4PFZA

X-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
250
Chain Sequence
b'MRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVRLLAPILASKVIAVGKNYAAHVAPEDPVIFLKPNTAIIGPNVPIQLPADADPVHHEGELAIVIGRPCKDVPAARAAEFILGYTIGNDVSARDQQRKDGQWMRAKGHDTFCPLGPWIVTDLDPSDVELRTEVNGQVRQRSRTSLLLHDIGRLVEWTSAVMTLLPGDVILTGTPEGVGPIEDGDTVSITVEGIGTLTNPVVRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-carboxymethyl-2-hydroxymuconate delta-isomerase
publication title X-ray Crystal Structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
total genus 65
structure length 250
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4pfzA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4pfzA02
5D2JA 1GTTA 3S52A 1QQJA 2HZYA 2Q1AX 5D2HA 2Q1CX 2Q18X 2EB4A 4MAQA 2Q19X 3V77A 2WQTA 2Q1DX 3LZKA 5D2FA 4DBFA 1NR9A 1SAWA 3QDFA 1HYOA 5D2KA 3RR6A 4PFZA 5D2GA 1QCOA 3R6OA 4DBHA 1SV6A 1I7OA 1NKQA 4QKUA 3BQBA 1WZOA 2EB5A 2DFUA 5D2IA 1QCNA 2EB6A
chains in the Genus database with same CATH superfamily
1AWJA 3M0QA 3RBBB 3PFSA 1VUBA 4KGVB 3X28B 3RNJA 3EG1A 3EH2A 5GMKm 5GAMj 3GBQA 3OS2A 4M77A 3H8ZA 4F7UG 1O75A 1RAIB 4MMLA 3FJ5A 1VQLQ 1UJ0A 2LX9A 1Q82U 2P4RA 3OYHA 1SKUB 3HSBA 3LX7A 2K6DA 4LNPA 2CP3A 2DL7A 2ZPEB 1ZBJA 2ROTA 5FRMA 1YCYA 1RAAB 3QO3A 3RKWA 3OMGA 2FVUA 2QGFB 3FDRA 1SHFA 3AT1B 3J80E 1VQOQ 1SSHA 4RCCA 1TOVA 4FM4B 5KYXA 1B7TA 2NUTB 1K9AA 1M30A 3CCJA 1YCSB 1X6BA 2AT1B 4BI8B 2O88A 2PZ1A 3S3OA 4RTUA 1WHMA 3I56Q 4A4KA 4GY5A 3EG2A 1A0NB 2K5FA 1UGVA 2KGTA 2Z0WA 4KH0B 2YUPA 1V76A 1X75C 2A36A 2CZ1B 2R5AA 5CO7A 4OMFB 2FPDA 3FIFA 5D2IA 2CH4W 5GJVB 1M1FA 2CUBA 2LVMA 1W2BS 4ELZC 3DKMA 2CP2A 2Y4XA 1FMKA 3P8DA 4PJOB 1BI1A 3CCJT 1UHCA 4M77F 4M4ZA 2XK0A 5GAMd 2DRKA 2SEMA 3GNGA 2DILA 3JB9D 2RD1A 2QI2A 1BI0A 4XTXA 2X4WA 3EGDB 3JCMc 4L59A 3KUFA 3CD6A 2DYBA 3EFSA 5I11A 3O5ZA 1M27C 4M78C 2K79A 1QVGA 1QVFS 1VQKA 1VYVA 4FCYA 1UJYA 2X4YA 4C8QD 2J06A 1NPRA 3P8BB 2M1HA 1Q7YC 3H9NA 4M77B 3CPWA 4JZ4A 4M7AA 1W70A 2E1HA 1PNJA 3MHXA 2QQSA 4IIOA 3INZA 3HPWA 3OYFA 3MP1A 1QMCA 3CCRQ 3EGXA 4J9CA 2NYSA 5D6WA 1K1ZA 4DEXA 2NUPA 1ZLMA 5KYXB 1QKWA 4JS5A 2VC8A 2DIQA 3H0HA 1K0XA 1PM3A 4BI4A 1VQKT 3CCVA 1RLPC 2OJ2A 3OB9A 5GAN7 1WI7A 1YJWA 2XU8A 2ZPHB 5FWBA 5GANg 1IGUA 2RQWA 4E7LA 2IVWA 1N8RC 2L0AA 2EB5A 5C6SA 2E64A 4EMHA 1GFDA 2JS2A 5LJ3e 2D6FA 1MV0B 3I55A 2KBTA 3E19A 4RG8A 4ZTJA 3A1PA 2JZ2A 2JTMA 2QQBA 5GAOr 5FU6C 5CQYA 2DNUA 5IHIA 2EBPA 5LJ3j 3S3MA 2K7AA 4BDYA 3JCMg 4J6YA 1YJ9A 4M7AF 3EG0A 2OTLA 1JXMA 5IXBA 2DAQA 3JCMJ 2DZCA 2LDMA 3CCVT 1KC8C 1VQMA 3PGGA 1VA7A 2L3SA 1SEMA 2D9TA 1YJWT 2EW3A 3G6EQ 1JRIA 3CMAQ 1NJIR 1Q86U 4PFZA 3V8KA 4M78E 2HNIA 3KBGA 3SWNA 1ZA2B 2MI6A 2LQWA 2KYBA 6AT1B 1K8AU 1VOMA 4M75A 1PSFA 5FU7B 2GBQA 2ZPIB 3L2RA 4OMOA 1BCMA 4OMLA 4EDUA 3CCMA 1PD0A 4M7AB 1BIBA 5HY6A 1KD1U 4LXCA 1TSFA 2YRCA 2F1LA 2RI2A 4FSSA 4KGXB 4UC4A 5LJ5f 3CC7T 1PG5B 2J6KA 3J7AF 2HKNA 1IRXA 2VB6A 2XMFA 4C92C 1YJ9T 3OSSC 2OTLT 1G2BA 2FEIA 1VQNA 3MP6A 2KROA 2KR3A 2DO3A 1VQMT 2NUPB 3E2UA 1N27A 1QP3A 2CS7A 1BU1A 3VV0A 2AZSA 1NLPC 1WHLA 3M54A 4RTXA 5LJ3d 1MNDA 5KH6A 1WXTA 1KJWA 2Y90A 3CCMT 2AIRB 1I07A 1WHGA 3MJXA 3I5RA 3EFRA 2B86A 4XU0A 4HCZA 4EIKA 3JCMW 3KFVA 5I2SA 4X34A 4XU1A 4XTVA 3G71Q 1VQNT 1RAHB 2KRSA 3M55A 3PNWC 2LJ0A 1QWFA 2AHJB 4M75F 4VUBA 4F16A 1LPLA 2CP5A 4RKUE 3OYEA 3REBB 3PVLA 3M53A 2K5LA 2XHCA 4RTTA 2DX1A 2O31A 2YRVA 4F7UA 3RERA 3JCMh 3L42A 3CC4A 3UT1A 1ZUUA 4II1A 4XQ3A 2PVGB 3SWNB 2G6FX 2HZYA 4DBRA 2PVOB 2L3QA 4M75B 3I35A 4B6MA 3BDUA 4BUGA 1D1BA 3CC7Q 2LQ8A 2COZA 1YI2A 1WHKA 3VUZA 4F7UE 2G3RA 2JM9A 4XTWA 2FG0A 4CRIA 1W6XA 3QDRB 1I7OA 1XNIA 1OX9A 1Q81R 1I1JA 3EG9A 2DXBA 1R8OB 1K76A 3QG1A 3NGPA 1X6OA 2Q1AX 4C92E 4IUTA 5EC7A 1TS9A 2YXYA 1K9MR 1WJSA 2NLUA 2Q19X 4FYYB 3V77A 3META 3G4SA 2L8DA 4OB0B 2L5QA 3ZBDA 1V1CA 3VS7A 3CXCA 1U5SA 2L2PA 5A2QE 3CC4T 2EKOA 2KQWA 1OI1A 1RADB 3CCEA 5DLQE 5GAN8 1QVGP 4F04B 1NLOC 2HL3A 2HD0A 1YI2T 4OB3B 1M1GA 1R0CB 3LGLA 1NEGA 3CCQQ 4L5GA 2ZGWA 1M8MA 2RHYA 5GMKh 3CEYA 2CYZB 2VGNA 2X51A 4QQGA 2E5QA 1UECA 1JJ2A 1OU9A 1VQLA 4RTVA 4AT1B 5GANj 1MGQA 4J7IA 2JW4A 4AFSC 2LTOA 3G4ST 1IZ6A 2HQHA 1IHVA 2DJQA 1GCQC 