4PFZA

X-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
250
Chain Sequence
MRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVRLLAPILASKVIAVGKNYAAHVAPEDPVIFLKPNTAIIGPNVPIQLPADADPVHHEGELAIVIGRPCKDVPAARAAEFILGYTIGNDVSARDQQRKDGQWMRAKGHDTFCPLGPWIVTDLDPSDVELRTEVNGQVRQRSRTSLLLHDIGRLVEWTSAVMTLLPGDVILTGTPEGVGPIEDGDTVSITVEGIGTLTNPVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 5-carboxymethyl-2-hydroxymuconate delta-isomerase
publication title X-ray Crystal Structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
total genus 65
structure length 250
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4pfzA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4pfzA02
3RR6A 2WQTA 2DFUA 3R6OA 2HZYA 3S52A 1HYOA 1WZOA 5D2KA 1SAWA 4QKUA 2Q1DX 3BQBA 1QCNA 5D2IA 2EB5A 2Q18X 2EB6A 4DBFA 1QQJA 4PFZA 5D2GA 1I7OA 5D2FA 5D2JA 5D2HA 4DBHA 2Q1CX 2Q1AX 1NKQA 1QCOA 1NR9A 3LZKA 3QDFA 3V77A 1SV6A 2Q19X 4MAQA 1GTTA 2EB4A
chains in the Genus database with same CATH superfamily
2HKNA 3V8JA 1D1AA 4Z8AA 1UHFA 6AT1B 5IH2A 3M4YA 1T3LA 4IUPA 1VIFA 3VUBA 4JZ4A 1YJWT 4MZPA 2EFIA 3QG1A 4LXCA 1BI0A 4PLLA 2DVEA 4EIKA 3WVEB 3QUIA 2I0NA 3VS2A 1KHIA 1JXMA 2DYIA 2F2VA 3M58A 1GFCA 3HFOA 5L8RE 4V2SA 4A4HA 2HAXA 2OTLQ 3MCAB 1VQ7A 4A54A 1G3YA 3PNWC 4Z89A 2P84A 2EB5A 2QEXQ 1BCOA 4XK8E 2F5TX 2EQIA 2KXCA 1Q82R 3MPUB 1U1TA 5LL6S 2VKNA 3THKA 2X9HA 2CT3A 2LX9A 1IHVA 1PM3A 4XTVA 1MMDA 1NLPC 1SHFA 2DEQA 3CXCS 1ZA2B 8ATCB 2HD0A 4JRKA 2JW4A 3JB9D 2ZPFB 3HP9A 5DLOA 4FYWB 3H0FA 3C4SA 3CMAA 2HQXA 1UDLA 1M1KR 2P0PA 3A8MB 1KQ2A 3HL8A 4GBQA 2H8HA 2CUBA 2RO0A 4WCIA 5CO7A 3GBQA 5KYXA 3OB9A 3H41A 3L2RA 4OGCA 1RI9A 2KI7A 3LX7A 1GRIA 2DTIA 4F04B 3JB9J 3FDRA 4PJOA 4HKEA 2GNCA 3LGLA 2MI6A 1NLOC 4IUUA 2H3EB 1MNDA 3RMQA 1D0YA 1B34A 1Q81U 2DL7A 2KGTA 3I56Q 3N5BB 3KFVA 3X26B 5KYUA 1M3BA 2KAFA 2RK2A 2FVUA 4N0AA 4AMCA 2QGFB 4HVUA 4JZ3A 3V7SA 3G7ZA 2W0ZA 1YBYA 3CCST 1I4K1 1LOJA 5IXFA 1VQMT 1TH7A 3CCRQ 3CCLT 1I07A 3MO8A 2HBPA 3HRSA 1WXBA 5KYWB 2GF7A 2LJ1A 1D09B 2CYZB 3IQLA 4BDYA 4J83A 2CH4W 3QBYA 2YUQA 1Q7YC 3CEYA 5LJ3e 1Q86C 1NJIR 3FEOA 1HJDA 3I55Q 3CCUT 3MP8A 5GANj 1U1SA 3C12A 4QKUA 2FO0A 4JDSA 1I8FA 3CCEA 1WI7A 1WHLA 3H0HA 3QYGB 2JZ2A 2XHCA 2D8JA 5D6WA 1VIEA 3MP1A 1PSFA 4N0AC 1MMNA 2HDAA 3CC2Q 4IUQA 1VQ6T 1QVPA 2QASA 1D0XA 2AZVA 1WGSA 1PRMC 3QDRB 3PMIA 3X25B 3PTAA 1PD1A 2COYA 3URGA 2DZCA 2YRDA 4XU0A 2PTKA 2FRWA 1KIKA 2FRYA 2LJ0A 1UJ0A 1FX7A 4XAXB 5C6SA 2BTTA 3EHQA 2K7AA 3TREA 3CC7T 3OYCA 1PKTA 1RAFB 4RTZA 1PSEA 2ABLA 1BIBA 7AT1B 1I81A 5LJ3h 2O2OA 1PWTA 2JTMA 3UA6A 5HKCA 3GNFB 1HYOA 2DXUA 1TOVA 1VQLQ 3L2QA 2VB6A 3OYMA 1O9SA 1OZ2A 1QCOA 3SD4A 4J9EA 4M78F 1WHGA 2KRMA 1TSFA 5CK9A 4C5HA 2EJGA 2R5AA 2J6KA 4MDWA 4AFQC 2KVQG 2AK5A 5CKEA 5D6XA 1V29B 5KYXB 3JCMP 4M75F 3A98A 3S3OA 2OTJA 1VQ7Q 3TSZA 2MPXC 1FMVA 3QHSA 4PJOB 2FEIA 1IGUA 2LT1A 3OYDA 2HSPA 4BD3A 1B34B 3QZ5B 2JMAA 3TCJA 4JRPA 4ELZC 1VUBA 2QQBA 2VGNA 3NMZC 3X24B 4RMOA 3EG0A 1AZEA 4D6WA 3RKWA 2BE9B 2MK5A 1VQ4Q 2C0TA 2NUTA 1YFNA 3QJYA 4EMHA 1M3CA 2E4HA 3OYYA 1KJWA 1PNJA 2LMJA 5C0MA 1I5LA 2IPOB 1R0CB 2EIFA 1VOMA 2EQJA 4LDYA 2RQTA 4OMLA 4DOVA 4M78A 4F17A 4A4FA 3CMAQ 4J9GA 1G8XA 3CCQT 1M9SA 2RH2A 2DXCA 3U23A 3CXCA 5J3BA 1GXIE 2FZKB 2K9GA 2RI2A 1NYFA 1AZGB 1U06A 1M90U 5GMKm 1M1GA 1WJSA 1G3TA 2ROTA 3M5AA 4XU3A 3RNJA 3CXCP 1XQHA 2YT6A 3CCLA 3H0IA 4Z88A 2LVMA 4LDWA 3SDZA 5D2GA 1AVZC 5HY6A 1NR9A 3LZKA 4LUDA 4E7KA 4FU6A 3NTHA 4KULA 3RR6A 1AHJB 1MUZA 1UGRB 3M9QA 2DNUA 2ZCFB 1AWJA 4M78C 1MHNA 5J26A 2QXFA 4QQ6A 3M56A 1Q82C 5DY9A 5CAIA 2LZ6B 2V1RA 2COZA 2QG9B 2RQRA 2DERA 2NYSA 1VQ6A 5GJVB 3UPUA 2HQHA 4KT0E 2IIMA 2QI2A 1M5Q1 4PFOA 1K76A 3G71A 2ESWA 5GAMe 3JCMW 1WZOA 1Y71A 3CCEQ 2RA2A 1T0HA 4M75C 4RTTA 1LPLA 2SEMA 1M1KC 5GMKh 2EYYA 3SEMA 2L5QA 2R5MA 2O31A 1UTIA 2ZAEA 1C1AA 3E9FA 2R58A 1AD5A 3H8ZA 3AHUA 3GOXA 1RACB 3V7RA 3A8HB 1D3BB 2KY9A 2BZXA 4J6WA 2YLCA 4BI3A 2JS0A 1VQOA 2DL4A 3JCMh 1I0CA 5I21A 2OTLA 3EFOB 5LJ5h 1RABB 4RTYA 3META 2BKDN 1AWWA 2P0KA 1KQSS 4ATOA 3OMCA 1TXQA 4XTXA 4CC3A 5A0DA 2EJ9A 2RNAA 2VUBA 1VYTA 4O6JA 1O75A 1M3AA 2YLBA 2F2XA 2AKLA 4Y28E 3ZBDA 2X4XA 1RAAB 3CC4A 3OSVA 4PJOE 2LCCA 1VYVA 2RJFA 1NJIC 2NUTB 5GAMg 1N9RA 