  2KT1 A;  1NBE B;  2EYZ A;  2PVD B;  3MKD A;  1YJ9 A;  4Z88 A;  3JV3 A;  3CXC A;  3LH5 A;  1Q7Y R;  2XI9 A;  4DA4 A;  1MMN A;  3G71 Q;  3EG1 A;  1PD1 A;  2D0Q B;  1V1C A;  4PJO E;  2LVM A;  4O6J A;  2MCN A;  4C92 D;  1YHQ A;  4X34 A;  4QQ6 A;  3J81 E;  4J6X A;  2HL3 A;  2L3S A;  4HVU A;  3I55 Q;  1UGR B;  2DBM A;  4KUL A;  4EPC A;  1VQ5 A;  3HL8 A;  3JCM h;  3EFO B;  3HP9 A;  5CK9 A;  2H3J A;  1Q81 C;  2DIG A;  2K6D A;  2RHI A;  2Z0W A;  2QI2 A;  3S3N A;  5EG2 A;  2DNU A;  1UJ0 A;  4XU2 A;  4DBH A;  1AWO A;  2KRS A;  2HQX A;  5I2M A;  1YP5 A;  5DLO A;  3PE0 A;  1QVF A;  2RHZ A;  2DRK A;  2X9H A;  2V8K A;  3ULR B;  2GNC A;  1Q86 R;  2LCS A;  2VAS A;  3KFV A;  4II1 A;  3RKY A;  1K73 U;  2JUF A;  3U23 A;  1YI2 Q;  2KEA A;  1N27 A;  2JS0 A;  4L5G A;  2RQR A;  2RK2 A;  3ZFJ A;  1YBY A;  3OYL A;  5GMK e;  3QWX X;  1T3S A;  3QKJ A;  2J6F A;  3G1J A;  1QMC A;  1R8O B;  5FU6 C;  1YIT A;  4J5Y A;  3C95 A;  2BIV A;  1VQM A;  1BIA A;  4Y92 A;  4F7U E;  1BI0 A;  3X25 B;  5LJ5 f;  4M77 C;  4BE0 A;  2HSE B;  5D6X A;  2Q19 X;  1WHJ A;  2EJF A;  4PJJ A;  5AT1 B;  1N8R U;  1PWT A;  1JRI A;  2E10 A;  5DLQ E;  1K1Z A;  4EMK C;  1AWW A;  1B34 B;  1EFN A;  4QVD A;  3A1P A;  3JB9 H;  3L2V A;  2EBP A;  4M7A A;  5D2H A;  4BY6 C;  5M9O A;  3CCM A;  2RA2 A;  1M1G A;  1NR9 A;  1IGQ A;  5GAN j;  1BKB A;  1G3S A;  2A36 A;  1JJ2 A;  2QQA A;  2OTL T;  1BU1 A;  4M78 C;  2MIO A;  3C12 A;  4OGC A;  3OS5 A;  4M75 F;  1M2O A;  1AWJ A;  2ZPG B;  1WA7 A;  3CPW P;  4M7D C;  3JB9 J;  1R0C B;  3JAM E;  1FWZ A;  4PJM A;  4NS5 A;  3G7Z A;  3VS5 A;  5HK0 A;  3VV0 A;  1AT1 B;  4PNO A;  3OYJ A;  3CMA Q;  2ZPI B;  2K4Y A;  3H9N A;  2EJ9 A;  2A3L A;  1WHH A;  3TSW A;  2DD5 A;  1M9S A;  2MPX C;  2D8H A;  3UA6 A;  4JS4 A;  2CP2 A;  5HK3 A;  2LQN A;  2MK5 A;  4AFZ C;  2DFU A;  4IKF A;  1D0Z A;  2KRN A;  2LC4 A;  3H0I A;  4BI8 B;  5GAO q;  1MUZ A;  1X2Q A;  4DEX A;  2GFA A;  1ACM B;  4RTY A;  4J9H A;  2X3X D;  3S52 A;  2HQH A;  5GAN h;  2RN8 A;  1EIF A;  2FEI A;  4F04 B;  2VC8 A;  1M3C A;  4LNP A;  5FLX E;  1BBZ A;  1QQJ A;  2F2V A;  2ATC B;  3OYC A;  3AT1 B;  2JTF A;  2XHC A;  3HFN A;  3X24 B;  5GAM d;  4ZN3 A;  1KK7 A;  4F16 A;  4C92 G;  4XTW A;  4Z02 A;  2CUD A;  2FHD A;  1KD1 C;  3FIF A;  2V26 A;  3FJP A;  4KGZ B;  1KC8 C;  1VQL A;  1SKU B;  3GF5 A;  3HTR A;  3V7R A;  3EGX A;  2C06 