1AZGB 3JCMe 4M7DA 2RK2A 4DOWA 1XJWB 1VQOA 3PE0A 2EJGA 2K9GA 3CCET 3RIRA 1M4ZA 1M3CA 2X4JA 4QW2A 4MDWA 2CP0A 5D2JA 5DLOA 1GFCA 1Q95G 3I56A 5CKHA 5GAMh 3GOXA 2QASA 2WACA 3VRZA 1H8KA 1I81A 1BKBA 1IXDA 3RR6A 3UWNA 1I5LA 3JB9I 4JPBW 3EFOB 1YN8A 4M77C 5M9OA 1VQLT 3HL8A 3X24B 2HBWA 1Q82R 2F2WA 3PTAA 4ORZA 2EQUA 3QYGB 1GRIA 5CK9A 5CKBA 1OYXA 2NUTA 3NPFA 4NS5A 5AYFA 3JCMX 1ABQA 1Z9ZA 1VQOT 3CMET 1WNLA 1VQ6Q 3OBWA 5DM7R 1GBQA 1YIJQ 2VUBA 3DLLA 2X9HA 4D6WA 4E7SA 5GAN2 3I56T 1OU8A 2L3RA 5GANd 1EZZB 2H3EB 3EG3A 1EX4A 2DIGA 2LP5A 4PFPA 4F17A 4XAXB 5GMKe 1VQ8T 4M7DF 1NR9A 2V1RA 2J05A 4QVZA 3MO8A 1EFNA 3JV3A 3OS0A 2MPXC 1PD1A 3BE3A 3MEUA 1GBRA 2GTOA 5GMKj 2KSSA 4X9DA 1EIFA 1GCQA 2KXCA 2P0QA 4A4HA 5DY9A 3JCMd 3QPHA 4IUVA 1MV3A 4WCIA 4CC4B 5KYUA 2V1QA 3EHQA 5D2FA 2YUNA 1R77A 3A98A 4HVUA 2LC4A 1AVZC 2XI9A 3CCRA 4CC2A 4M7DB 3M0RA 5GAMe 2RI3A 4ANJA 1IREB 4PJOE 2QEXQ 3JB9H 1BK2A 4AFQC 1QQJA 3CBMA 3MPUB 3UF4A 3QWYA 2A7YA 2C06A 2ZCFB 4M78D 1AT1B 2COYA 4LDWA 3ZEHA 2V8KA 2M9UA 4EMGA 4J9HA 1ZQ1A 3M4GA 1VQ9Q 2A3LA 5D2GA 2RHIA 3AHUA 4J9BA 3GIBA 5A0LA 2DRMA 5FU7C 5GAOn 1AZEA 4OVAA 4AMCA 2Q18X 4DA4A 4M7AC 4O5VA 3NTKA 2WQTA 4M77E 1ARKA 2YUQA 1OQKA 3CMEQ 5KYNA 3C12A 2F5KA 1K73C 4OMQA 1HXDA 2HSPA 4LDVA 3CCRT 2X3XD 4OB1B 1M90C 4EMKB 3MKDA 1XQHA 5A0DA 2W10A 3SD4A 1BIAA 1PC0A 2RJEA 4IUUA 1Q7YU 3ER0A 3RKYA 2KRMA 4LN2A 4Z89A 2K2MA 2IG0A 2EJ9A 1VQ8Q 3G1JA 1WA7A 4E47A 4KUIA 4ZGDB 2E41A 4KGZB 2FZGB 4PK4A 4ELYC 3G6EA 2AK5A 3CMAA 1TH7A 2KDSA 3DB3A 3RMSA 4V2SA 2XG8D 1ACMB 2YUOA 3LW5E 1TU0B 1U06A 2RH2A 3FEOA 4ATOA 2MMPA 1QVFA 2DXTA 4MAQA 5LJ3h 4ME7A 2PQWA 1UGSB 4AFZC 1KQSA 5HK3A 2LJ1A 5IAYA 1VQ5Q 5KYUB 1FMWA 3GPLA 2RF0A 2VXFA 4MZMA 1YWPA 2JUFA 1G3WA 4Y91A 4RTYA 5CAIA 1N8RU 1G8XA 5GAOp 3OYIA 5KE2A 1Z9QA 1ZA1B 5LJ5g 3D7SB 2KEAA 4M7DG 1R0BG 2CT3A 3VUBA 3G6ET 2JM8A 3CMAT 1KFZA 3PT9A 4QVDA 1Q86R 4PLIA 2HBPA 1S72Q 1QW1A 3TU4K 4J8OA 4Y28E 3SWNC 1K8AR 5L23A 1RACB 4OP0A 5FW9A 2CUDA 4B9XA 2R58A 1YJNQ 2KXDA 4M75C 3L2WA 3QSUA 2JMCA 1KD1R 1KC8U 3LYIA 2JMAA 3TQ7P 2DJZA 3ZFJA 2DD5A 4M7AE 1YNZA 2DLPA 1M1KC 1JJ2P 4C92D 2HSEB 4ESRA 3S52A 3G71A 2LT4A 1MMDA 2LCSA 1QVGS 2DBMA 2QAZA 4A4FA 1KHIA 1IGQA 2EPDA 2QGGA 3RUXA 3QXEB 3M4YA 3QYHB 3OYBA 4BE0A 5I21A 2DKGA 3T9NA 2YLCA 2CZ6B 5GAN4 4ZNXA 1RUWA 1NEBA 2D0NA 3S6WA 1WFWA 3VS1A 2JTFA 3QZ9B 1QKXA 4XTZA 1X69A 3LH0A 4OMMA 2DF6A 3CC7A 5CKFA 1V29B 1G5VA 3SHWA 1TTHB 2O9VA 3JRZA 1QCNA 2A08A 3G71T 1ZSZC 3CCST 2LNHB 4EPCA 1CKAA 4LDYA 4PLLA 4QT7A 4FW2A 1NYFA 4BDZA 3DB4A 5L8RE 2PVDB 4A53A 2WSCE 2PUOB 1VYTA 3OYKA 4R0KA 2SRCA 3GP8A 2HAXA 1OEBA 1IO6A 2B8AA 4KRTA 3BY7A 3QJYA 1N9SA 2KRNA 5GAOl 2QQRA 2VWFA 1PRMC 1PKSA 3THKA 1N6AA 2RI5A 3MEAA 4J9GA 2Q1DX 2ED0A 3LGFA 2CT4A 2LMJA 5ECAA 2DL5A 5J26A 2XDBA 4HVWA 3NTIA 3VYHB 3CCQA 1VQ7Q 4M75E 2KE9A 5GJWB 3EHRA 4IKFA 1I8FA 1X27A 3E9FA 3QZ5B 1OZ3A 5IN1A 3E1SA 1TWBA 5GAN3 2OTJQ 1JU5C 3WVEB 1G3SA 3VRYA 4DQ2A 3LLRA 8ATCB 5D6XA 5IHNA 2DVJA 5KYWB 1UTIA 2LJ3A 5CR2A 1RABB 5CKEA 2DK3A 4E2FB 1MNEA 1UE9A 5D7UA 2DXCA 3OW2A 2LX7A 2WSEE 3UPUA 4LD6A 2KT1A 5GAOm 2F2VA 3CCQT 2VGMA 1ZSZA 1LVKA 5GANh 3CBPA 2FB7A 3CCSQ 2KAFA 1M3AA 4YTLA 1VYUA 2OI3A 3JCMP 2QA4Q 3PMIA 4PJMA 3HKSA 3UA7A 2FO0A 1Y71A 2E6ZA 3CBOA 4BE2A 2L3PA 1T3SA 1U1SA 3BW1A 4J9FA 4PJOD 3R6OA 3HHTB 2K5IA 4M7DC 3OYDA 2FHDA 1VQ6A 2JVVA 3V7CA 2DL4A 2I2LA 4C8QA 4HCCA 1YIJA 5LJ5e 2LCCA 1OX8A 5GMKi 2PNIA 3E9GA 3BDLA 1TUCA 2L89A 3C0CA 2EIFA 2LRQA 1PWTA 2CZ0B 1AWWA 3EFOA 1VQ4Q 3P8HA 3VS0A 4J7FA 3I55Q 3JCMf 5LJ5j 2JNGA 3TVTA 4ZGEB 3GLXA 3M57A 5CCAA 1TUGB 2HDAA 2RHZA 4M77D 3V8LA 4C0DB 2QDLA 2VV5A 4FT2A 4BI3A 1KQSP 1QCFA 4GLKA 5GAOq 4A54A 4N4GA 3I5SA 1Y57A 4JJNK 3A8OB 2BTTA 4MDXA 1VQ6T 2LQKA 3QWXX 4EMKC 2COWA 2DEUA 1YIJT 4N0AC 3JB9F 1QWEA 2QEXA 1VIFA 1YITQ 4FYXB 3FC3A 2DXUA 1ZX6A 3HFOA 5GANe 2CP6A 2K3YA 1I0CA 3VYGA 1TUDA 2MF2A 2KVQG 2KY9A 2FRYA 3OQ5A 2BIVA 1NZ9A 2FZCB 5IHKA 2BE7D 3CPWP 3M58A 2RJDA 2KNBB 3QBYA 1VQ9A 1ZSZB 4C8QF 1FYNA 1NE8A 2XKOC 2QXFA 1G3YA 3V8JA 2RHUA 1CSKA 4QVCA 3X26B 1NJIC 4J9IA 4RG2A 2BKDN 4PJLA 2AZVA 2DL8A 2Q1CX 4P5NA 3HRUA 4XK8E 1D0ZA 3LZKA 1I4K1 1YFNA 2EGCA 3CMEA 1H641 3ASKA 5LJ5d 3BQBA 3OYYA 