4M78D 4OMMA 3CD6T 2A28A 2EKOA 1ZSZA 1S72A 1JJ2A 1Y07A 5IN1A 2LDMA 5I22A 3JCMQ 1H3ZA 5GAOm 4M78B 4ZGJB 5FWBA 3L2VA 2M51A 3JCMX 4C0ZA 3EFSA 3HTRA 4AT1B 2DL3A 1EX4A 1QP2A 1EIFA 2KRSA 5CR2A 3ER0A 1R0BG 4PLIA 1WIEA 2X3WD 1YJNT 2AHJB 2EAYA 4LNPA 2OTJQ 3QIIA 1PHTA 2XU8A 1OQKA 4M75D 3CQTA 3SHWA 4FW2A 3BW1A 3L2ZA 2DTOA 1E7OA 3EGUA 2HCKA 4CC4B 5GANf 1BU1A 4M75B 3JB9H 4OMFB 4BE2A 1G83A 5IHKA 1LNXA 2L2PA 5DLQE 4CI0C 3DKMA 2QQRA 1TG0A 5ECAA 4C92G 3O5ZA 4C0DC 3OYEA 4J9CA 1OX8A 2K5IA 1K9MU 2L8DA 3QWXX 2RI3A 3OS1A 1OU9A 4JUVA 2DJQA 3CPFA 1YWOA 2EQKA 2MWOA 4OB2B 1X27A 4RKUE 3G4ST 3EG9A 1VQNA 4J9FA 1B07A 4JS4A 3OW2S 2J7IA 1SRMA 4M77A 4AG2C 2YRVA 2PVGB 2JNGA 3P8BB 3JV3A 1M1FA 3CC2A 4JRQA 3CCLQ 1KK7A 2LQKA 2J6OA 1N6AA 1KD1U 3D7SB 5GAMf 1IRXA 2E64A 3I5RA 2A0FB 2ECZA 3EHRA 5GAMd 1UHCA 2QA4T 2SRCA 1A0NB 1M27C 2M9UA 3L1AA 3LWIA 3A8GB 2JM9A 5L23A 2D9TA 4HCKA 2CSIA 1G3WA 1VQKT 2K3YA 4D8DA 1TUDA 3A8LB 4E7ZA 2AKKA 2AZSA 2DL5A 5EG2A 2RHZA 4M4ZA 2VV5A 3M53A 2RJEA 1VQ6Q 3SWNA 1WFWA 3MEVA 4F14A 1WNLA 2KDSA 1YCSB 4M77C 5LJ3j 1WXTA 3HRUA 2K3XA 3QWYA 1VYUA 4KBMB 3G71Q 2A36A 4TVRA 4Y91A 4DEXA 5GAN3 1YJ9A 2E10A 2P0QA 3G6ET 2HNIA 3GLXA 3CCMT 3I9QA 1XTDA 4BY6C 3DB4A 5AT1B 2H3JA 3F70A 4GY5A 4Q5WA 3J81E 3PVLA 1VQ5A 2VGMA 4PJOF 2KQWA 1M2VA 3OBYA 1M90R 4C0DB 3E19A 4GLKA 2EWNA 1VQOQ 3R6NA 1M2OA 5FWCA 2K4YA 2VWFA 3QSUA 4RG2A 4B6MA 4KH1B 3OYNA 2M16A 1YHQT 1D1BA 2D1XA 3OSSC 3SWNC 3X28B 4C5GA 1QQJA 2YXYA 5GAOr 1UECA 4FW1A 3A5ZB 4M78E 4E7HA 3CD6A 4HCBA 2ZPGB 5IT9E 2CP2A 4RCBA 1VQ4A 2JT4A 1KQSA 2J05A 2EGCA 3CC4Q 2G3RA 1UGVA 2VXFA 2MCNA 4LE9A 4DA4A 4R55A 2EKHA 3MEAA 2B8AA 2ZPEB 2VC8A 2ZPHB 1KQSP 4M75E 2DXTA 1S72Q 2JUFA 1LVKA 4F7UG 4M77D 5KYYA 3KXTA 3EG9B 3FRNA 1WHJA 1H641 2FG0A 1X6GA 1TTHB 1YITT 4M77B 3WXMB 1WHHA 2K2VA 1K1ZA 3NTKA 4Y92A 2DBMA 4BY6B 3LGFA 4FM4B 3CMET 4QVCA 1ARKA 2KYBA 4J9HA 3DLLA 3TEEA 4NL2A 2CSQA 1UG1A 1KSWA 2O4XA 4BUGA 2RF0A 2PZ1A 3M0PA 4RG8A 2HMAA 4NS5A 1Q86U 1UE9A 2CUDA 1ZUUA 4J7FA 4PJOC 4M7AG 1VQNQ 3SWNB 3BFMA 2XIDA 2OAUA 2BZ8A 2DIQA 4LUEA 4HT8A 2YUPA 4JLIA 3CCJT 4X1VA 3CCVT 2P4TA 2QQSA 2YRCA 1UUEA 2X4JA 2O88A 2JXBA 1QWFA 2DTHA 5KCHA 2VXEA 3M4GA 1KHCA 3OW2A 1BYMA 1YN8A 4HCZA 2LT4A 2LCSA 5GMKj 1SKUB 5CVIA 2DVJA 3VS5A 3M54A 4KUIA 2A7YA 3PIPA 2E65A 3CPWA 2KNBB 4BE0A 4FT4A 2C0IA 2DM1A 1M2VB 3OW2P 4NOYA 5GAN2 1XJWB 2O9SA 1QKWA 1VA7A 4KH0B 3LH0A 3G6EA 4LDUA 3CPWP 1N9SA 5LJ5j 4CC2A 1N8RR 4ZTJA 2ENMA 5HK3A 2D0NA 2DAQA 2KR3A 2Q1DX 2DIGA 1YJWA 5J39A 1K73U 4KGVB 2RI5A 1AOJA 1OULA 3FB9A 3JRZA 1AT1B 4E7SA 1JJ2S 2Q1CX 5KE2A 1QVGA 4FYVB 3QPHA 2B86A 1YJ9Q 1K9MR 2A37A 4ME7A 3GNGA 4C8QA 5EC7A 3EH1A 4DOWA 4KUDK 1E6HA 1ZA1B 3MP6A 3R6OA 1YHQA 2GQVA 2D6FA 2E5KA 2RD1A 1QVGP 5GMKl 4Z02A 2LX7A 3ZEHA 2KXDA 1WA7A 4IIOA 1VQ5Q 4EMGA 4QVDA 4PJMA 4X9CA 5FRMA 2F69A 3CBOA 4PJOD 2CP5A 3O8VA 4N4IA 3M0RA 3ASKA 4J9DA 2HL3A 4QVZA 3UWNA 2LQNA 1IREB 3A1PA 4AFUC 3CD6Q 1K0XA 3E9GA 5KYUB 3VS3A 1VQ9T 1BIAA 1RUWA 2K2MA 4C8QG 3RERA 5CQYA 4ZN3A 2EQUA 4PKCC 4M77E 2J6FA 2OX7A 1SPKA 4BI8B 1OYXA 3RESA 5GAN6 2GGRA 2M0YA 4DBQA 2I2LA 1BCMA 4A4GA 3REAB 3OS0A 2LTOA 1YI2T 1GBQA 3FC3A 4C0FA 2DYBA 4FSXA 4FCYA 2QTXA 3I56T 2EB4A 3M55A 2M02A 3OYHA 3I35A 1NEGA 1TUGB 4FSSA 2K5LA 2RHYA 5GANe 3CCSA 3VV0A 3DLMA 1VQMA 1MMAA 4F16A 5AYFA 3UATA 3BE3A 2JOYA 2EJFA 4BACA 3M0SA 1XOVA 1M90C 3VS4A 2XKOC 4N4HA 3CCRT 4PFPA 3T9NA 3X20B 4IURA 1OV3A 3CCUA 3GIBA 2DE0X 4RTXA 5KH6A 2KT8A 2DK3A 1NZ9A 1WHMA 2LJ3A 1H3HA 1NBEB 2MF2A 1CSKA 2BE7D 5D2JA 1X01A 1IO6A 4E6RA 4E47A 3CCJA 2GTOA 1Q82U 2CP3A 1QVFS 3NFCA 3ZL7C 5GAOn 1WQ7A 2XDDA 3P8DA 1W2BS 2E5QA 1UJYA 4HT9A 2KROA 2QTVA 4B9WA 1WX6A 1RADB 4FT2A 2V1QA 4C92F 3CC7A 2F2WA 1KC8U 2Z0WA 4OMPA 4PFZA 4C5EA 1U5SA 4RTWA 5GANg 1SV6A 3G1JA 1J3TA 3A8OB 1RAIB 4A53A 5KYNA 5IHIA 2MWPA 5CKBA 1Y0MA 2X3XD 4CC7A 1RAEB 3RDVA 2L3PA 4RTVA 2V8JA 1Q81R 2WSFE 2L3QA 1I5OB 4A4KA 1M4ZA 3VUZA 1ABQA 1C6VX 3JCMJ 3CBPA 3G6EQ 1SHGA 1S1NA 3FJPA 8AT1B 3CCMQ 2XICA 1MMGA 1JRIA 2DFUA 1X2KA 5GAN8 1YJWQ 1JEGA 1SAWA 4M7DA 5GAMh 1X69A 4ESRA 2Q18X 2CREA 2NUZA 3HHTB 3V7CA 3QO3A 2FPEA 4AFSC 2QDLA 1GCPA 2HSEB 3J7AF 4J5YA 1WYXA 4HA8A 3H9NA 2RHIA 4C92A 1DJ7B 1LCKA 2LQ8A 1YHQQ 2R57A 2DILA 4A4EA 3RKXA 4M77F 3VS0A 2DD4A 4XU2A 