A;  3AHU A;  5D2G A;  3BDL A;  4BAC A;  2JT4 A;  2LQW A;  1FX7 A;  3EGU A;  4EIK A;  3L42 A;  1GTT A;  2ZPF B;  2HNI A;  3HKS A;  3EFS A;  1AZG B;  1K8A R;  2EKH A;  1G3W A;  3CCE A;  1MGQ A;  5FRM A;  4AFS C;  2L89 A;  2QEX A;  2DK3 A;  1PRL C;  1KG1 A;  4Z89 A;  1G2B A;  2KYM A;  1G3T A;  4QQG A;  2B86 A;  4LDY A;  2WSF E;  4CC3 A;  4LXC A;  2FB7 A;  3V7S A;  3DLL A;  2JMC A;  5GAO m;  2EGA A;  3GNF B;  1X6O A;  5D6W A;  1BI3 A;  2JJ9 A;  4J7I A;  3CCJ A;  3L2W A;  1M1K C;  4KGV B;  1TUC A;  4M77 A;  4BE1 A;  2K7A A;  5GAM f;  2DM1 A;  2AZV A;  4XK8 E;  1GFD A;  4J6Y A;  3CCL T;  4XTX A;  4CC4 B;  1M30 A;  2AKK A;  4EMK A;  1W70 A;  1EX4 A;  1ZBX A;  2PTK A;  2LNV A;  3CCU T;  4OB0 B;  1ZUY A;  1VIF A;  2O2O A;  4AG1 C;  2OTL Q;  2BZX A;  2P84 A;  5CIU A;  3KXT A;  3OW2 S;  2QDY B;  2OI3 A;  1U1S A;  5GJW B;  2K5F A;  3OQ5 A;  2CYZ B;  2GCX A;  4M78 A;  4MZT A;  2NUP A;  4P5N A;  2O4X A;  2X3W D;  4JJN K;  1X75 C;  1K0X A;  4M7D A;  1WQ7 A;  4JRP A;  4RTU A;  2MOX A;  1UG1 A;  5D2J A;  4OVA A;  3CCQ A;  2EQU A;  1VQO A;  1HD3 A;  4XU3 A;  3M0P A;  4FM4 B;  2O9S A;  2X4Y A;  4BB7 A;  2DL7 A;  3EFR A;  1RAD B;  2EQM A;  4DOV A;  2AZS A;  1K73 R;  4M7A F;  2OTJ A;  3OMC A;  4FYV B;  4M7A B;  1IHW A;  5GAO n;  4HVV A;  2QQ9 A;  5CKB A;  1VQ8 A;  1N9R A;  4NOY A;  3JCM X;  2L3Q A;  3NTI A;  4OML A;  3EG9 A;  4BE2 A;  3T9N A;  1O75 A;  2CKK A;  1YWO A;  3Q1J A;  2PVO B;  2EIF A;  3G6E T;  2RH2 A;  4N4G A;  1QKW A;  5C6S A;  2LJ0 A;  2HCK A;  4TVR A;  3A8M B;  2DVJ A;  2M0Y A;  1NPR A;  1N8R R;  2F5T X;  1VQ9 T;  3MJX A;  2E12 A;  4JS5 A;  3VRY A;  1WHK A;  3LZK A;  1WJS A;  3SDZ A;  1UDL A;  1U5S A;  4D6W A;  3I9Q A;  3VUB A;  2V8J A;  2HZY A;  4LDV A;  3LYI A;  3MP1 A;  2K3Y A;  3FB9 A;  1UTI A;  4JJB A;  2X51 A;  1VQ6 Q;  3M0R A;  3OYY A;  1MND A;  3CC7 T;  1ZA1 B;  2KSS A;  3ER0 A;  3OYE A;  1VYU A;  1Y71 A;  2CRE A;  1Q81 U;  4XTZ A;  4M7A D;  2HD0 A;  1WFW A;  3M0Q A;  1W2B A;  5IHK A;  4QW2 A;  2RQV A;  2DL5 A;  1FMW A;  2HMA A;  5GAM j;  1JBM A;  2LQ8 A;  2KXC A;  5LJ3 e;  3E9G A;  3L1A A;  5J26 A;  4LD9 K;  2WSC E;  3CME A;  1OZ2 A;  2XDB A;  3OW2 P;  3CD6 T;  4PLL A;  1MV3 A;  4X9C A;  3CCL Q;  5LJ5 g;  3NTH A;  2HBP A;  2K79 A;  1VQ7 T;  1U1T A;  2EB4 A;  1MMA A;  4QKU A;  4BUG A;  1Q82 C;  1UUE A;  3CCU Q;  1NE8 A;  2DEU A;  4LUD