5FLXE 2BZ8A 1AWOA 2ENMA 4XTUA 2VKNA 3L2UA 2GTJA 2ESWA 2QEXT 3M0PA 1WQ7A 1LOJA 1D1AA 3OYMA 4C8QB 4M7DE 5A0GA 3CCLQ 4PJJA 2K3BA 3EH1A 3HTRA 5C0MA 1H92A 3UATA 1VQ8A 3RESA 1LCKA 2RJFA 3MCAB 4M78G 4FSXA 1VQ9T 7AT1B 1YHQQ 2YT6A 1RAGB 2ROLA 1WIEA 4J83A 5GAMf 4JDSA 1LJOA 2KT8A 4GBQA 2H8HA 4J6XA 2FZKB 3Q1JA 1U8RA 2GCXA 3OMCA 2P4TA 3S3NA 4M7AD 2VVKA 4EMKA 2NUZA 4JRQA 4RTZA 1VQPT 1Q81U 1N9RA 2E5KA 4N0AA 2I0NA 1VQ5A 2DFUA 2RA2A 2JT4A 2D0QB 4IUPA 4BACA 4KT0E 3H0FA 4HVVA 4HT8A 4ZGJB 2DZ9A 3JB9J 4FYWB 3N5BB 4Z88A 1SRMA 1Q7YR 1BB9A 3A8GB 2EQKA 3M0SA 5GAN5 5HCKA 4A4EA 3ULRB 3M59A 1NM7A 2HEQA 1K73U 4HCKA 2FL7A 2O9SA 2EGAA 1T0JA 1WQWA 2O4XB 2XICA 1RLQC 3QKJA 1M90U 1OULA 1S72A 1MMAA 4JJBA 2ZAEA 4HXJA 4QQ6A 1YJNA 2ED1A 1E7OA 1VQ5T 4QKUA 2EYQA 5I22A 4C5HA 4PNOA 1HSQA 2FPEA 3G7ZA 3OYJA 1HJDA 3VS4A 3JB9G 5HK0A 2RHXA 1N8RR 1Q81C 2BUDA 2EGEA 3OYNA 1NBEB 2X3WD 1JEGA 1JQQA 3CC2T 1WGSA 1Y96B 4RUGA 2EJFA 1KG1A 1K4US 2VASA 1K9MC 5KCOA 2LCLA 2ECZA 4E7ZA 2AKLA 2D8JA 3KXTA 4LDXA 2CZ7B 4C8QG 1S72T 4B9WA 2M0YA 3A8MB 2V26A 3RMQA 4C0FA 1MMGA 3OW2P 1Y07A 3ME9A 3REAB 3CCUQ 4IUQA 2MIOA 2XD0A 1D3BA 1YJNT 3JAME 3UA6A 4E7JA 2DA9A 5IXFA 1X2QA 4M75D 1YBYA 1OOTA 2QDYB 1VQPQ 2RK1A 1KC8R 4BY6B 2RB6A 1MHNA 2YRDA 1WHHA 4JRKA 2J6OA 3NHNA 2F2XA 1WPYA 1I5OB 4C5IA 4C0ZA 4N4HA 1W2BA 4C92G 4R56A 1M2VA 1RAEB 3A8LB 4WTOB 3UDCA 1H3ZA 1B07A 2PUKB 1UFFA 3LH5A 8AT1B 4JRIA 4R55A 4KUDK 4PJOF 2MWPA 4FYVB 2DPPB 4X1VA 2K3XA 1WJRA 2A28A 5AT1B 3JSCA 1M8VA 1M1KU 1BI3A 4NL3A 5IH2A 1O9SA 1W1FA 3H0IA 3QUIA 4MZPA 2VXEA 2DERA 5HKCA 1WXUA 3HFNA 2QQAA 1HD3A 2EWNA 2JN0A 1VQ7A 4FL6A 1SF9A 1QVPA 1H3HA 3OA6A 3FJPA 3TEEA 2M16A 5LJ3f 2MCNA 1BYMA 2YWWA 4IURA 1ABOA 2FPFA 1PCXA 4C5GA 4JUVA 4D8KA 2DMOA 4WF2A 1Q82C 3CC2Q 2OTJA 2EQMA 4XU3A 2LQNA 2KMTA 2EAYA 3RDVA 2GFAA 2RPNA 5CQXA 3CXCP 2M0OA 3C4SA 2OAWA 2H3JA 1UEBA 4E7IA 2RM4A 1B3QA 1ZHIA 1OPKA 2ABLA 4GLMA 1OPLA 3LWIA 1KQSS 5CKDA 4AFUC 5D6YA 1TG0A 3F70A 3R6NA 3O8VA 1D3BB 4FU6A 1D1CA 1DJ7B 1GCPA 1KK7A 4BE1A 3C94A 1VQ7T 4JJDA 3QHSA 3WXMB 2ZZDA 1RAFB 3CCSA 2JOYA 4BD3A 4HA8A 1X43A 4C0DC 4J9EA 5KYWA 1GL5A 4J5YA 2BZXA 2OTJT 4TVRA 2QA4A 5KYYA 1PKTA 3MEVA 4DOVA 4J9DA 4OMPA 2HKQB 4DBHA 1RI9A 1M2VB 3VJPA 4CC7A 3CPWS 2R5MA 4PJNA 3CD6T 5FROA 1UGPB 4OB2B 4HCBA 4X9CA 1D0YA 2E6NA 4ZN3A 2RO0A 5IT9E 2GNCA 1JO8A 2QG9B 2RQTA 3OS1A 2O2OA 4LD9K 1C6VX 4NOYA 1M3BA 3OYCA 2RQRA 4CI0C 3JCMQ 1IHWA 2BE9B 3L2QA 2DYIA 1VQ4A 1GTTA 4O6JA 2E3HA 1B34A 2QA4T 1U3OA 2P0PA 2YSQA 3H41A 3M0UA 3CCJQ 2QYZA 4RCBA 1RI0A 1WYXA 1S1NA 3IQLA 5CVIA 1OV3A 3M0TA 2M51A 1X01A 3VS5A 3H6ZA 4M78A 4C0GA 2OX7A 3FB9A 2HCKA 4PJOG 4M7DD 5FWCA 2EQJA 4DEYA 4PKCC 1J3TA 4LUDA 4C8QC 5LJ5h 1QLYA 3OSVA 4F14A 2DTIA 1WLPB 1YITA 1HYOA 2AKKA 1GXIE 2QK0A 2DTHA 4A63B 2GQIA 1VQ4T 3I55T 5D2HA 1SRLA 2EB6A 2V8IA 3FLGA 2YDLA 4RMOA 4A4GA 1JXOA 1JBMA 3WVDB 3JCMV 4M77G 1BI2A 2IPOB 2C0OA 4PL6A 1P92A 1X2KA 2RQUA 4Q5WA 2CKKA 5KYYB 4DBQA 4FIBA 3CD6Q 1T0HA 1N5ZA 3EGXB 4JZ3A 3VKIA 2ZPBB 2DE0X 3A5ZB 1VQKQ 2PTKA 2EB4A 1XTDA 1KSWA 1YITT 3FRNA 4LE9A 2GF7A 4XU2A 3M56A 4JLIA 2ATCB 4E7HA 3CCLA 2X4XA 1UGRB 4M78F 2E12A 4N4IA 1MMNA 2JJ9A 2GFUA 4K11A 2EFIA 1YHQA 3VS3A 3TSZA 3NMZC 3TREA 1Q86C 2C0TA 3VU3C 3ZL7C 4FW1A 2HQXA 3JCMb 1D09B 1SAWA 4NL2A 1B34B 1X6GA 1K8AC 2MOXA 2X35A 1SHGA 2P0KA 2P84A 1SSFA 5GANf 2RJCA 2FRWA 1WDXA 2YHTA 3V7RA 4E6RA 2DBKA 4HKEA 3OYGA 1KD1C 1SPKA 3X20B 3GNFB 3CCVQ 5EG2A 4CC3A 4M78B 5GAMg 1F1BB 1ZSGA 1VIEA 3OW2S 1W2BP 4E7KA 1YJWQ 5J3BA 2F69A 1NJIU 4HT9A 2A37A 4J6WA 4OF1A 2D8HA 2KI7A 3CCLT 1TXQA 2R57A 1G3TA 1IB8A 1UGQB 1SV6A 2EYYA 2J7IA 4C8QE 5I2MA 1PSEA 4C5EA 1UG1A 1YHQT 2M02A 3CPFA 2XDPA 1QVFP 2DL3A 9ATCB 1PHTA 1E6HA 1FMVA 4C92A 2CH4A 3M9QA 2E70A 2MYSA 1YJ9Q 3SDZA 4IIMA 1UHFA 5CIUA 4AG2C 2OTLQ 4BY6C 3PIOA 5FRNA 1NKQA 2BZYA 4M7AG 2EYXA 1UB4A 3GF5A 1VQMQ 2CGHA 1D0XA 1UUEA 1WHJA 2D1XA 1T3LA 1U1TA 2EVRA 2RNAA 5KCHA 2LT1A 1Y7XA 1KHCA 2DEQA 4DBFA 3BFMA 2CSQA 3CQTA 3I9QA 4OMNA 2WSFE 4Y92A 3EGUA 2O01E 2DD4A 1KIKA 3NTHA 2O4XA 1KQ2A 2HL5C 3CCMQ 3DLMA 1AWXA 2QTVA 4OGCA 4JRPA 2Y4YA 1ZUYA 1K73R 2MWOA 2RN8A 2RQVA 2CP7A 2ZPFB 3V7SA 2KYMA 3QIIA 3OY9A 2K4YA 1M90R 1PRLC 5FU6B 1FXXA 3QDFA 