2AIRB 1VQ7T 2RQUA 3GPLA 3LW5E 5CKHA 2KT1A 1VQ9A 1NPRA 1G3SA 1Y7XA 1JJ2P 3RMSA 2M0OA 2YUOA 4MAQA 1MV0B 1OZ3A 2EBPA 3FIFA 4OP0A 1K0SA 2PQWA 4M7DG 1OEBA 3CCQA 4YTLA 3NTIA 4VUBA 2EGEA 5GANd 1OPKA 4IKFA 2ZPBB 2OI3A 3CMAT 4J9IA 2ROLA 4C92C 1HK9A 1TWBA 1ZSZC 1N8RC 2LC4A 2QQAA 2XDBA 1GFDA 2L3SA 1QW1A 1RAHB 1YITQ 3V8LA 1K73R 1K4US 2QQ9A 4HXJA 4O5VA 1RLQC 5I11A 1YWPA 4OVAA 4PNOA 4PJJA 1OOTA 2QYZA 2HL5C 3M0QA 1ZHIA 1K9MC 2Q1AX 1K9AA 2JM8A 3HSBA 3QKJA 4OF1A 2Q19X 2FPDA 2F5KA 3CCSQ 3DB3A 3CPWS 1VQMQ 3J80E 2E6NA 2HQEA 1X43A 1EZZB 4L59A 3EG3A 3MHXA 3NGPA 1ZLMA 5A2QE 2DJZA 2XDPA 2DLPA 4ZGDB 2RHXA 4AG1C 3OQ5A 1M8MA 1KQ1A 3LH5A 1IGQA 2EVRA 3OY9A 2WSCE 4ORZA 3ULRB 3CCUQ 3BY7A 2RJDA 1ZUYA 3PE0A 3RKYA 2HKQB 4QQDA 1IXDA 4EDUA 1TUCA 3E1SA 2XMFA 1OI1A 4C8QE 2DBKA 1QVGS 3OYAA 1HD3A 3V8KA 4PJLA 3CCJQ 3EGXA 2VYTA 9ATCB 3CCET 2KSSA 5KYWA 1PC0A 3M0UA 5GMKi 3SB2A 3JB9G 4JJBA 1ZBJA 1K8AU 1FWZA 4D8KA 2KMTA 2HEQA 3PFSA 2EW3A 2RMOA 2XI9A 4OGEA 2L89A 3CC7Q 1QVFA 4E2FB 5CQXA 1AEYA 3VS1A 1W2BA 2RM4A 4C92D 4JJNK 2DA9A 2ZPIB 4ANJA 3OYGA 3RIRA 3OYJA 4C92B 1QVFP 4M7AF 1H8KA 2GBQA 1W2BP 1ZSZB 3C94A 2G6FX 1X75C 3VS6A 2CZ1B 4J6YA 3Q1JA 3I5SA 1JU5C 3BQBA 4F7UA 3OBWA 1VQ8T 1Y57A 5FLXE 2GQIA 3OS2A 4ZTFA 1B3QA 5D2HA 4XTUA 4JJDA 3KUFA 3QJ6A 2QK0A 2EYWA 1U8RA 2LP5A 1D1CA 3H6ZA 1UGSB 2YHTA 2DL8A 1ZBXA 1R8OB 1EFNA 1AWXA 2A3LA 2IVWA 4C0GA 3PMTA 2LRQA 3EG2A 1X6BA 1WJQA 2E12A 2FZGB 1YJNA 1WLPB 4II1A 1PD0A 1LJOA 4OMQA 1ACMB 3SFMA 3PVQA 2FB7A 3TQ7P 3HKSA 2WQTA 2OTJT 1AWOA 4BI4A 1IB8A 5M9OA 3P8HA 1VQ9Q 2PVDB 1KC8R 2EGAA 1FXXA 4M7AA 5GJWB 2CP6A 4WTOB 3GF5A 2CKKA 2K57A 2CP7A 2L0AA 2CS7A 3OYIA 2WACA 2W10A 1T0JA 1YP5A 1QCFA 3CCQQ 2GFUA 2DPPB 1WQWA 1WPYA 3JCMc 3G4SA 1Q81C 3ZFJA 1MGQA 3LLRA 1YI2Q 3QZ9B 3JCMV 1B7TA 2Y4YA 1UB4A 2EYZA 4BE1A 4MMLA 4E7JA 4PL6A 2Y4XA 5A0GA 3EG1A 2JTEA 4FL6A 2MMPA 1UFFA 5IXBA 4R0KA 1Q7YU 1TU0B 1Z9ZA 2QGGA 3UDCA 4L5GA 1UGQB 4M7AC 2QA4A 3EGXB 1GBRA 4K11A 4C8QF 2KE9A 1SRLA 2VVKA 3L2WA 1P92A 1PRLC 3KBGA 1JBMA 1VQKA 1BKBA 1VQPT 3MEWA 3MJXA 4PJOG 2M1HA 3FLGA 4HVVA 2DETA 5DM7R 5GAN7 3RBBB 4KRTA 3C95A 2J06A 3PGGA 4M7DE 2KYMA 1WJRA 2CP0A 4KGXB 3INZA 4OB1B 1YIJT 1QWEA 1V1CA 2K6DA 5IAYA 2COWA 3CCMA 2DF6A 2DXBA 1W70A 1U3OA 2HZYA 3G71T 3S52A 3PT9A 4F7UB 4C92E 2L3RA 2F1LA 1KFZA 1UGPB 2RK1A 1HSQA 2NWMA 4P5NA 5FU6C 2NUPA 4GLMA 1F1BB 2E6ZA 4J6XA 2C06A 2VASA 1YNZA 3QDFA 1X6OA 1NE8A 3EH2A 3FJ5A 2XG8D 1NYGA 5GAMj 1K73C 1H92A 4XTZA 1VQ8A 4EMKA 2OAWA 5GAN5 1VQOT 4J9BA 3TU4K 3OYFA 1TS9A 3QYHB 3JSCA 5LJ3g 2OTLT 1SF9A 1BI2A 1KG1A 2PVOB 3MEUA 2X51A 2QEXT 5GAN4 4M7AD 2LQWA 2CZ6B 4OMNA 1D3BA 1KD1R 2FZCB 5KYYB 2KEAA 4M7AB 4DBRA 5D2IA 3EFOA 3LWHA 2GCXA 2C0OA 3CC4T 1I7OA 2FHDA 1IHWA 2EPDA 3V77A 4XU1A 4PK4A 2GTJA 3JCMb 4C8QC 2XD0A 1RI0A 2DD5A 1M8VA 3S6WA 2QDYB 1SSHA 4EMKC 1S72T 4MMKA 3VU3C 4NL3A 3OMGA 2DRMA 3AT1B 3BDUA 3VRYA 2RN8A 1YITA 1YJNQ 1Y96A 3M59A 4N4GA 3E2UA 1PKSA 5CCAA 1FYNA 2XK0A 1Z9QA 5KCOA 2JMCA 3VJPA 4A63B 1K8AR 2O4XB 1UEBA 5FU7C 3QXEB 2GFAA 1SSFA 2QAZA 2E41A 2CDTA 3VRZA 3CMEA 2PUOB 1NPPA 5FU6B 4MZTA 4LDVA 2CT4A 2X35A 2E3IA 1IZ6A 3C0CA 1W6XA 4CRIA 1BBZA 1E6GA 4J8OA 4JPBW 5LJ3f 1QLYA 5A0LA 2K79A 1RAGB 4LD6A 3G4SQ 5LJ3d 2JJ9A 1PCXA 2JVVA 2ZZDA 5GMKe 1FMWA 2LNVA 2JS2A 3NPFA 4M75A 3I55T 2EYQA 2X4WA 1W1FA 1BK2A 1VQNT 2PU9B 2FL7A 1VQPA 3CCVA 3VKIA 4M7DF 2KRNA 3TVTA 1C0MA 2AT1B 3OS5A 2MIOA 3JCMe 1RL2A 1CKBA 3CC2T 2RQVA 2QA4Q 2YWWA 5LJ5e 4M78G 3L42A 1G2BA 5GANh 2JN0A 2EQMA 2NUPB 4OMOA 5D7UA 1JXOA 4C8QD 2PUKB 5GAOl 2P4RA 4AFZC 1YIJA 2PNIA 3S3MA 4F7UE 1VQKQ 5FRNA 1M1KU 4FYXB 3NHNA 2NLUA 4C8QB 2X4YA 5I2MA 4FIBA 1OPLA 1WDXA 4EMKB 4JS5A 3CBMA 1KC8C 4M75G 5HCKA 4RUGA 3UT1A 1YCYA 4DBFA 5D2FA 4XTWA 2MYSA 3M57A 4RTUA 1ZSGA 1VQLT 1Q95G 1NKQA 2V8IA 2LNHB 4ZN1A 3HFNA 4JLGA 1XNIA 4XTYA 5FU7B 4DQ2A 2CGHA 3UF4A 4UC4A 1YJ9T 2DO3A 1GL5A 2BUDA 2E3HA 1ZQ1A 3OYLA 2D8HA 3PIOA 2YDLA 2QEXA 2KBTA 5KE3A 1SEMA 3JCMg 1JB0E 2DEUA 4M7AE 2D0QB 1JO8A 1OX9A 4IIMA 1FMKA 3EGDA 1PG5B 1VQ5T 5LJ5g 3S3NA 4LDXA 4R56A 1ZUKA 4BB7A 1NJIU 4B9XA 1W4SA 3HPWA 1Q7YR 3M0TA 1VQ8Q 1Q86R 4JRIA 1MNEA 2HBWA 3JB9I 3JB9F 1NM7A 1Y96B 4EPCA 4ZGEB 4RCCA 4C5IA 2K3BA 2Y90A 1OU8A 3JAME 1R77A 4E7LA 5D6YA 4OB0B 5I2SA 1HXDA 2FYKA 2LCLA 