A;  1SRL A;  3FJ5 A;  2GTJ A;  3GPL A;  4KUI A;  4EMH A;  4PJN A;  5GAN 2;  3FC3 A;  4CC2 A;  1K9M C;  2XMF A;  2YUQ A;  3E9F A;  2LCC A;  5HCK A;  2EB6 A;  5LJ3 d;  1QCN A;  3TVT A;  4OGE A;  1PNJ A;  1OU9 A;  2QK0 A;  3MEA A;  5KE2 A;  2BE7 D;  3MP6 A;  3CCR T;  2DZ9 A;  4WF2 A;  1Y7X A;  3SWN C;  4C5H A;  3PGG A;  1QP2 A;  2RB6 A;  2O31 A;  4FSX A;  2LX7 A;  1PG5 B;  1FMK A;  5GAM h;  3OS2 A;  1S72 T;  2DXB A;  1J3T A;  4JJC A;  4LDW A;  5FU6 B;  4XTV A;  2FZG B;  3CCV T;  4A4F A;  2C0T A;  2E41 A;  4MML A;  5FU7 C;  3MHX A;  4RTX A;  4CRI A;  4M77 F;  3VYH B;  3A8O B;  4Y91 A;  4OB1 B;  1IRE B;  4OMM A;  4C0Z A;  2EQI A;  4RTT A;  3M57 A;  1UHF A;  2JM8 A;  8ATC B;  3G71 A;  1VQN A;  3CC4 T;  4BY6 B;  2GQV A;  3M4Y A;  3SFM A;  2KQW A;  2EW3 A;  1WJQ A;  2HKN A;  4QQD A;  3I55 A;  2F69 A;  1T3L A;  1K0S A;  4M78 F;  2G6F X;  1NJI C;  4M78 B;  2R58 A;  3QHS A;  2NUP B;  3OBY A;  1VQ9 Q;  2DL3 A;  4FSS A;  3RDV A;  1PSF A;  4M7D F;  2LDM A;  1VQK T;  4M7D B;  2ZPH B;  2DZC A;  3UDC A;  2YRC A;  3PT9 A;  4C5G A;  1AOJ A;  3TU4 K;  2J06 A;  1YJW A;  3OB9 A;  1YJ9 T;  5KYW B;  2YSQ A;  3CC7 Q;  3VU3 C;  3OYN A;  4F14 A;  2RPN A;  4ZGD B;  1KD1 U;  4Y28 E;  3WVD B;  1KQS S;  2AHJ B;  1YJN A;  1M27 C;  1YHQ T;  3O8V A;  4IUV A;  3OYA A;  1GCP A;  2DYB A;  2X4W A;  3ASK A;  2ZPB B;  2KVQ G;  4HT8 A;  2DA9 A;  4XTU A;  1GFC A;  1N5Z A;  1IGU A;  2DO3 A;  2EB5 A;  5D6Y A;  1VQ5 T;  2QAS A;  2ZAE A;  3CD6 Q;  4ZTJ A;  3RIR A;  3VS6 A;  4M7A G;  5LJ5 e;  2E65 A;  4MAQ A;  3P8D A;  1QVF S;  4E2F B;  1VQ7 Q;  5DM7 R;  3NHN A;  2DTI A;  4F7U A;  2NWM A;  3CBP A;  4A53 A;  1B07 A;  4HA8 A;  4JZ3 A;  4B9X A;  1LPL A;  3NMZ C;  2L2P A;  1D0Y A;  3H6Z A;  4M7D D;  3OYH A;  1M8V A;  3M53 A;  1ARK A;  2D0N A;  1TSF A;  3JRZ A;  1KSW A;  2F2W A;  2JNG A;  3CQT A;  1UB4 A;  2RNA A;  2V1R A;  1YIT T;  2ZZD A;  3HRT A;  4NL3 A;  3CCR Q;  1FXX A;  1VYT A;  3JCM Q;  2ROL A;  1VQM T;  4ZTF A;  1Q86 C;  4O5V A;  1RAI B;  3MPU B;  3EGD A;  1I4K 1;  1S72 Q;  2CS7 A;  2A0F B;  2Y90 A;  3SB2 A;  2CZ1 B;  2JM9 A;  3SWN A;  3CCV Q;  2RJE A;  4FYW B;  2G3R A;  2Y4Y A;  2DBK A;  3QDR B;  4ZGJ B;  2E64 A;  3MEV A;  3CCM T;  4QT7 A;  1WLP B;  3BE3 A;  1GBQ A;  4GLM A;  5CKE A;  1WYX A;  2A08 A;  1NM7 A;  3BW1 A;  4J9I A;  2A37 A;  1UGP B;  3URG A;  2L3R A;  3X20 B;  3CPW