3MP8A 3CCUA 3HRTA 4F7UF 4Z02A 1VQNQ 1WJQA 1OZ2A 3CXCS 3LWHA 1NPPA 2EQIA 3EAEA 1SG5A 3MEWA 4ZN1A 1VQPA 2E4HA 2E3IA 2HMAA 4JS4A 2K57A 2YLBA 3L2ZA 1M5Q1 3OYLA 3OS5A 2HQEA 3L1AA 1Y96A 4C92F 2E65A 2QQ9A 4PJOC 1RL2A 2VYTA 2ZPGB 3L2VA 4BB7A 1BBZA 3SB2A 3TSWA 1WX6A 2JTEA 3PMTA 1C0MA 4JJCA 3X25B 3M5AA 3PIPA 2DTOA 3J81E 4F7UB 2J6FA 1JJ2S 1FWZA 2DM1A 4LDUA 2XIDA 3URGA 1FX7A 3HP9A 2A0FB 3CCUT 1XOVA 4Z8AA 3NFCA 4C92B 1UDLA 1QP2A 4M75G 5J39A 2GQVA 2KK4A 4LUEA 1Y0MA 1C1AA 1M9SA 2GGRA 4KULA 1K9MU 4XTYA 5GAN6 1MUZA 3EG9B 3A8HB 4KH1B 5KE3A 2CDTA 2RMOA 3VS2A 2E10A 2C0IA 2CSIA 2PU9B 1LNXA 1K0SA 2QTXA 2OAUA 3OYAA 2EKHA 2EYZA 2XDDA 3CC4Q 3HRSA 3QJ6A 4KBMB 1ZUKA 4RTWA 4MZTA 3CC2A 2K2VA 3VS6A 2NWMA 1AOJA 4AG1C 1WXBA 1NG2A 2DVEA 1M2OA 4FT4A 5GMKl 4L6V5 2JXBA 2FYKA 2LZ6B 4JLGA 1JB0E 2IIMA 1AEYA 2MK5A 3SFMA 1YI2Q 2V8JA 1ZBXA 5LJ3g 5LL6S 1E6GA 1YP5A 4D8DA 4ZTFA 1M1KR 1BCOA 4OGEA 2W0ZA 3C95A 3PVQA 1CKBA 3TCJA 1W4SA 1WZOA 2F5TX 1NYGA 2MAMA 3U23A 3SEMA 1G83A 4PFOA 4PJOA 3G4SQ 2CREA 2LNVA 2JS0A 3RKXA 1HK9A 1AD5A 1YWOA 2EYWA 5D2KA 3EGDA 1QCOA 3CCEQ 4QQDA 1KQ1A 3OBYA 1AHJB 4MMKA 2DETA
chains in the Genus database with same CATH topology
5D2JA 1GTTA 3S52A 1QQJA 2HZYA 2Q1AX 5D2HA 2Q1CX 2Q18X 2EB4A 4MAQA 2Q19X 3V77A 2WQTA 2Q1DX 3LZKA 5D2FA 4DBFA 1NR9A 1SAWA 3QDFA 1HYOA 5D2KA 3RR6A 4PFZA 5D2GA 1QCOA 3R6OA 4DBHA 1SV6A 1I7OA 1NKQA 4QKUA 3BQBA 1WZOA 2EB5A 2DFUA 5D2IA 1QCNA 2EB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2J A;  1GTT A;  3S52 A;  1QQJ A;  2HZY A;  2Q1A X;  5D2H A;  2Q1C X;  2Q18 X;  2EB4 A;  4MAQ A;  2Q19 X;  3V77 A;  2WQT A;  2Q1D X;  3LZK A;  5D2F A;  4DBF A;  1NR9 A;  1SAW A;  3QDF A;  1HYO A;  5D2K A;  3RR6 A;  4PFZ A;  5D2G A;  1QCO A;  3R6O A;  4DBH A;  1SV6 A;  1I7O A;  1NKQ A;  4QKU A;  3BQB A;  1WZO A;  2EB5 A;  2DFU A;  5D2I A;  1QCN A;  2EB6 A; 
#chains in the Genus database with same CATH topology
 1AWJ A;  3M0Q A;  3RBB B;  3PFS A;  1VUB A;  4KGV B;  3X28 B;  3RNJ A;  3EG1 A;  3EH2 A;  5GMK m;  5GAM j;  3GBQ A;  3OS2 A;  4M77 A;  3H8Z A;  4F7U G;  1O75 A;  1RAI B;  4MML A;  3FJ5 A;  1VQL Q;  1UJ0 A;  2LX9 A;  1Q82 U;  2P4R A;  3OYH A;  1SKU B;  3HSB A;  3LX7 A;  2K6D A;  4LNP A;  2CP3 A;  2DL7 A;  2ZPE B;  1ZBJ A;  2ROT A;  5FRM A;  1YCY A;  1RAA B;  3QO3 A;  3RKW A;  3OMG A;  2FVU A;  2QGF B;  3FDR A;  1SHF A;  3AT1 B;  3J80 E;  1VQO Q;  1SSH A;  4RCC A;  1TOV A;  4FM4 B;  5KYX A;  1B7T A;  2NUT B;  1K9A A;  1M30 A;  3CCJ A;  1YCS B;  1X6B A;  2AT1 B;  4BI8 B;  2O88 A;  2PZ1 A;  3S3O A;  4RTU A;  1WHM A;  3I56 Q;  4A4K A;  4GY5 A;  3EG2 A;  1A0N B;  2K5F A;  1UGV A;  2KGT A;  2Z0W A;  4KH0 B;  2YUP A;  1V76 A;  1X75 C;  2A36 A;  2CZ1 B;  2R5A A;  5CO7 A;  4OMF B;  2FPD A;  3FIF A;  5D2I A;  2CH4 W;  5GJV B;  1M1F A;  2CUB A;  2LVM A;  1W2B S;  4ELZ C;  3DKM A;  2CP2 A;  2Y4X A;  1FMK A;  3P8D A;  4PJO B;  1BI1 A;  3CCJ T;  1UHC A;  4M77 F;  4M4Z A;  2XK0 A;  5GAM d;  2DRK A;  2SEM A;  3GNG A;  2DIL A;  3JB9 D;  2RD1 A;  2QI2 A;  1BI0 A;  4XTX A;  2X4W A;  3EGD B;  3JCM c;  4L59 A;  3KUF A;  3CD6 A;  2DYB A;  3EFS A;  5I11 A;  3O5Z A;  1M27 C;  4M78 C;  2K79 A;  1QVG A;  1QVF S;  1VQK A;  1VYV A;  4FCY A;  1UJY A;  2X4Y A;  4C8Q D;  2J06 A;  1NPR A;  3P8B B;  2M1H A;  1Q7Y C;  3H9N A;  4M77 B;  3CPW A;  4JZ4 A;  4M7A A;  1W70 A;  2E1H A;  1PNJ A;  3MHX A;  2QQS A;  4IIO A;  3INZ A;  3HPW A;  3OYF A;  3MP1 A;  1QMC A;  3CCR Q;  3EGX A;  4J9C A;  2NYS A;  5D6W A;  1K1Z A;  4DEX A;  2NUP A;  1ZLM A;  5KYX B;  1QKW A;  4JS5 A;  2VC8 A;  2DIQ A;  3H0H A;  1K0X A;  1PM3 A;  4BI4 A;  1VQK T;  3CCV A;  1RLP C;  2OJ2 A;  3OB9 A;  5GAN 7;  1WI7 A;  1YJW A;  2XU8 A;  2ZPH B;  5FWB A;  5GAN g;  1IGU A;  2RQW A;  4E7L A;  2IVW A;  1N8R C;  2L0A A;  2EB5 A;  5C6S A;  2E64 A;  4EMH A;  1GFD A;  2JS2 A;  5LJ3 e;  2D6F A;  1MV0 B;  3I55 A;  2KBT A;  3E19 A;  4RG8 A;  4ZTJ A;  3A1P A;  2JZ2 A;  2JTM A;  2QQB A;  5GAO r;  5FU6 C;  5CQY A;  2DNU A;  5IHI A;  2EBP A;  5LJ3 j;  3S3M A;  2K7A A;  4BDY A;  3JCM g;  4J6Y A;  1YJ9 A;  4M7A F;  3EG0 A;  2OTL A;  1JXM A;  5IXB A;  2DAQ A;  