2DX1A 2OJ2A 1SG5A 1QMCA 5GAOq 1ABOA 3HRTA 4ZNXA 3OYBA 4L6V5 2JTFA 1VQ4T 1I1JA 1WXUA 5D2KA 3VS7A 4M7DC 2DZ9A 2ED0A 4J7IA 1V76A 2RHUA 4QT7A 4OB3B 1GCQA 2RPNA 1YI2A 4BDZA 4FYYB 1N5ZA 1NEBA 3I56A 1D0ZA 3LYIA 3WVDB 4MZMA 2DRKA 4LD9K 2BIVA 1N8RU 2O9VA 2DKGA 2WSEE 1ZX6A 2RJCA 4DEYA 4ELYC 3UA7A 4WF2A 1RLPC 4QW2A 4XQ3A 2RQWA 1QKXA 4X34A 3CCRA 2O01E 2A08A 2MAMA 3TSWA 3GP8A 3RUXA 2IG0A 4HCCA 3CMEQ 4IUTA 3JCMf 5CIUA 2ED1A 3EAEA 1N27A 3I55A 4E7IA 3JCMd 5LJ5f 2E1HA 1GCQC 2V8KA 4X9DA 4MDXA 3VYHB 5GAOp 5LJ5d 2EB6A 4KGZB 4LN2A 2E70A 1T3SA 1BI3A 2FPFA 1X2QA 2K5FA 1BI1A 2KK4A 4PJNA 2ATCB 4F7UF 3REBB 1KD1C 2EYXA 3EFRA 3VYGA 5FROA 2YUNA 1G5VA 1CKAA 1BB9A 3OA6A 1WHKA 3ME9A 2ZGWA 1QCNA 1JQQA 3OYKA 5CKFA 3L2UA 4IUVA 3MKDA 1VQPQ 3CCVQ 5FW9A 4DBHA 5HK0A 2CZ7B 1QP3A 4M7DD 5IHNA 1GTTA 4QQGA 5CKDA 2DMOA 2CZ0B 1M30A 4M7DB 2V26A 2RB6A 1MV3A 1VQLA 1YIJQ 1NG2A 2BZYA 1K8AC 4M77G 4HVWA 3EGDB 3BDLA 4JJCA 2YSQA 2MOXA 2CH4A
chains in the Genus database with same CATH topology
3RR6A 2WQTA 2DFUA 3R6OA 2HZYA 3S52A 1HYOA 1WZOA 5D2KA 1SAWA 4QKUA 2Q1DX 3BQBA 1QCNA 5D2IA 2EB5A 2Q18X 2EB6A 4DBFA 1QQJA 4PFZA 5D2GA 1I7OA 5D2FA 5D2JA 5D2HA 4DBHA 2Q1CX 2Q1AX 1NKQA 1QCOA 1NR9A 3LZKA 3QDFA 3V77A 1SV6A 2Q19X 4MAQA 1GTTA 2EB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR6 A;  2WQT A;  2DFU A;  3R6O A;  2HZY A;  3S52 A;  1HYO A;  1WZO A;  5D2K A;  1SAW A;  4QKU A;  2Q1D X;  3BQB A;  1QCN A;  5D2I A;  2EB5 A;  2Q18 X;  2EB6 A;  4DBF A;  1QQJ A;  4PFZ A;  5D2G A;  1I7O A;  5D2F A;  5D2J A;  5D2H A;  4DBH A;  2Q1C X;  2Q1A X;  1NKQ A;  1QCO A;  1NR9 A;  3LZK A;  3QDF A;  3V77 A;  1SV6 A;  2Q19 X;  4MAQ A;  1GTT A;  2EB4 A; 
#chains in the Genus database with same CATH topology
 2HKN A;  3V8J A;  1D1A A;  4Z8A A;  1UHF A;  6AT1 B;  5IH2 A;  3M4Y A;  1T3L A;  4IUP A;  1VIF A;  3VUB A;  4JZ4 A;  1YJW T;  4MZP A;  2EFI A;  3QG1 A;  4LXC A;  1BI0 A;  4PLL A;  2DVE A;  4EIK A;  3WVE B;  3QUI A;  2I0N A;  3VS2 A;  1KHI A;  1JXM A;  2DYI A;  2F2V A;  3M58 A;  1GFC A;  3HFO A;  5L8R E;  4V2S A;  4A4H A;  2HAX A;  2OTL Q;  3MCA B;  1VQ7 A;  4A54 A;  1G3Y A;  3PNW C;  4Z89 A;  2P84 A;  2EB5 A;  2QEX Q;  1BCO A;  4XK8 E;  2F5T X;  2EQI A;  2KXC A;  1Q82 R;  3MPU B;  1U1T A;  5LL6 S;  2VKN A;  3THK A;  2X9H A;  2CT3 A;  2LX9 A;  1IHV A;  1PM3 A;  4XTV A;  1MMD A;  1NLP C;  1SHF A;  2DEQ A;  3CXC S;  1ZA2 B;  8ATC B;  2HD0 A;  4JRK A;  2JW4 A;  3JB9 D;  2ZPF B;  3HP9 A;  5DLO A;  4FYW B;  3H0F A;  3C4S A;  3CMA A;  2HQX A;  1UDL A;  1M1K R;  2P0P A;  3A8M B;  1KQ2 A;  3HL8 A;  4GBQ A;  2H8H A;  2CUB A;  2RO0 A;  4WCI A;  5CO7 A;  3GBQ A;  5KYX A;  3OB9 A;  3H41 A;  3L2R A;  4OGC A;  1RI9 A;  2KI7 A;  3LX7 A;  1GRI A;  2DTI A;  4F04 B;  3JB9 J;  3FDR A;  4PJO A;  4HKE A;  2GNC A;  3LGL A;  2MI6 A;  1NLO C;  4IUU A;  2H3E B;  1MND A;  3RMQ A;  1D0Y A;  1B34 A;  1Q81 U;  2DL7 A;  2KGT A;  3I56 Q;  3N5B B;  3KFV A;  3X26 B;  5KYU A;  1M3B A;  2KAF A;  2RK2 A;  2FVU A;  4N0A A;  4AMC A;  2QGF B;  4HVU A;  4JZ3 A;  3V7S A;  3G7Z A;  2W0Z A;  1YBY A;  3CCS T;  1I4K 1;  1LOJ A;  5IXF A;  1VQM T;  1TH7 A;  3CCR Q;  3CCL T;  1I07 A;  3MO8 A;  2HBP A;  3HRS A;  1WXB A;  5KYW B;  2GF7 A;  2LJ1 A;  1D09 B;  2CYZ B;  3IQL A;  4BDY A;  4J83 A;  2CH4 W;  3QBY A;  2YUQ A;  1Q7Y C;  3CEY A;  5LJ3 e;  1Q86 C;  1NJI R;  3FEO A;  1HJD A;  3I55 Q;  3CCU T;  3MP8 A;  5GAN j;  1U1S A;  3C12 A;  4QKU A;  2FO0 A;  4JDS A;  1I8F A;  3CCE A;  1WI7 A;  1WHL A;  3H0H A;  3QYG B;  2JZ2 A;  2XHC A;  2D8J A;  5D6W A;  1VIE A;  3MP1 A;  1PSF A;  4N0A C;  1MMN A;  2HDA A;  3CC2 Q;  4IUQ A;  1VQ6 T;  1QVP A;  2QAS A;  1D0X A;  2AZV A;  1WGS A;  1PRM C;  3QDR B;  3PMI A;  3X25 B;  3PTA A;  1PD1 A;  2COY A;  3URG A;  2DZC A;  2YRD A;  4XU0 A;  2PTK A;  2FRW A;  1KIK A;  2FRY A;  2LJ0 A;  1UJ0 A;  1FX7 A;  4XAX B;  5C6S A;  2BTT A;  3EHQ A;  2K7A A;  3TRE A;  3CC7 T;  3OYC A;  1PKT A;  1RAF B;  4RTZ A;  1PSE A;  2ABL A;  1BIB A;  7AT1 B;  1I81 A;  5LJ3 h;  2O2O A;  1PWT A;  2JTM A;  3UA6 A;  5HKC A;  3GNF B;  1HYO A;  2DXU A;  1TOV A;  1VQL Q;  3L2Q A;  2VB6 A;  3OYM A;  1O9S A;  1OZ2 A;  1QCO A;  3SD4 A;  4J9E A;  