A;  3QXE B;  3CC4 Q;  2RQW A;  4XTY A;  2CGH A;  1Q81 R;  1K76 A;  3H8Z A;  1WHM A;  2E5K A;  1WQW A;  1AZE A;  1I5O B;  1NLP C;  2FPF A;  2F5K A;  2IPO B;  2EAY A;  3WXM B;  3EAE A;  5CVI A;  5CR2 A;  5A0L A;  2LX9 A;  1VQK Q;  1KQS P;  1KJW A;  4KH1 B;  3ZEH A;  2DER A;  4ZN1 A;  2RK1 A;  2QGF B;  4J6W A;  2KNB B;  1RAA B;  2QQS A;  4JUV A;  4K11 A;  3WVE B;  2DAQ A;  5I11 A;  1M90 C;  1D3B A;  2BE9 B;  1LCK A;  4YTL A;  1YJ9 Q;  3EG3 A;  3L2U A;  4E47 A;  2RHU A;  5J3B A;  2CT4 A;  4M75 B;  1NEB A;  4C8Q C;  4A54 A;  3I56 T;  1QP3 A;  2WSE E;  4J9C A;  1VQ4 T;  4CC7 A;  1YHQ Q;  5D2I A;  1W6X A;  1AWX A;  2GQI A;  4QVZ A;  2I2L A;  3A5Z B;  3C0C A;  8AT1 B;  3QZ9 B;  1RAG B;  1TU0 B;  3TQ7 P;  2EFI A;  1I7O A;  3QYH B;  2P4R A;  1WXT A;  1VQ5 Q;  3TCJ A;  3J80 E;  2V1Q A;  1KFZ A;  3SHW A;  4KH0 B;  4C92 C;  2VKN A;  1Z9Z A;  2RQT A;  3OMG A;  4Q5W A;  2JMA A;  3OYF A;  3VUZ A;  4MDW A;  3JCM g;  4DQ2 A;  1AEY A;  1OPL A;  2CT3 A;  3MEU A;  1MMG A;  1IHV A;  1PKT A;  3CCE T;  1B7T A;  2EJG A;  2VGM A;  2QEX T;  2CDT A;  2JOY A;  4M78 G;  2M1H A;  2KI7 A;  3I35 A;  2QTX A;  3THK A;  1I0C A;  2J6O A;  1YIT Q;  2LNH B;  4M7D G;  4M75 D;  1MHN A;  2E6N A;  3OYD A;  4E7H A;  4R56 A;  3FRN A;  1BYM A;  2L3P A;  1VQM Q;  4FT4 A;  1M5Q 1;  1K8A C;  4M7A E;  2M9U A;  1KQ1 A;  1QVG S;  4GLK A;  5GAO p;  4PKC C;  1C6V X;  3S3O A;  5EC7 A;  2KDS A;  1K9M U;  3CCJ T;  1VQP A;  2P0Q A;  1D1A A;  2VUB A;  4C0G A;  3S6W A;  1X2K A;  2KMT A;  3CCM Q;  1RUW A;  4JLI A;  3MET A;  3QG1 A;  5KYY A;  3F70 A;  1VQ6 T;  3VYG A;  3L2Q A;  4J9B A;  2KY9 A;  2HEQ A;  4AFU C;  1KD1 R;  5KYU A;  3OYI A;  4NL2 A;  2OX7 A;  2JS2 A;  1ZQ1 A;  1RAF B;  4LUE A;  4N4H A;  3P8H A;  4BD3 A;  1K9A A;  2VV5 A;  1HJD A;  2JW4 A;  3L2Z A;  4EMG A;  4FW2 A;  3CCQ T;  3M59 A;  5IHN A;  4A63 B;  2X35 A;  1ZUK A;  3D7S B;  1VQO T;  3EGD B;  2YHT A;  1BI1 A;  2GTO A;  2P4T A;  2KR3 A;  4AFQ C;  1QVP A;  3SWN B;  5IHI A;  2HQE A;  3RKW A;  1CKA A;  3QSU A;  1X01 A;  2OAW A;  5L8R E;  2R57 A;  4PFZ A;  3I56 Q;  1U06 A;  2OTJ T;  5CKH A;  1VQ4 Q;  2P0K A;  3VKI A;  2KT8 A;  1VQ8 T;  4C8Q A;  1RAE B;  2LQK A;  3QO3 A;  5D7U A;  5A0G A;  3OS0 A;  1LOJ A;  2RMO A;  4DBF A;  5GAN g;  4JRK A;  5CAI A;  3PIO A;  2CZ6 B;  3E1S A;  3JCM J;  4JRQ A;  2RD1 A;  3V8K A;  1IZ6 A;  4OMF B;  