3JCM J;  2DZC A;  2LDM A;  3CCV T;  1KC8 C;  1VQM A;  3PGG A;  1VA7 A;  2L3S A;  1SEM A;  2D9T A;  1YJW T;  2EW3 A;  3G6E Q;  1JRI A;  3CMA Q;  1NJI R;  1Q86 U;  4PFZ A;  3V8K A;  4M78 E;  2HNI A;  3KBG A;  3SWN A;  1ZA2 B;  2MI6 A;  2LQW A;  2KYB A;  6AT1 B;  1K8A U;  1VOM A;  4M75 A;  1PSF A;  5FU7 B;  2GBQ A;  2ZPI B;  3L2R A;  4OMO A;  1BCM A;  4OML A;  4EDU A;  3CCM A;  1PD0 A;  4M7A B;  1BIB A;  5HY6 A;  1KD1 U;  4LXC A;  1TSF A;  2YRC A;  2F1L A;  2RI2 A;  4FSS A;  4KGX B;  4UC4 A;  5LJ5 f;  3CC7 T;  1PG5 B;  2J6K A;  3J7A F;  2HKN A;  1IRX A;  2VB6 A;  2XMF A;  4C92 C;  1YJ9 T;  3OSS C;  2OTL T;  1G2B A;  2FEI A;  1VQN A;  3MP6 A;  2KRO A;  2KR3 A;  2DO3 A;  1VQM T;  2NUP B;  3E2U A;  1N27 A;  1QP3 A;  2CS7 A;  1BU1 A;  3VV0 A;  2AZS A;  1NLP C;  1WHL A;  3M54 A;  4RTX A;  5LJ3 d;  1MND A;  5KH6 A;  1WXT A;  1KJW A;  2Y90 A;  3CCM T;  2AIR B;  1I07 A;  1WHG A;  3MJX A;  3I5R A;  3EFR A;  2B86 A;  4XU0 A;  4HCZ A;  4EIK A;  3JCM W;  3KFV A;  5I2S A;  4X34 A;  4XU1 A;  4XTV A;  3G71 Q;  1VQN T;  1RAH B;  2KRS A;  3M55 A;  3PNW C;  2LJ0 A;  1QWF A;  2AHJ B;  4M75 F;  4VUB A;  4F16 A;  1LPL A;  2CP5 A;  4RKU E;  3OYE A;  3REB B;  3PVL A;  3M53 A;  2K5L A;  2XHC A;  4RTT A;  2DX1 A;  2O31 A;  2YRV A;  4F7U A;  3RER A;  3JCM h;  3L42 A;  3CC4 A;  3UT1 A;  1ZUU A;  4II1 A;  4XQ3 A;  2PVG B;  3SWN B;  2G6F X;  2HZY A;  4DBR A;  2PVO B;  2L3Q A;  4M75 B;  3I35 A;  4B6M A;  3BDU A;  4BUG A;  1D1B A;  3CC7 Q;  2LQ8 A;  2COZ A;  1YI2 A;  1WHK A;  3VUZ A;  4F7U E;  2G3R A;  2JM9 A;  4XTW A;  2FG0 A;  4CRI A;  1W6X A;  3QDR B;  1I7O A;  1XNI A;  1OX9 A;  1Q81 R;  1I1J A;  3EG9 A;  2DXB A;  1R8O B;  1K76 A;  3QG1 A;  3NGP A;  1X6O A;  2Q1A X;  4C92 E;  4IUT A;  5EC7 A;  1TS9 A;  2YXY A;  1K9M R;  1WJS A;  2NLU A;  2Q19 X;  4FYY B;  3V77 A;  3MET A;  3G4S A;  2L8D A;  4OB0 B;  2L5Q A;  3ZBD A;  1V1C A;  3VS7 A;  3CXC A;  1U5S A;  2L2P A;  5A2Q E;  3CC4 T;  2EKO A;  2KQW A;  1OI1 A;  1RAD B;  3CCE A;  5DLQ E;  5GAN 8;  1QVG P;  4F04 B;  1NLO C;  2HL3 A;  2HD0 A;  1YI2 T;  4OB3 B;  1M1G A;  1R0C B;  3LGL A;  1NEG A;  3CCQ Q;  4L5G A;  2ZGW A;  1M8M A;  2RHY A;  5GMK h;  3CEY A;  2CYZ B;  2VGN A;  2X51 A;  4QQG A;  2E5Q A;  1UEC A;  1JJ2 A;  1OU9 A;  1VQL A;  4RTV A;  4AT1 B;  5GAN j;  1MGQ A;  4J7I A;  2JW4 A;  4AFS C;  2LTO A;  3G4S T;  1IZ6 A;  2HQH A;  1IHV A;  2DJQ A;  1GCQ C;  1AZG B;  3JCM e;  4M7D A;  2RK2 A;  4DOW A;  1XJW B;  1VQO A;  3PE0 A;  2EJG A;  2K9G A;  3CCE T;  3RIR A;  1M4Z A;  1M3C A;  2X4J A;  4QW2 A;  4MDW A;  2CP0 A;  5D2J A;  5DLO A;  1GFC A;  1Q95 G;  3I56 A;  5CKH A;  5GAM h;  3GOX A;  2QAS A;  2WAC A;  3VRZ A;  1H8K A;  1I81 A;  1BKB A;  1IXD A;  3RR6 A;  3UWN A;  1I5L A;  3JB9 I;  4JPB W;  3EFO B;  1YN8 A;  4M77 C;  5M9O A;  1VQL T;  3HL8 A;  3X24 B;  2HBW A;  1Q82 R;  2F2W A;  3PTA A;  4ORZ A;  2EQU A;  3QYG B;  1GRI A;  5CK9 A;  5CKB A;  1OYX A;  2NUT A;  3NPF A;  4NS5 A;  5AYF A;  3JCM X;  1ABQ A;  1Z9Z A;  1VQO T;  3CME T;  1WNL A;  1VQ6 Q;  3OBW A;  5DM7 R;  1GBQ A;  1YIJ Q;  2VUB A;  3DLL A;  2X9H A;  4D6W A;  4E7S A;  5GAN 2;  3I56 T;  1OU8 A;  2L3R A;  5GAN d;  1EZZ B;  2H3E B;  3EG3 A;  1EX4 A;  2DIG A;  2LP5 A;  4PFP A;  4F17 A;  4XAX B;  5GMK e;  1VQ8 T;  4M7D F;  1NR9 A;  2V1R A;  2J05 A;  4QVZ A;  3MO8 A;  1EFN A;  3JV3 A;  3OS0 A;  2MPX C;  1PD1 A;  3BE3 A;  3MEU A;  1GBR A;  2GTO A;  5GMK j;  2KSS A;  4X9D A;  1EIF A;  1GCQ A;  2KXC A;  2P0Q A;  4A4H A;  5DY9 A;  3JCM d;  3QPH A;  4IUV A;  1MV3 A;  4WCI A;  4CC4 B;  5KYU A;  2V1Q A;  3EHQ A;  5D2F A;  2YUN A;  1R77 A;  3A98 A;  4HVU A;  2LC4 A;  1AVZ C;  2XI9 A;  3CCR A;  4CC2 A;  4M7D B;  3M0R A;  5GAM e;  2RI3 A;  4ANJ A;  1IRE B;  4PJO E;  2QEX Q;  3JB9 H;  1BK2 A;  4AFQ C;  1QQJ A;  3CBM A;  3MPU B;  3UF4 A;  3QWY A;  2A7Y A;  2C06 A;  2ZCF B;  4M78 D;  1AT1 B;  2COY A;  4LDW A;  3ZEH A;  2V8K A;  2M9U A;  4EMG A;  4J9H A;  1ZQ1 A;  3M4G A;  1VQ9 Q;  2A3L A;  5D2G A;  2RHI A;  3AHU A;  4J9B A;  3GIB A;  5A0L A;  2DRM A;  5FU7 C;  5GAO n;  1AZE A;  4OVA A;  4AMC A;  2Q18 