4M78 F;  1WHG A;  2KRM A;  1TSF A;  5CK9 A;  4C5H A;  2EJG A;  2R5A A;  2J6K A;  4MDW A;  4AFQ C;  2KVQ G;  2AK5 A;  5CKE A;  5D6X A;  1V29 B;  5KYX B;  3JCM P;  4M75 F;  3A98 A;  3S3O A;  2OTJ A;  1VQ7 Q;  3TSZ A;  2MPX C;  1FMV A;  3QHS A;  4PJO B;  2FEI A;  1IGU A;  2LT1 A;  3OYD A;  2HSP A;  4BD3 A;  1B34 B;  3QZ5 B;  2JMA A;  3TCJ A;  4JRP A;  4ELZ C;  1VUB A;  2QQB A;  2VGN A;  3NMZ C;  3X24 B;  4RMO A;  3EG0 A;  1AZE A;  4D6W A;  3RKW A;  2BE9 B;  2MK5 A;  1VQ4 Q;  2C0T A;  2NUT A;  1YFN A;  3QJY A;  4EMH A;  1M3C A;  2E4H A;  3OYY A;  1KJW A;  1PNJ A;  2LMJ A;  5C0M A;  1I5L A;  2IPO B;  1R0C B;  2EIF A;  1VOM A;  2EQJ A;  4LDY A;  2RQT A;  4OML A;  4DOV A;  4M78 A;  4F17 A;  4A4F A;  3CMA Q;  4J9G A;  1G8X A;  3CCQ T;  1M9S A;  2RH2 A;  2DXC A;  3U23 A;  3CXC A;  5J3B A;  1GXI E;  2FZK B;  2K9G A;  2RI2 A;  1NYF A;  1AZG B;  1U06 A;  1M90 U;  5GMK m;  1M1G A;  1WJS A;  1G3T A;  2ROT A;  3M5A A;  4XU3 A;  3RNJ A;  3CXC P;  1XQH A;  2YT6 A;  3CCL A;  3H0I A;  4Z88 A;  2LVM A;  4LDW A;  3SDZ A;  5D2G A;  1AVZ C;  5HY6 A;  1NR9 A;  3LZK A;  4LUD A;  4E7K A;  4FU6 A;  3NTH A;  4KUL A;  3RR6 A;  1AHJ B;  1MUZ A;  1UGR B;  3M9Q A;  2DNU A;  2ZCF B;  1AWJ A;  4M78 C;  1MHN A;  5J26 A;  2QXF A;  4QQ6 A;  3M56 A;  1Q82 C;  5DY9 A;  5CAI A;  2LZ6 B;  2V1R A;  2COZ A;  2QG9 B;  2RQR A;  2DER A;  2NYS A;  1VQ6 A;  5GJV B;  3UPU A;  2HQH A;  4KT0 E;  2IIM A;  2QI2 A;  1M5Q 1;  4PFO A;  1K76 A;  3G71 A;  2ESW A;  5GAM e;  3JCM W;  1WZO A;  1Y71 A;  3CCE Q;  2RA2 A;  1T0H A;  4M75 C;  4RTT A;  1LPL A;  2SEM A;  1M1K C;  5GMK h;  2EYY A;  3SEM A;  2L5Q A;  2R5M A;  2O31 A;  1UTI A;  2ZAE A;  1C1A A;  3E9F A;  2R58 A;  1AD5 A;  3H8Z A;  3AHU A;  3GOX A;  1RAC B;  3V7R A;  3A8H B;  1D3B B;  2KY9 A;  2BZX A;  4J6W A;  2YLC A;  4BI3 A;  2JS0 A;  1VQO A;  2DL4 A;  3JCM h;  1I0C A;  5I21 A;  2OTL A;  3EFO B;  5LJ5 h;  1RAB B;  4RTY A;  3MET A;  2BKD N;  1AWW A;  2P0K A;  1KQS S;  4ATO A;  3OMC A;  1TXQ A;  4XTX A;  4CC3 A;  5A0D A;  2EJ9 A;  2RNA A;  2VUB A;  1VYT A;  4O6J A;  1O75 A;  1M3A A;  2YLB A;  2F2X A;  2AKL A;  4Y28 E;  3ZBD A;  2X4X A;  1RAA B;  3CC4 A;  3OSV A;  4PJO E;  2LCC A;  1VYV A;  2RJF A;  1NJI C;  2NUT B;  5GAM g;  1N9R A;  4M78 D;  4OMM A;  3CD6 T;  2A28 A;  2EKO A;  1ZSZ A;  1S72 A;  1JJ2 A;  1Y07 A;  5IN1 A;  2LDM A;  5I22 A;  3JCM Q;  1H3Z A;  5GAO m;  4M78 B;  4ZGJ B;  5FWB A;  3L2V A;  2M51 A;  3JCM X;  4C0Z A;  3EFS A;  3HTR A;  4AT1 B;  2DL3 A;  1EX4 A;  1QP2 A;  1EIF A;  2KRS A;  5CR2 A;  3ER0 A;  1R0B G;  4PLI A;  1WIE A;  2X3W D;  1YJN T;  2AHJ B;  2EAY A;  4LNP A;  2OTJ Q;  3QII A;  1PHT A;  2XU8 A;  1OQK A;  4M75 D;  3CQT A;  3SHW A;  4FW2 A;  3BW1 A;  3L2Z A;  2DTO A;  1E7O A;  3EGU A;  2HCK A;  4CC4 B;  5GAN f;  1BU1 A;  4M75 B;  3JB9 H;  4OMF B;  4BE2 A;  1G83 A;  5IHK A;  1LNX A;  2L2P A;  5DLQ E;  4CI0 C;  3DKM A;  2QQR A;  1TG0 A;  5ECA A;  4C92 G;  3O5Z A;  4C0D C;  3OYE A;  4J9C A;  1OX8 A;  2K5I A;  1K9M U;  2L8D A;  3QWX X;  2RI3 A;  3OS1 A;  1OU9 A;  4JUV A;  2DJQ A;  3CPF A;  1YWO A;  2EQK A;  2MWO A;  4OB2 B;  1X27 A;  4RKU E;  3G4S T;  3EG9 A;  1VQN A;  4J9F A;  1B07 A;  4JS4 A;  3OW2 S;  2J7I A;  1SRM A;  4M77 A;  4AG2 C;  2YRV A;  2PVG B;  2JNG A;  3P8B B;  3JV3 A;  1M1F A;  3CC2 A;  4JRQ A;  3CCL Q;  1KK7 A;  2LQK A;  2J6O A;  1N6A A;  1KD1 U;  3D7S B;  5GAM f;  1IRX A;  2E64 A;  3I5R A;  2A0F B;  2ECZ A;  3EHR A;  5GAM d;  1UHC A;  2QA4 T;  2SRC A;  1A0N B;  1M27 C;  2M9U A;  3L1A A;  3LWI A;  3A8G B;  2JM9 A;  5L23 A;  2D9T A;  4HCK A;  2CSI A;  1G3W A;  1VQK T;  2K3Y A;  4D8D A;  1TUD A;  3A8L B;  4E7Z A;  2AKK A;  2AZS A;  2DL5 A;  5EG2 A;  2RHZ A;  4M4Z A;  2VV5 A;  3M53 A;  2RJE A;  1VQ6 Q;  3SWN A;  1WFW A;  3MEV A;  4F14 A;  1WNL A;  2KDS A;  1YCS B;  4M77 C;  5LJ3 j;  1WXT A;  3HRU A;  2K3X A;  3QWY A;  1VYU A;  4KBM B;  3G71 Q;  2A36 A;  4TVR A;  4Y91 A;  4DEX A;  5GAN 3;  1YJ9 A;  2E10 A;  2P0Q A;  3G6E T;  2HNI A;  3GLX A;  3CCM T;  3I9Q A;  1XTD A;  4BY6 C;  3DB4 A;  5AT1 B;  2H3J A;  3F70 A;  4GY5 A;  4Q5W A;  3J81 E;  3PVL A;  1VQ5 A;  2VGM A;  4PJO F;  2KQW