5KCO A;  5I2S A;  3QJ6 A;  2NUT A;  3JCM e;  3EH1 A;  5GMK m;  3A98 A;  5GMK j;  4FW1 A;  2DXC A;  4C92 A;  5KE3 A;  3M4G A;  5KYX A;  4BI4 A;  5D2F A;  2O9V A;  3FDR A;  3LW5 E;  1S1N A;  4KGX B;  2K2V A;  3CCE Q;  2QEX Q;  3REA B;  1RAC B;  2LT1 A;  1QVG P;  4JLG A;  4BDZ A;  2VB6 A;  4PJO C;  2COZ A;  1D3B B;  2O01 E;  3R6O A;  1VUB A;  2A28 A;  2E4H A;  1C0M A;  1ZSG A;  3G4S A;  4OF1 A;  2COY A;  2FL7 A;  1GBR A;  3OW2 A;  3DB4 A;  4M77 E;  1TWB A;  2XU8 A;  1X27 A;  1Y96 A;  2RI5 A;  3PNW C;  2KRO A;  3CME T;  4M75 G;  1RI0 A;  3CCJ Q;  2RHY A;  1SRM A;  3UF4 A;  1P92 A;  3GOX A;  3O5Z A;  1D1B A;  2R5M A;  4ORZ A;  2Q1A X;  4RCB A;  5C0M A;  3CCS A;  1KQ2 A;  5GMK h;  2KYB A;  2FZK B;  2K5I A;  4L59 A;  4ESR A;  1ZLM A;  5GMK l;  1QW1 A;  1YIJ A;  3QUI A;  4M78 E;  3PVQ A;  1ZX6 A;  1NZ9 A;  4OMO A;  1M4Z A;  2QQR A;  1X6B A;  4JDS A;  4M7D E;  4D8K A;  4HCB A;  3PMT A;  2BZY A;  2HSP A;  1V76 A;  2RF0 A;  4PJL A;  3G6E A;  1PC0 A;  4RTW A;  3M54 A;  3OYB A;  2VXE A;  4HXJ A;  3CCQ Q;  2E5Q A;  3LGF A;  1E6G A;  1UFF A;  1SEM A;  2AT1 B;  2LMJ A;  3JCM b;  1VQO Q;  1RL2 A;  1UGV A;  1Y57 A;  2M0O A;  3EGX B;  2GBQ A;  3QBY A;  3I5S A;  1AD5 A;  2QA4 A;  4IUU A;  2LCL A;  4JJD A;  4LD6 A;  2RJC A;  2PUK B;  1SSF A;  2OTJ Q;  2H3E B;  2EQJ A;  2SRC A;  4R55 A;  1HK9 A;  2BTT A;  1QKX A;  2ENM A;  1VQ8 Q;  3TSZ A;  1PKS A;  4IIO A;  6AT1 B;  2IIM A;  5GAN e;  1VQN T;  3RMQ A;  4RMO A;  1BCO A;  5KYU B;  1ZBJ A;  4HT9 A;  2CSQ A;  3OYK A;  5KCH A;  1Q82 R;  3H0H A;  3UPU A;  2RJF A;  3MP8 A;  1M90 U;  1ZSZ C;  3LX7 A;  2FYK A;  1N6A A;  1WHG A;  1T0J A;  1K9M R;  1CSK A;  1NKQ A;  2QAZ A;  3N5B B;  4FYY B;  2K57 A;  4M77 B;  2JTM A;  3CC2 T;  1WX6 A;  1NLO C;  5GAN 5;  2WQT A;  3REB B;  2JN0 A;  5HY6 A;  2CP0 A;  2XG8 D;  2RI2 A;  4HCC A;  4F17 A;  4LDU A;  2LTO A;  4HKE A;  4EMK B;  4E7Z A;  3UWN A;  2RM4 A;  2MI6 A;  2NLU A;  4FCY A;  4A4K A;  2EYY A;  2VYT A;  2DL8 A;  4UC4 A;  3OY9 A;  3A8G B;  1YJN T;  3NPF A;  1UGQ B;  4PJO A;  2RJD A;  5LJ3 f;  2HBW A;  2O4X B;  2F1L A;  4C8Q F;  4C5I A;  4C8Q B;  2JXB A;  1WXU A;  3CME Q;  2D6F A;  3CXC S;  2COW A;  1S72 A;  1GL5 A;  3EHR A;  1Q95 G;  3M0T A;  3M9Q A;  2KXD A;  2PUO B;  4HCK A;  2C0I A;  2ROT A;  4RKU E;  1IXD A;  2NUT B;  1YI2 A;  1G83 A;  1B3Q A;  1M2V A;  4M77 D;  4C92 F;  