X;  4DA4 A;  4M7A C;  4O5V A;  3NTK A;  2WQT A;  4M77 E;  1ARK A;  2YUQ A;  1OQK A;  3CME Q;  5KYN A;  3C12 A;  2F5K A;  1K73 C;  4OMQ A;  1HXD A;  2HSP A;  4LDV A;  3CCR T;  2X3X D;  4OB1 B;  1M90 C;  4EMK B;  3MKD A;  1XQH A;  5A0D A;  2W10 A;  3SD4 A;  1BIA A;  1PC0 A;  2RJE A;  4IUU A;  1Q7Y U;  3ER0 A;  3RKY A;  2KRM A;  4LN2 A;  4Z89 A;  2K2M A;  2IG0 A;  2EJ9 A;  1VQ8 Q;  3G1J A;  1WA7 A;  4E47 A;  4KUI A;  4ZGD B;  2E41 A;  4KGZ B;  2FZG B;  4PK4 A;  4ELY C;  3G6E A;  2AK5 A;  3CMA A;  1TH7 A;  2KDS A;  3DB3 A;  3RMS A;  4V2S A;  2XG8 D;  1ACM B;  2YUO A;  3LW5 E;  1TU0 B;  1U06 A;  2RH2 A;  3FEO A;  4ATO A;  2MMP A;  1QVF A;  2DXT A;  4MAQ A;  5LJ3 h;  4ME7 A;  2PQW A;  1UGS B;  4AFZ C;  1KQS A;  5HK3 A;  2LJ1 A;  5IAY A;  1VQ5 Q;  5KYU B;  1FMW A;  3GPL A;  2RF0 A;  2VXF A;  4MZM A;  1YWP A;  2JUF A;  1G3W A;  4Y91 A;  4RTY A;  5CAI A;  1N8R U;  1G8X A;  5GAO p;  3OYI A;  5KE2 A;  1Z9Q A;  1ZA1 B;  5LJ5 g;  3D7S B;  2KEA A;  4M7D G;  1R0B G;  2CT3 A;  3VUB A;  3G6E T;  2JM8 A;  3CMA T;  1KFZ A;  3PT9 A;  4QVD A;  1Q86 R;  4PLI A;  2HBP A;  1S72 Q;  1QW1 A;  3TU4 K;  4J8O A;  4Y28 E;  3SWN C;  1K8A R;  5L23 A;  1RAC B;  4OP0 A;  5FW9 A;  2CUD A;  4B9X A;  2R58 A;  1YJN Q;  2KXD A;  4M75 C;  3L2W A;  3QSU A;  2JMC A;  1KD1 R;  1KC8 U;  3LYI A;  2JMA A;  3TQ7 P;  2DJZ A;  3ZFJ A;  2DD5 A;  4M7A E;  1YNZ A;  2DLP A;  1M1K C;  1JJ2 P;  4C92 D;  2HSE B;  4ESR A;  3S52 A;  3G71 A;  2LT4 A;  1MMD A;  2LCS A;  1QVG S;  2DBM A;  2QAZ A;  4A4F A;  1KHI A;  1IGQ A;  2EPD A;  2QGG A;  3RUX A;  3QXE B;  3M4Y A;  3QYH B;  3OYB A;  4BE0 A;  5I21 A;  2DKG A;  3T9N A;  2YLC A;  2CZ6 B;  5GAN 4;  4ZNX A;  1RUW A;  1NEB A;  2D0N A;  3S6W A;  1WFW A;  3VS1 A;  2JTF A;  3QZ9 B;  1QKX A;  4XTZ A;  1X69 A;  3LH0 A;  4OMM A;  2DF6 A;  3CC7 A;  5CKF A;  1V29 B;  1G5V A;  3SHW A;  1TTH B;  2O9V A;  3JRZ A;  1QCN A;  2A08 A;  3G71 T;  1ZSZ C;  3CCS T;  2LNH B;  4EPC A;  1CKA A;  4LDY A;  4PLL A;  4QT7 A;  4FW2 A;  1NYF A;  4BDZ A;  3DB4 A;  5L8R E;  2PVD B;  4A53 A;  2WSC E;  2PUO B;  1VYT A;  3OYK A;  4R0K A;  2SRC A;  3GP8 A;  2HAX A;  1OEB A;  1IO6 A;  2B8A A;  4KRT A;  3BY7 A;  3QJY A;  1N9S A;  2KRN A;  5GAO l;  2QQR A;  2VWF A;  1PRM C;  1PKS A;  3THK A;  1N6A A;  2RI5 A;  3MEA A;  4J9G A;  2Q1D X;  2ED0 A;  3LGF A;  2CT4 A;  2LMJ A;  5ECA A;  2DL5 A;  5J26 A;  2XDB A;  4HVW A;  3NTI A;  3VYH B;  3CCQ A;  1VQ7 Q;  4M75 E;  2KE9 A;  5GJW B;  3EHR A;  4IKF A;  1I8F A;  1X27 A;  3E9F A;  3QZ5 B;  1OZ3 A;  5IN1 A;  3E1S A;  1TWB A;  5GAN 3;  2OTJ Q;  1JU5 C;  3WVE B;  1G3S A;  3VRY A;  4DQ2 A;  3LLR A;  8ATC B;  5D6X A;  5IHN A;  2DVJ A;  5KYW B;  1UTI A;  2LJ3 A;  5CR2 A;  1RAB B;  5CKE A;  2DK3 A;  4E2F B;  1MNE A;  1UE9 A;  5D7U A;  2DXC A;  3OW2 A;  2LX7 A;  2WSE E;  3UPU A;  4LD6 A;  2KT1 A;  5GAO m;  2F2V A;  3CCQ T;  2VGM A;  1ZSZ A;  1LVK A;  5GAN h;  3CBP A;  2FB7 A;  3CCS Q;  2KAF A;  1M3A A;  4YTL A;  1VYU A;  2OI3 A;  3JCM P;  2QA4 Q;  3PMI A;  4PJM A;  3HKS A;  3UA7 A;  2FO0 A;  1Y71 A;  2E6Z A;  3CBO A;  4BE2 A;  2L3P A;  1T3S A;  1U1S A;  3BW1 A;  4J9F A;  4PJO D;  3R6O A;  3HHT B;  2K5I A;  4M7D C;  3OYD A;  2FHD A;  1VQ6 A;  2JVV A;  3V7C A;  2DL4 A;  2I2L A;  4C8Q A;  4HCC A;  1YIJ A;  5LJ5 e;  2LCC A;  1OX8 A;  5GMK i;  2PNI A;  3E9G A;  3BDL A;  1TUC A;  2L89 A;  3C0C A;  2EIF A;  2LRQ A;  1PWT A;  2CZ0 B;  1AWW A;  3EFO A;  1VQ4 Q;  3P8H A;  3VS0 A;  4J7F A;  3I55 Q;  3JCM f;  5LJ5 j;  2JNG A;  3TVT A;  4ZGE B;  3GLX A;  3M57 A;  5CCA A;  1TUG B;  2HDA A;  2RHZ A;  4M77 D;  3V8L A;  4C0D B;  2QDL A;  2VV5 A;  4FT2 A;  4BI3 A;  1KQS P;  1QCF A;  4GLK A;  5GAO q;  4A54 A;  4N4G A;  3I5S A;  1Y57 A;  4JJN K;  3A8O B;  2BTT A;  4MDX A;  1VQ6 T;  2LQK A;  3QWX X;  4EMK C;  2COW A;  2DEU A;  1YIJ T;  4N0A C;  3JB9 F;  1QWE A;  2QEX A;  1VIF A;  1YIT Q;  4FYX B;  3FC3 A;  2DXU A;  1ZX6 A;  3HFO A;  5GAN e;  2CP6 A;  2K3Y A;  1I0C A;  3VYG A;  1TUD A;  2MF2 A;  2KVQ G;  2KY9 A;  2FRY A;  3OQ5 A;  2BIV A;  1NZ9 A;  2FZC B;  5IHK A;  2BE7 D;  3CPW P;  3M58 A;  