A;  1M2V A;  3OBY A;  1M90 R;  4C0D B;  3E19 A;  4GLK A;  2EWN A;  1VQO Q;  3R6N A;  1M2O A;  5FWC A;  2K4Y A;  2VWF A;  3QSU A;  4RG2 A;  4B6M A;  4KH1 B;  3OYN A;  2M16 A;  1YHQ T;  1D1B A;  2D1X A;  3OSS C;  3SWN C;  3X28 B;  4C5G A;  1QQJ A;  2YXY A;  5GAO r;  1UEC A;  4FW1 A;  3A5Z B;  4M78 E;  4E7H A;  3CD6 A;  4HCB A;  2ZPG B;  5IT9 E;  2CP2 A;  4RCB A;  1VQ4 A;  2JT4 A;  1KQS A;  2J05 A;  2EGC A;  3CC4 Q;  2G3R A;  1UGV A;  2VXF A;  2MCN A;  4LE9 A;  4DA4 A;  4R55 A;  2EKH A;  3MEA A;  2B8A A;  2ZPE B;  2VC8 A;  2ZPH B;  1KQS P;  4M75 E;  2DXT A;  1S72 Q;  2JUF A;  1LVK A;  4F7U G;  4M77 D;  5KYY A;  3KXT A;  3EG9 B;  3FRN A;  1WHJ A;  1H64 1;  2FG0 A;  1X6G A;  1TTH B;  1YIT T;  4M77 B;  3WXM B;  1WHH A;  2K2V A;  1K1Z A;  3NTK A;  4Y92 A;  2DBM A;  4BY6 B;  3LGF A;  4FM4 B;  3CME T;  4QVC A;  1ARK A;  2KYB A;  4J9H A;  3DLL A;  3TEE A;  4NL2 A;  2CSQ A;  1UG1 A;  1KSW A;  2O4X A;  4BUG A;  2RF0 A;  2PZ1 A;  3M0P A;  4RG8 A;  2HMA A;  4NS5 A;  1Q86 U;  1UE9 A;  2CUD A;  1ZUU A;  4J7F A;  4PJO C;  4M7A G;  1VQN Q;  3SWN B;  3BFM A;  2XID A;  2OAU A;  2BZ8 A;  2DIQ A;  4LUE A;  4HT8 A;  2YUP A;  4JLI A;  3CCJ T;  4X1V A;  3CCV T;  2P4T A;  2QQS A;  2YRC A;  1UUE A;  2X4J A;  2O88 A;  2JXB A;  1QWF A;  2DTH A;  5KCH A;  2VXE A;  3M4G A;  1KHC A;  3OW2 A;  1BYM A;  1YN8 A;  4HCZ A;  2LT4 A;  2LCS A;  5GMK j;  1SKU B;  5CVI A;  2DVJ A;  3VS5 A;  3M54 A;  4KUI A;  2A7Y A;  3PIP A;  2E65 A;  3CPW A;  2KNB B;  4BE0 A;  4FT4 A;  2C0I A;  2DM1 A;  1M2V B;  3OW2 P;  4NOY A;  5GAN 2;  1XJW B;  2O9S A;  1QKW A;  1VA7 A;  4KH0 B;  3LH0 A;  3G6E A;  4LDU A;  3CPW P;  1N9S A;  5LJ5 j;  4CC2 A;  1N8R R;  4ZTJ A;  2ENM A;  5HK3 A;  2D0N A;  2DAQ A;  2KR3 A;  2Q1D X;  2DIG A;  1YJW A;  5J39 A;  1K73 U;  4KGV B;  2RI5 A;  1AOJ A;  1OUL A;  3FB9 A;  3JRZ A;  1AT1 B;  4E7S A;  1JJ2 S;  2Q1C X;  5KE2 A;  1QVG A;  4FYV B;  3QPH A;  2B86 A;  1YJ9 Q;  1K9M R;  2A37 A;  4ME7 A;  3GNG A;  4C8Q A;  5EC7 A;  3EH1 A;  4DOW A;  4KUD K;  1E6H A;  1ZA1 B;  3MP6 A;  3R6O A;  1YHQ A;  2GQV A;  2D6F A;  2E5K A;  2RD1 A;  1QVG P;  5GMK l;  4Z02 A;  2LX7 A;  3ZEH A;  2KXD A;  1WA7 A;  4IIO A;  1VQ5 Q;  4EMG A;  4QVD A;  4PJM A;  4X9C A;  5FRM A;  2F69 A;  3CBO A;  4PJO D;  2CP5 A;  3O8V A;  4N4I A;  3M0R A;  3ASK A;  4J9D A;  2HL3 A;  4QVZ A;  3UWN A;  2LQN A;  1IRE B;  3A1P A;  4AFU C;  3CD6 Q;  1K0X A;  3E9G A;  5KYU B;  3VS3 A;  1VQ9 T;  1BIA A;  1RUW A;  2K2M A;  4C8Q G;  3RER A;  5CQY A;  4ZN3 A;  2EQU A;  4PKC C;  4M77 E;  2J6F A;  2OX7 A;  1SPK A;  4BI8 B;  1OYX A;  3RES A;  5GAN 6;  2GGR A;  2M0Y A;  4DBQ A;  2I2L A;  1BCM A;  4A4G A;  3REA B;  3OS0 A;  2LTO A;  1YI2 T;  1GBQ A;  3FC3 A;  4C0F A;  2DYB A;  4FSX A;  4FCY A;  2QTX A;  3I56 T;  2EB4 A;  3M55 A;  2M02 A;  3OYH A;  3I35 A;  1NEG A;  1TUG B;  4FSS A;  2K5L A;  2RHY A;  5GAN e;  3CCS A;  3VV0 A;  3DLM A;  1VQM A;  1MMA A;  4F16 A;  5AYF A;  3UAT A;  3BE3 A;  2JOY A;  2EJF A;  4BAC A;  3M0S A;  1XOV A;  1M90 C;  3VS4 A;  2XKO C;  4N4H A;  3CCR T;  4PFP A;  3T9N A;  3X20 B;  4IUR A;  1OV3 A;  3CCU A;  3GIB A;  2DE0 X;  4RTX A;  5KH6 A;  2KT8 A;  2DK3 A;  1NZ9 A;  1WHM A;  2LJ3 A;  1H3H A;  1NBE B;  2MF2 A;  1CSK A;  2BE7 D;  5D2J A;  1X01 A;  1IO6 A;  4E6R A;  4E47 A;  3CCJ A;  2GTO A;  1Q82 U;  2CP3 A;  1QVF S;  3NFC A;  3ZL7 C;  5GAO n;  1WQ7 A;  2XDD A;  3P8D A;  1W2B S;  2E5Q A;  1UJY A;  4HT9 A;  2KRO A;  2QTV A;  4B9W A;  1WX6 A;  1RAD B;  4FT2 A;  2V1Q A;  4C92 F;  3CC7 A;  2F2W A;  1KC8 U;  2Z0W A;  4OMP A;  4PFZ A;  4C5E A;  1U5S A;  4RTW A;  5GAN g;  1SV6 A;  3G1J A;  1J3T A;  3A8O B;  1RAI B;  4A53 A;  5KYN A;  5IHI A;  2MWP A;  5CKB A;  1Y0M A;  2X3X D;  4CC7 A;  1RAE B;  3RDV A;  2L3P A;  4RTV A;  2V8J A;  1Q81 R;  2WSF E;  2L3Q A;  1I5O B;  4A4K A;  1M4Z A;  3VUZ A;  1ABQ A;  1C6V X;  3JCM J;  3CBP A;  3G6E Q;  1SHG A;  1S1N A;  3FJP A;  8AT1 B;  3CCM Q;  2XIC A;  1MMG A;  1JRI A;  2DFU A;  1X2K A;  5GAN 8;  1YJW Q;  1JEG A;  1SAW A;  4M7D A;  5GAM h;  1X69 A;  4ESR A;  2Q18 X;  2CRE A;  2NUZ A;  3HHT B;  3V7C A;  3QO3 A;  2FPE A;  4AFS C;  2QDL A;  1GCP A;  