4C92 B;  1WI7 A;  5KYX B;  1KC8 U;  2CZ0 B;  3VRZ A;  1MV0 B;  1M1F A;  1TUD A;  2K3X A;  5GAN 4;  1F1B B;  4RG8 A;  4DEY A;  2OAU A;  3QYG B;  1D09 B;  1WXB A;  4L6V 5;  1WDX A;  2OJ2 A;  3EG9 B;  3RBB B;  4C0F A;  3JB9 F;  2EYW A;  1JU5 C;  1Q7Y C;  1H64 1;  2MAM A;  4J9G A;  1R77 A;  3JCM P;  3BFM A;  2DEQ A;  4RCC A;  3V77 A;  1HXD A;  4ZGE B;  3MCA B;  4GY5 A;  4M75 E;  4M78 D;  2EGE A;  1SG5 A;  4LE9 A;  2KK4 A;  3OA6 A;  4N4I A;  2L0A A;  3NFC A;  4ZNX A;  4C8Q D;  5GMK i;  1BB9 A;  2X4J A;  4E7I A;  2LZ6 B;  5AYF A;  5GAM g;  4N0A C;  2DTO A;  3VS4 A;  4MDX A;  4E7K A;  1RLQ C;  1XJW B;  1QWE A;  1XOV A;  3DKM A;  5CQX A;  2EKO A;  5ECA A;  5GAN 8;  4J9D A;  3MEW A;  4MZP A;  1IRX A;  2AIR B;  1YNZ A;  4JPB W;  1H8K A;  2XIC A;  1M1K U;  3ZL7 C;  1OU8 A;  3ZBD A;  2FPD A;  1NPP A;  1VQN Q;  1QLY A;  3M56 A;  5LJ5 d;  3IQL A;  3CMA A;  3OS1 A;  1AHJ B;  3OSV A;  4BI3 A;  2DMO A;  1KQS A;  1BIB A;  4ELZ C;  1JJ2 S;  2CH4 W;  3JB9 D;  3JCM c;  1SSH A;  3CC2 Q;  1ZSZ A;  2K3B A;  1SF9 A;  2ED1 A;  5DY9 A;  1TTH B;  3VS2 A;  3GBQ A;  1WJR A;  1I8F A;  1Z9Q A;  2FRY A;  2MF2 A;  4A4G A;  4X1V A;  2DXT A;  2JZ2 A;  2XID A;  2GF7 A;  5A2Q E;  3JCM W;  1YJW Q;  1KHI A;  5LJ3 j;  2L8D A;  3CXC P;  1TG0 A;  4PL6 A;  3RES A;  1I07 A;  3H0F A;  3VS1 A;  1YJN Q;  2Q1C X;  3QII A;  1KIK A;  4OB2 B;  1QCF A;  2YDL A;  3GLX A;  3C94 A;  2GFU A;  4IUQ A;  2VWF A;  1SHF A;  1RAB B;  5FWC A;  1YN8 A;  3V8L A;  4Z8A A;  2X4X A;  2CSI A;  2R5A A;  3BY7 A;  4OMQ A;  3TEE A;  4C0D C;  1IB8 A;  5IXB A;  2NUZ A;  4E7J A;  3LWI A;  2DX1 A;  1GRI A;  1QVF P;  3DLM A;  2PZ1 A;  5IXF A;  1RLP C;  5GAN 6;  2KGT A;  1XQH A;  1TUG B;  2LJ3 A;  4WCI A;  1JXO A;  1HYO A;  1O9S A;  2DE0 X;  3JCM V;  5D2K A;  2ECZ A;  5LJ3 h;  1OX8 A;  4M77 G;  4AG2 C;  5CO7 A;  3UT1 A;  1M90 R;  2CP5 A;  2IVW A;  4FYX B;  1VQL T;  4PJO F;  4E7L A;  4PJO B;  2QTV A;  4IUP A;  1U8R A;  4ELY C;  1MNE A;  1GCQ C;  5GAM e;  3RER A;  2NYS A;  4DOW A;  3E2U A;  4DBR A;  3J7A F;  1XTD A;  1VQP T;  1OZ3 A;  2L5Q A;  1I5L A;  3PVL A;  1NYF A;  4B9W A;  2OTL A;  1E7O A;  4J9F A;  2K9G A;  1QCO A;  5CKD A;  2CP7 A;  2PVG B;  4N0A A;  3BDU A;  2XK0 A;  2O88 A;  2PU9 B;  1G3Y A;  4C8Q G;  1JJ2 P;  1LJO A;  3I56 A;  4ATO A;  1TOV A;  2FRW A;  1M2V B;  1VQ4 A;  3HSB A;  1SHG A;  1OOT A;  4RTV A;  