2RJD A;  2KNB B;  3QBY A;  1VQ9 A;  1ZSZ B;  4C8Q F;  1FYN A;  1NE8 A;  2XKO C;  2QXF A;  1G3Y A;  3V8J A;  2RHU A;  1CSK A;  4QVC A;  3X26 B;  1NJI C;  4J9I A;  4RG2 A;  2BKD N;  4PJL A;  2AZV A;  2DL8 A;  2Q1C X;  4P5N A;  3HRU A;  4XK8 E;  1D0Z A;  3LZK A;  1I4K 1;  1YFN A;  2EGC A;  3CME A;  1H64 1;  3ASK A;  5LJ5 d;  3BQB A;  3OYY A;  5FLX E;  2BZ8 A;  1AWO A;  2ENM A;  4XTU A;  2VKN A;  3L2U A;  2GTJ A;  2ESW A;  2QEX T;  3M0P A;  1WQ7 A;  1LOJ A;  1D1A A;  3OYM A;  4C8Q B;  4M7D E;  5A0G A;  3CCL Q;  4PJJ A;  2K3B A;  3EH1 A;  3HTR A;  5C0M A;  1H92 A;  3UAT A;  1VQ8 A;  3RES A;  1LCK A;  2RJF A;  3MCA B;  4M78 G;  4FSX A;  1VQ9 T;  7AT1 B;  1YHQ Q;  2YT6 A;  1RAG B;  2ROL A;  1WIE A;  4J83 A;  5GAM f;  4JDS A;  1LJO A;  2KT8 A;  4GBQ A;  2H8H A;  4J6X A;  2FZK B;  3Q1J A;  1U8R A;  2GCX A;  3OMC A;  2P4T A;  3S3N A;  4M7A D;  2VVK A;  4EMK A;  2NUZ A;  4JRQ A;  4RTZ A;  1VQP T;  1Q81 U;  1N9R A;  2E5K A;  4N0A A;  2I0N A;  1VQ5 A;  2DFU A;  2RA2 A;  2JT4 A;  2D0Q B;  4IUP A;  4BAC A;  4KT0 E;  3H0F A;  4HVV A;  4HT8 A;  4ZGJ B;  2DZ9 A;  3JB9 J;  4FYW B;  3N5B B;  4Z88 A;  1SRM A;  1Q7Y R;  1BB9 A;  3A8G B;  2EQK A;  3M0S A;  5GAN 5;  5HCK A;  4A4E A;  3ULR B;  3M59 A;  1NM7 A;  2HEQ A;  1K73 U;  4HCK A;  2FL7 A;  2O9S A;  2EGA A;  1T0J A;  1WQW A;  2O4X B;  2XIC A;  1RLQ C;  3QKJ A;  1M90 U;  1OUL A;  1S72 A;  1MMA A;  4JJB A;  2ZAE A;  4HXJ A;  4QQ6 A;  1YJN A;  2ED1 A;  1E7O A;  1VQ5 T;  4QKU A;  2EYQ A;  5I22 A;  4C5H A;  4PNO A;  1HSQ A;  2FPE A;  3G7Z A;  3OYJ A;  1HJD A;  3VS4 A;  3JB9 G;  5HK0 A;  2RHX A;  1N8R R;  1Q81 C;  2BUD A;  2EGE A;  3OYN A;  1NBE B;  2X3W D;  1JEG A;  1JQQ A;  3CC2 T;  1WGS A;  1Y96 B;  4RUG A;  2EJF A;  1KG1 A;  1K4U S;  2VAS A;  1K9M C;  5KCO A;  2LCL A;  2ECZ A;  4E7Z A;  2AKL A;  2D8J A;  3KXT A;  4LDX A;  2CZ7 B;  4C8Q G;  1S72 T;  4B9W A;  2M0Y A;  3A8M B;  2V26 A;  3RMQ A;  4C0F A;  1MMG A;  3OW2 P;  1Y07 A;  3ME9 A;  3REA B;  3CCU Q;  4IUQ A;  2MIO A;  2XD0 A;  1D3B A;  1YJN T;  3JAM E;  3UA6 A;  4E7J A;  2DA9 A;  5IXF A;  1X2Q A;  4M75 D;  1YBY A;  1OOT A;  2QDY B;  1VQP Q;  2RK1 A;  1KC8 R;  4BY6 B;  2RB6 A;  1MHN A;  2YRD A;  1WHH A;  4JRK A;  2J6O A;  3NHN A;  2F2X A;  1WPY A;  1I5O B;  4C5I A;  4C0Z A;  4N4H A;  1W2B A;  4C92 G;  4R56 A;  1M2V A;  1RAE B;  3A8L B;  4WTO B;  3UDC A;  1H3Z A;  1B07 A;  2PUK B;  1UFF A;  3LH5 A;  8AT1 B;  4JRI A;  4R55 A;  4KUD K;  4PJO F;  2MWP A;  4FYV B;  2DPP B;  4X1V A;  2K3X A;  1WJR A;  2A28 A;  5AT1 B;  3JSC A;  1M8V A;  1M1K U;  1BI3 A;  4NL3 A;  5IH2 A;  1O9S A;  1W1F A;  3H0I A;  3QUI A;  4MZP A;  2VXE A;  2DER A;  5HKC A;  1WXU A;  3HFN A;  2QQA A;  1HD3 A;  2EWN A;  2JN0 A;  1VQ7 A;  4FL6 A;  1SF9 A;  1QVP A;  1H3H A;  3OA6 A;  3FJP A;  3TEE A;  2M16 A;  5LJ3 f;  2MCN A;  1BYM A;  2YWW A;  4IUR A;  1ABO A;  2FPF A;  1PCX A;  4C5G A;  4JUV A;  4D8K A;  2DMO A;  4WF2 A;  1Q82 C;  3CC2 Q;  2OTJ A;  2EQM A;  4XU3 A;  2LQN A;  2KMT A;  2EAY A;  3RDV A;  2GFA A;  2RPN A;  5CQX A;  3CXC P;  2M0O A;  3C4S A;  2OAW A;  2H3J A;  1UEB A;  4E7I A;  2RM4 A;  1B3Q A;  1ZHI A;  1OPK A;  2ABL A;  4GLM A;  1OPL A;  3LWI A;  1KQS S;  5CKD A;  4AFU C;  5D6Y A;  1TG0 A;  3F70 A;  3R6N A;  3O8V A;  1D3B B;  4FU6 A;  1D1C A;  1DJ7 B;  1GCP A;  1KK7 A;  4BE1 A;  3C94 A;  1VQ7 T;  4JJD A;  3QHS A;  3WXM B;  2ZZD A;  1RAF B;  3CCS A;  2JOY A;  4BD3 A;  4HA8 A;  1X43 A;  4C0D C;  4J9E A;  5KYW A;  1GL5 A;  4J5Y A;  2BZX A;  2OTJ T;  4TVR A;  2QA4 A;  5KYY A;  1PKT A;  3MEV A;  4DOV A;  4J9D A;  4OMP A;  2HKQ B;  4DBH A;  1RI9 A;  1M2V B;  3VJP A;  4CC7 A;  3CPW S;  2R5M A;  4PJN A;  3CD6 T;  5FRO A;  1UGP B;  4OB2 B;  4HCB A;  4X9C A;  1D0Y A;  2E6N A;  4ZN3 A;  2RO0 A;  5IT9 E;  2GNC A;  1JO8 A;  2QG9 B;  2RQT A;  3OS1 A;  2O2O A;  4LD9 K;  1C6V X;  4NOY A;  1M3B A;  3OYC A;  2RQR A;  4CI0 C;  3JCM Q;  1IHW A;  2BE9 B;  3L2Q A;  2DYI A;  1VQ4 A;  1GTT A;  4O6J A;  2E3H A;  1B34 A;  2QA4 T;  1U3O A;  2P0P A;  2YSQ A;  3H41 A;  3M0U A;  3CCJ Q;  2QYZ A;  4RCB A;  1RI0 A;  1WYX A;  1S1N