2HSE B;  3J7A F;  4J5Y A;  1WYX A;  4HA8 A;  3H9N A;  2RHI A;  4C92 A;  1DJ7 B;  1LCK A;  2LQ8 A;  1YHQ Q;  2R57 A;  2DIL A;  4A4E A;  3RKX A;  4M77 F;  3VS0 A;  2DD4 A;  4XU2 A;  2AIR B;  1VQ7 T;  2RQU A;  3GPL A;  3LW5 E;  5CKH A;  2KT1 A;  1VQ9 A;  1NPR A;  1G3S A;  1Y7X A;  1JJ2 P;  3RMS A;  2M0O A;  2YUO A;  4MAQ A;  1MV0 B;  1OZ3 A;  2EBP A;  3FIF A;  4OP0 A;  1K0S A;  2PQW A;  4M7D G;  1OEB A;  3CCQ A;  4YTL A;  3NTI A;  4VUB A;  2EGE A;  5GAN d;  1OPK A;  4IKF A;  2ZPB B;  2OI3 A;  3CMA T;  4J9I A;  2ROL A;  4C92 C;  1HK9 A;  1TWB A;  1ZSZ C;  1N8R C;  2LC4 A;  2QQA A;  2XDB A;  1GFD A;  2L3S A;  1QW1 A;  1RAH B;  1YIT Q;  3V8L A;  1K73 R;  1K4U S;  2QQ9 A;  4HXJ A;  4O5V A;  1RLQ C;  5I11 A;  1YWP A;  4OVA A;  4PNO A;  4PJJ A;  1OOT A;  2QYZ A;  2HL5 C;  3M0Q A;  1ZHI A;  1K9M C;  2Q1A X;  1K9A A;  2JM8 A;  3HSB A;  3QKJ A;  4OF1 A;  2Q19 X;  2FPD A;  2F5K A;  3CCS Q;  3DB3 A;  3CPW S;  1VQM Q;  3J80 E;  2E6N A;  2HQE A;  1X43 A;  1EZZ B;  4L59 A;  3EG3 A;  3MHX A;  3NGP A;  1ZLM A;  5A2Q E;  2DJZ A;  2XDP A;  2DLP A;  4ZGD B;  2RHX A;  4AG1 C;  3OQ5 A;  1M8M A;  1KQ1 A;  3LH5 A;  1IGQ A;  2EVR A;  3OY9 A;  2WSC E;  4ORZ A;  3ULR B;  3CCU Q;  3BY7 A;  2RJD A;  1ZUY A;  3PE0 A;  3RKY A;  2HKQ B;  4QQD A;  1IXD A;  4EDU A;  1TUC A;  3E1S A;  2XMF A;  1OI1 A;  4C8Q E;  2DBK A;  1QVG S;  3OYA A;  1HD3 A;  3V8K A;  4PJL A;  3CCJ Q;  3EGX A;  2VYT A;  9ATC B;  3CCE T;  2KSS A;  5KYW A;  1PC0 A;  3M0U A;  5GMK i;  3SB2 A;  3JB9 G;  4JJB A;  1ZBJ A;  1K8A U;  1FWZ A;  4D8K A;  2KMT A;  2HEQ A;  3PFS A;  2EW3 A;  2RMO A;  2XI9 A;  4OGE A;  2L89 A;  3CC7 Q;  1QVF A;  4E2F B;  5CQX A;  1AEY A;  3VS1 A;  1W2B A;  2RM4 A;  4C92 D;  4JJN K;  2DA9 A;  2ZPI B;  4ANJ A;  3OYG A;  3RIR A;  3OYJ A;  4C92 B;  1QVF P;  4M7A F;  1H8K A;  2GBQ A;  1W2B P;  1ZSZ B;  3C94 A;  2G6F X;  1X75 C;  3VS6 A;  2CZ1 B;  4J6Y A;  3Q1J A;  3I5S A;  1JU5 C;  3BQB A;  4F7U A;  3OBW A;  1VQ8 T;  1Y57 A;  5FLX E;  2GQI A;  3OS2 A;  4ZTF A;  1B3Q A;  5D2H A;  4XTU A;  4JJD A;  3KUF A;  3QJ6 A;  2QK0 A;  2EYW A;  1U8R A;  2LP5 A;  1D1C A;  3H6Z A;  1UGS B;  2YHT A;  2DL8 A;  1ZBX A;  1R8O B;  1EFN A;  1AWX A;  2A3L A;  2IVW A;  4C0G A;  3PMT A;  2LRQ A;  3EG2 A;  1X6B A;  1WJQ A;  2E12 A;  2FZG B;  1YJN A;  1WLP B;  4II1 A;  1PD0 A;  1LJO A;  4OMQ A;  1ACM B;  3SFM A;  3PVQ A;  2FB7 A;  3TQ7 P;  3HKS A;  2WQT A;  2OTJ T;  1AWO A;  4BI4 A;  1IB8 A;  5M9O A;  3P8H A;  1VQ9 Q;  2PVD B;  1KC8 R;  2EGA A;  1FXX A;  4M7A A;  5GJW B;  2CP6 A;  4WTO B;  3GF5 A;  2CKK A;  2K57 A;  2CP7 A;  2L0A A;  2CS7 A;  3OYI A;  2WAC A;  2W10 A;  1T0J A;  1YP5 A;  1QCF A;  3CCQ Q;  2GFU A;  2DPP B;  1WQW A;  1WPY A;  3JCM c;  3G4S A;  1Q81 C;  3ZFJ A;  1MGQ A;  3LLR A;  1YI2 Q;  3QZ9 B;  3JCM V;  1B7T A;  2Y4Y A;  1UB4 A;  2EYZ A;  4BE1 A;  4MML A;  4E7J A;  4PL6 A;  2Y4X A;  5A0G A;  3EG1 A;  2JTE A;  4FL6 A;  2MMP A;  1UFF A;  5IXB A;  4R0K A;  1Q7Y U;  1TU0 B;  1Z9Z A;  2QGG A;  3UDC A;  4L5G A;  1UGQ B;  4M7A C;  2QA4 A;  3EGX B;  1GBR A;  4K11 A;  4C8Q F;  2KE9 A;  1SRL A;  2VVK A;  3L2W A;  1P92 A;  1PRL C;  3KBG A;  1JBM A;  1VQK A;  1BKB A;  1VQP T;  3MEW A;  3MJX A;  4PJO G;  2M1H A;  3FLG A;  4HVV A;  2DET A;  5DM7 R;  5GAN 7;  3RBB B;  4KRT A;  3C95 A;  2J06 A;  3PGG A;  4M7D E;  2KYM A;  1WJR A;  2CP0 A;  4KGX B;  3INZ A;  4OB1 B;  1YIJ T;  1QWE A;  1V1C A;  2K6D A;  5IAY A;  2COW A;  3CCM A;  2DF6 A;  2DXB A;  1W70 A;  1U3O A;  2HZY A;  3G71 T;  3S52 A;  3PT9 A;  4F7U B;  4C92 E;  2L3R A;  2F1L A;  1KFZ A;  1UGP B;  2RK1 A;  1HSQ A;  2NWM A;  4P5N A;  5FU6 C;  2NUP A;  4GLM A;  1F1B B;  2E6Z A;  4J6X A;  2C06 A;  2VAS A;  1YNZ A;  3QDF A;  1X6O A;  1NE8 A;  3EH2 A;  3FJ5 A;  2XG8 D;  1NYG A;  5GAM j;  1K73 C;  1H92 A;  4XTZ A;  1VQ8 A;  4EMK A;  2OAW A;  5GAN 5;  1VQO T;  4J9B A;  3TU4 K;  3OYF A;  1TS9 A;  3QYH B;  3JSC A;  5LJ3 g;  2OTL T;  1SF9 A;  1BI2 A;  1KG1 A;  2PVO B;  3MEU A;  2X51 A;  2QEX T;  5GAN 4;  4M7A D;  2LQW A;  2CZ6 B;  4OMN A;  1D3B A;  1KD1 R;  2FZC B;  5KYY B;  2KEA A;  4M7A B;  4DBR A;  5D2I A;  3EFO A;  3LWH A;  2GCX A;  2C0O A;  