5IT9 E;  1Q82 U;  2DJQ A;  2VGN A;  5GJV B;  4RG2 A;  2HL5 C;  4IUT A;  2KE9 A;  2XDP A;  4PK4 A;  1JEG A;  1WIE A;  4FT2 A;  2DYI A;  3RMS A;  2MYS A;  3JSC A;  2AK5 A;  2YXY A;  4PJO D;  2CP6 A;  4F7U F;  4F7U B;  4FL6 A;  3PFS A;  2DIL A;  1N9S A;  1YFN A;  2DPP B;  2FVU A;  3HPW A;  2M51 A;  3RR6 A;  2K2M A;  4J8O A;  1D0X A;  1UGS B;  3JB9 G;  2YUN A;  1KC8 R;  1PRM C;  3INZ A;  1UE9 A;  3QJY A;  2ESW A;  3LLR A;  3RNJ A;  2B8A A;  1BI2 A;  4J83 A;  2J05 A;  1WZO A;  3ME9 A;  3SEM A;  2EPD A;  4XU0 A;  2W0Z A;  5I22 A;  5LJ5 j;  3E19 A;  3FEO A;  2EVR A;  2E6Z A;  5CKF A;  1WGS A;  5GAO r;  2DVE A;  4J9E A;  5L23 A;  3CEY A;  3QZ5 B;  3VS3 A;  1PHT A;  3OSS C;  3GIB A;  5LJ3 g;  1LVK A;  2EWN A;  4KUD K;  3VJP A;  2KRM A;  2WAC A;  2BZ8 A;  4E7S A;  1QVG A;  2IG0 A;  4XU1 A;  7AT1 B;  1NJI U;  1VQ6 A;  1ZSZ B;  3X26 B;  1KHC A;  1WNL A;  1M1K R;  5FU7 B;  3M55 A;  1OPK A;  3V8J A;  1FYN A;  2QG9 B;  1JXM A;  2KAF A;  2LT4 A;  2QDL A;  4KBM B;  1BCM A;  4KRT A;  2F2X A;  4PFO A;  1Y07 A;  3A8H B;  4XQ3 A;  1WPY A;  3JB9 I;  1K73 C;  1U3O A;  3H41 A;  3G4S T;  2D1X A;  5LJ5 h;  3OYM A;  3R6N A;  1VQL Q;  3HRU A;  1YWP A;  1VYV A;  2BUD A;  2M02 A;  1X69 A;  3CCL A;  5J39 A;  2J6K A;  2GGR A;  4AT1 B;  2Y4X A;  2E70 A;  1NG2 A;  4M75 C;  5HKC A;  2DXU A;  2RI3 A;  4OB3 B;  2ED0 A;  1VQP Q;  5A0D A;  5GAO l;  1ZA2 B;  3CCU A;  1GCQ A;  1MMD A;  5KYW A;  1W2B S;  3CPF A;  3FLG A;  5FWB A;  4D8D A;  3CCS T;  3M58 A;  1N8R C;  1GXI E;  1Q7Y U;  2I0N A;  1YCY A;  1YIJ T;  1JB0 E;  3S3M A;  1X43 A;  2C0O A;  2XKO C;  2YRV A;  3HHT B;  1V29 B;  3JCM d;  1OV3 A;  4KT0 E;  1W1F A;  2Q18 X;  1OQK A;  2FZC B;  1UEC A;  4MMK A;  2DLP A;  2SEM A;  2YLC A;  1M3A A;  2DL4 A;  1I1J A;  2LP5 A;  1G8X A;  2FO0 A;  4A4E A;  1TS9 A;  3OBW A;  3P8B B;  2LRQ A;  3TRE A;  2YT6 A;  1C1A A;  2QA4 T;  5GAN 3;  1Q86 U;  4C5E A;  1SPK A;  1PSE A;  2JTE A;  4C8Q E;  1ZHI A;  3VS0 A;  1AVZ C;  3M0S A;  1VOM A;  4OMP A;  1X6G A;  2A7Y A;  4PJO G;  4CI0 C;  1CKB A;  5KH6 A;  4B6M A;  2DET A;  1OX9 A;  3EFO A;  5KYN A;  2KBT A;  3KUF A;  2MMP A;  3C4S A;  3MO8 A;  3UAT A;  4QVC A;  2H8H A;  4JZ4 A;  3EH2 A;  4R0K A;  5LL6 S;  5GAN 7;  2YWW A;  4EDU A;  4RTZ A;  1JO8 A;  2ABL A;  1VQ9 A;  3QDF A;  4C92 E;  2D9T A;  3X28 B;  1NEG A;  3EG0 A;  3NGP A;  3JCM f;  2DJZ A;  3A8L B;  2K5L A;  1OYX A;  2RHX A;  3LH0 A;  4OMN A;  9ATC B;  3CBO A;  2CUB A;  1PCX A;  1T0H A;  1H3H A;  4A4H A;  1UEB A;  4X9D A;  5I21 A;  3CC7 A;  5KYY B;  1E6H A;  2QGG A;  1LNX A;  3I5R A;  3HRS A;  1VA7 A;  2YUP A;  3G71 T;  2PNI A;  3QPH A;  3VS7 A;  3V7C A;  1WHL A;  1Y0M A;  1IO6 A;  4VUB A;  2RO0 A;  5IH2 A;  1SAW A;  2Q1D X;  1ZUU A;  2JVV A;  3I55 T;  2EQK A;  3G4S Q;  2EYX A;  3LGL A;  1VIE A;  1W2B P;  1B34 A;  4F7U G;  4WTO B;  5FRN A;  3BQB A;  2XD0 A;  4FIB A;  1RAH B;  4FU6 A;  3EHQ A;  2HKQ B;  3UA7 A;  3CD6 A;  4LDX A;  1RI9 A;  2M16 A;  1VQ7 A;  3PMI A;  2E1H A;  1UJY A;  2QYZ A;  2BKD N;  1FMV A;  1I81 A;  3EG2 A;  4GBQ A;  1BK2 A;  2EGC A;  4MZM A;  3RUX A;  4ME7 A;  1YCS B;  1PD0 A;  1TH7 A;  2CP3 A;  1YJW T;  3CCS Q;  4M75 A;  5GAN d;  2MWO A;  4PFP A;  2CZ7 B;  2CH4 A;  2E3I A;  4JRI A;  1YI2 T;  3RKX A;  1YIJ Q;  1UHC A;  1HSQ A;  2QQB A;  3HFO A;  1D1C A;  2ZPE B;  1W4S A;  2HDA A;  4C0D B;  4J7F A;  3PIP A;  3CCR A;  3KBG A;  2YLB A;  2DF6 A;  1NYG A;  3G6E Q;  4IUR A;  2YUO A;  3DB3 A;  1OI1 A;  1DJ7 B;  4HCZ A;  2AKL A;  1ABQ A;  4M7A C;  3CCV A;  1K4U S;  2E3H A;  4PLI A;  4ANJ A;  5CCA A;  4E6R A;  2VXF A;  2V8I A;  2DIQ A;  2RQU A;  1A0N B;  1R0B G;  5IN1 A;  2DD4 A;  3M5A A;  4XAX B;  1EZZ B;  4IIM A;  3LWH A;  5FW9 A;  3NTK A;  3PTA A;  3CC2 A;  5FRO A;  4OP0 A;  2LJ1 A;  2ZGW A;  2QA4 Q;  2MWP A;  1XNI A;  1K8A U;  2HAX A;  1NJI R;  4LN2 A;  1M8M A;  2YRD A;  3M0U A;  3CC4 A;  3GP8 A;  4HVW A;  2W10 A;  1TXQ A;  2P0P A;  4RUG A;  2XDD A;  5GAN f;  3OYG A;  5CQY A;  1H92 A;  1M3B A;  3L2R A;  3GNG A;  1JQQ A;  2DKG A;  2VVK A;  1OEB A;  2DRM A;  2FG0 A;  2EYQ A;  4AMC A;  1ABO A;  3QWY A;  3CMA T;  2QXF A;  2D8J A;  4V2S A;  1H3Z A;  4DBQ A;  1VQK A;  2J7I A;  1PM3 A;  3SD4 A;  1QWF A;  1Y96 B;  4M4Z A;  1SV6 A;  5IAY A;  2FPE A;  1OUL A; 
#chains in the Genus database with same CATH homology
 2Q1A X;  1NR9 A;  4MAQ A;  5D2I A;  5D2J A;  1SAW A;  5D2F A;  2Q1D X;  4DBF A;  1WZO A;  3V77 A;  1HYO A;  2EB6 A;  1I7O A;  5D2K A;  2Q19 X;  3S52 A;  3BQB A;  4PFZ A;  1QCN A;  2EB4 A;  3LZK A;  2Q18 X;  2Q1C X;  5D2G A;  4QKU A;  1NKQ A;  1SV6 A;  1GTT A;  3QDF A;  3RR6 A;  3R6O A;  2DFU A;  2HZY A;  2EB5 A;  2WQT A;  4DBH A;  5D2H A;  1QCO A;  1QQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...