3CC4 T;  1I7O A;  2FHD A;  1IHW A;  2EPD A;  3V77 A;  4XU1 A;  4PK4 A;  2GTJ A;  3JCM b;  4C8Q C;  2XD0 A;  1RI0 A;  2DD5 A;  1M8V A;  3S6W A;  2QDY B;  1SSH A;  4EMK C;  1S72 T;  4MMK A;  3VU3 C;  4NL3 A;  3OMG A;  2DRM A;  3AT1 B;  3BDU A;  3VRY A;  2RN8 A;  1YIT A;  1YJN Q;  1Y96 A;  3M59 A;  4N4G A;  3E2U A;  1PKS A;  5CCA A;  1FYN A;  2XK0 A;  1Z9Q A;  5KCO A;  2JMC A;  3VJP A;  4A63 B;  1K8A R;  2O4X B;  1UEB A;  5FU7 C;  3QXE B;  2GFA A;  1SSF A;  2QAZ A;  2E41 A;  2CDT A;  3VRZ A;  3CME A;  2PUO B;  1NPP A;  5FU6 B;  4MZT A;  4LDV A;  2CT4 A;  2X35 A;  2E3I A;  1IZ6 A;  3C0C A;  1W6X A;  4CRI A;  1BBZ A;  1E6G A;  4J8O A;  4JPB W;  5LJ3 f;  1QLY A;  5A0L A;  2K79 A;  1RAG B;  4LD6 A;  3G4S Q;  5LJ3 d;  2JJ9 A;  1PCX A;  2JVV A;  2ZZD A;  5GMK e;  1FMW A;  2LNV A;  2JS2 A;  3NPF A;  4M75 A;  3I55 T;  2EYQ A;  2X4W A;  1W1F A;  1BK2 A;  1VQN T;  2PU9 B;  2FL7 A;  1VQP A;  3CCV A;  3VKI A;  4M7D F;  2KRN A;  3TVT A;  1C0M A;  2AT1 B;  3OS5 A;  2MIO A;  3JCM e;  1RL2 A;  1CKB A;  3CC2 T;  2RQV A;  2QA4 Q;  2YWW A;  5LJ5 e;  4M78 G;  3L42 A;  1G2B A;  5GAN h;  2JN0 A;  2EQM A;  2NUP B;  4OMO A;  5D7U A;  1JXO A;  4C8Q D;  2PUK B;  5GAO l;  2P4R A;  4AFZ C;  1YIJ A;  2PNI A;  3S3M A;  4F7U E;  1VQK Q;  5FRN A;  1M1K U;  4FYX B;  3NHN A;  2NLU A;  4C8Q B;  2X4Y A;  5I2M A;  4FIB A;  1OPL A;  1WDX A;  4EMK B;  4JS5 A;  3CBM A;  1KC8 C;  4M75 G;  5HCK A;  4RUG A;  3UT1 A;  1YCY A;  4DBF A;  5D2F A;  4XTW A;  2MYS A;  3M57 A;  4RTU A;  1ZSG A;  1VQL T;  1Q95 G;  1NKQ A;  2V8I A;  2LNH B;  4ZN1 A;  3HFN A;  4JLG A;  1XNI A;  4XTY A;  5FU7 B;  4DQ2 A;  2CGH A;  3UF4 A;  4UC4 A;  1YJ9 T;  2DO3 A;  1GL5 A;  2BUD A;  2E3H A;  1ZQ1 A;  3OYL A;  2D8H A;  3PIO A;  2YDL A;  2QEX A;  2KBT A;  5KE3 A;  1SEM A;  3JCM g;  1JB0 E;  2DEU A;  4M7A E;  2D0Q B;  1JO8 A;  1OX9 A;  4IIM A;  1FMK A;  3EGD A;  1PG5 B;  1VQ5 T;  5LJ5 g;  3S3N A;  4LDX A;  4R56 A;  1ZUK A;  4BB7 A;  1NJI U;  4B9X A;  1W4S A;  3HPW A;  1Q7Y R;  3M0T A;  1VQ8 Q;  1Q86 R;  4JRI A;  1MNE A;  2HBW A;  3JB9 I;  3JB9 F;  1NM7 A;  1Y96 B;  4EPC A;  4ZGE B;  4RCC A;  4C5I A;  2K3B A;  2Y90 A;  1OU8 A;  3JAM E;  1R77 A;  4E7L A;  5D6Y A;  4OB0 B;  5I2S A;  1HXD A;  2FYK A;  2LCL A;  2DX1 A;  2OJ2 A;  1SG5 A;  1QMC A;  5GAO q;  1ABO A;  3HRT A;  4ZNX A;  3OYB A;  4L6V 5;  2JTF A;  1VQ4 T;  1I1J A;  1WXU A;  5D2K A;  3VS7 A;  4M7D C;  2DZ9 A;  2ED0 A;  4J7I A;  1V76 A;  2RHU A;  4QT7 A;  4OB3 B;  1GCQ A;  2RPN A;  1YI2 A;  4BDZ A;  4FYY B;  1N5Z A;  1NEB A;  3I56 A;  1D0Z A;  3LYI A;  3WVD B;  4MZM A;  2DRK A;  4LD9 K;  2BIV A;  1N8R U;  2O9V A;  2DKG A;  2WSE E;  1ZX6 A;  2RJC A;  4DEY A;  4ELY C;  3UA7 A;  4WF2 A;  1RLP C;  4QW2 A;  4XQ3 A;  2RQW A;  1QKX A;  4X34 A;  3CCR A;  2O01 E;  2A08 A;  2MAM A;  3TSW A;  3GP8 A;  3RUX A;  2IG0 A;  4HCC A;  3CME Q;  4IUT A;  3JCM f;  5CIU A;  2ED1 A;  3EAE A;  1N27 A;  3I55 A;  4E7I A;  3JCM d;  5LJ5 f;  2E1H A;  1GCQ C;  2V8K A;  4X9D A;  4MDX A;  3VYH B;  5GAO p;  5LJ5 d;  2EB6 A;  4KGZ B;  4LN2 A;  2E70 A;  1T3S A;  1BI3 A;  2FPF A;  1X2Q A;  2K5F A;  1BI1 A;  2KK4 A;  4PJN A;  2ATC B;  4F7U F;  3REB B;  1KD1 C;  2EYX A;  3EFR A;  3VYG A;  5FRO A;  2YUN A;  1G5V A;  1CKA A;  1BB9 A;  3OA6 A;  1WHK A;  3ME9 A;  2ZGW A;  1QCN A;  1JQQ A;  3OYK A;  5CKF A;  3L2U A;  4IUV A;  3MKD A;  1VQP Q;  3CCV Q;  5FW9 A;  4DBH A;  5HK0 A;  2CZ7 B;  1QP3 A;  4M7D D;  5IHN A;  1GTT A;  4QQG A;  5CKD A;  2DMO A;  2CZ0 B;  1M30 A;  4M7D B;  2V26 A;  2RB6 A;  1MV3 A;  1VQL A;  1YIJ Q;  1NG2 A;  2BZY A;  1K8A C;  4M77 G;  4HVW A;  3EGD B;  3BDL A;  4JJC A;  2YSQ A;  2MOX A;  2CH4 A; 
#chains in the Genus database with same CATH homology
 3RR6 A;  2WQT A;  2DFU A;  3R6O A;  2HZY A;  3S52 A;  1HYO A;  1WZO A;  5D2K A;  1SAW A;  4QKU A;  2Q1D X;  3BQB A;  1QCN A;  5D2I A;  2EB5 A;  2Q18 X;  2EB6 A;  4DBF A;  1QQJ A;  4PFZ A;  5D2G A;  1I7O A;  5D2F A;  5D2J A;  5D2H A;  4DBH A;  2Q1C X;  2Q1A X;  1NKQ A;  1QCO A;  1NR9 A;  3LZK A;  3QDF A;  3V77 A;  1SV6 A;  2Q19 X;  4MAQ A;  1GTT A;  2EB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...