A;  3IQL A;  5CVI A;  1OV3 A;  3M0T A;  2M51 A;  1X01 A;  3VS5 A;  3H6Z A;  4M78 A;  4C0G A;  2OX7 A;  3FB9 A;  2HCK A;  4PJO G;  4M7D D;  5FWC A;  2EQJ A;  4DEY A;  4PKC C;  1J3T A;  4LUD A;  4C8Q C;  5LJ5 h;  1QLY A;  3OSV A;  4F14 A;  2DTI A;  1WLP B;  1YIT A;  1HYO A;  2AKK A;  1GXI E;  2QK0 A;  2DTH A;  4A63 B;  2GQI A;  1VQ4 T;  3I55 T;  5D2H A;  1SRL A;  2EB6 A;  2V8I A;  3FLG A;  2YDL A;  4RMO A;  4A4G A;  1JXO A;  1JBM A;  3WVD B;  3JCM V;  4M77 G;  1BI2 A;  2IPO B;  2C0O A;  4PL6 A;  1P92 A;  1X2K A;  2RQU A;  4Q5W A;  2CKK A;  5KYY B;  4DBQ A;  4FIB A;  3CD6 Q;  1T0H A;  1N5Z A;  3EGX B;  4JZ3 A;  3VKI A;  2ZPB B;  2DE0 X;  3A5Z B;  1VQK Q;  2PTK A;  2EB4 A;  1XTD A;  1KSW A;  1YIT T;  3FRN A;  4LE9 A;  2GF7 A;  4XU2 A;  3M56 A;  4JLI A;  2ATC B;  4E7H A;  3CCL A;  2X4X A;  1UGR B;  4M78 F;  2E12 A;  4N4I A;  1MMN A;  2JJ9 A;  2GFU A;  4K11 A;  2EFI A;  1YHQ A;  3VS3 A;  3TSZ A;  3NMZ C;  3TRE A;  1Q86 C;  2C0T A;  3VU3 C;  3ZL7 C;  4FW1 A;  2HQX A;  3JCM b;  1D09 B;  1SAW A;  4NL2 A;  1B34 B;  1X6G A;  1K8A C;  2MOX A;  2X35 A;  1SHG A;  2P0K A;  2P84 A;  1SSF A;  5GAN f;  2RJC A;  2FRW A;  1WDX A;  2YHT A;  3V7R A;  4E6R A;  2DBK A;  4HKE A;  3OYG A;  1KD1 C;  1SPK A;  3X20 B;  3GNF B;  3CCV Q;  5EG2 A;  4CC3 A;  4M78 B;  5GAM g;  1F1B B;  1ZSG A;  1VIE A;  3OW2 S;  1W2B P;  4E7K A;  1YJW Q;  5J3B A;  2F69 A;  1NJI U;  4HT9 A;  2A37 A;  4J6W A;  4OF1 A;  2D8H A;  2KI7 A;  3CCL T;  1TXQ A;  2R57 A;  1G3T A;  1IB8 A;  1UGQ B;  1SV6 A;  2EYY A;  2J7I A;  4C8Q E;  5I2M A;  1PSE A;  4C5E A;  1UG1 A;  1YHQ T;  2M02 A;  3CPF A;  2XDP A;  1QVF P;  2DL3 A;  9ATC B;  1PHT A;  1E6H A;  1FMV A;  4C92 A;  2CH4 A;  3M9Q A;  2E70 A;  2MYS A;  1YJ9 Q;  3SDZ A;  4IIM A;  1UHF A;  5CIU A;  4AG2 C;  2OTL Q;  4BY6 C;  3PIO A;  5FRN A;  1NKQ A;  2BZY A;  4M7A G;  2EYX A;  1UB4 A;  3GF5 A;  1VQM Q;  2CGH A;  1D0X A;  1UUE A;  1WHJ A;  2D1X A;  1T3L A;  1U1T A;  2EVR A;  2RNA A;  5KCH A;  2LT1 A;  1Y7X A;  1KHC A;  2DEQ A;  4DBF A;  3BFM A;  2CSQ A;  3CQT A;  3I9Q A;  4OMN A;  2WSF E;  4Y92 A;  3EGU A;  2O01 E;  2DD4 A;  1KIK A;  3NTH A;  2O4X A;  1KQ2 A;  2HL5 C;  3CCM Q;  3DLM A;  1AWX A;  2QTV A;  4OGC A;  4JRP A;  2Y4Y A;  1ZUY A;  1K73 R;  2MWO A;  2RN8 A;  2RQV A;  2CP7 A;  2ZPF B;  3V7S A;  2KYM A;  3QII A;  3OY9 A;  2K4Y A;  1M90 R;  1PRL C;  5FU6 B;  1FXX A;  3QDF A;  3MP8 A;  3CCU A;  3HRT A;  4F7U F;  4Z02 A;  1VQN Q;  1WJQ A;  1OZ2 A;  3CXC S;  3LWH A;  1NPP A;  2EQI A;  3EAE A;  1SG5 A;  3MEW A;  4ZN1 A;  1VQP A;  2E4H A;  2E3I A;  2HMA A;  4JS4 A;  2K57 A;  2YLB A;  3L2Z A;  1M5Q 1;  3OYL A;  3OS5 A;  2HQE A;  3L1A A;  1Y96 A;  4C92 F;  2E65 A;  2QQ9 A;  4PJO C;  1RL2 A;  2VYT A;  2ZPG B;  3L2V A;  4BB7 A;  1BBZ A;  3SB2 A;  3TSW A;  1WX6 A;  2JTE A;  3PMT A;  1C0M A;  4JJC A;  3X25 B;  3M5A A;  3PIP A;  2DTO A;  3J81 E;  4F7U B;  2J6F A;  1JJ2 S;  1FWZ A;  2DM1 A;  4LDU A;  2XID A;  3URG A;  1FX7 A;  3HP9 A;  2A0F B;  3CCU T;  1XOV A;  4Z8A A;  3NFC A;  4C92 B;  1UDL A;  1QP2 A;  4M75 G;  5J39 A;  2GQV A;  2KK4 A;  4LUE A;  1Y0M A;  1C1A A;  1M9S A;  2GGR A;  4KUL A;  1K9M U;  4XTY A;  5GAN 6;  1MUZ A;  3EG9 B;  3A8H B;  4KH1 B;  5KE3 A;  2CDT A;  2RMO A;  3VS2 A;  2E10 A;  2C0I A;  2CSI A;  2PU9 B;  1LNX A;  1K0S A;  2QTX A;  2OAU A;  3OYA A;  2EKH A;  2EYZ A;  2XDD A;  3CC4 Q;  3HRS A;  3QJ6 A;  4KBM B;  1ZUK A;  4RTW A;  4MZT A;  3CC2 A;  2K2V A;  3VS6 A;  2NWM A;  1AOJ A;  4AG1 C;  1WXB A;  1NG2 A;  2DVE A;  1M2O A;  4FT4 A;  5GMK l;  4L6V 5;  2JXB A;  2FYK A;  2LZ6 B;  4JLG A;  1JB0 E;  2IIM A;  1AEY A;  2MK5 A;  3SFM A;  1YI2 Q;  2V8J A;  1ZBX A;  5LJ3 g;  5LL6 S;  1E6G A;  1YP5 A;  4D8D A;  4ZTF A;  1M1K R;  1BCO A;  4OGE A;  2W0Z A;  3C95 A;  3PVQ A;  1CKB A;  3TCJ A;  1W4S A;  1WZO A;  2F5T X;  1NYG A;  2MAM A;  3U23 A;  3SEM A;  1G83 A;  4PFO A;  4PJO A;  3G4S Q;  2CRE A;  2LNV A;  2JS0 A;  3RKX A;  1HK9 A;  1AD5 A;  1YWO A;  2EYW A;  5D2K A;  3EGD A;  1QCO A;  3CCE Q;  4QQD A;  1KQ1 A;  3OBY A;  1AHJ B;  4MMK A;  2DET A; 
#chains in the Genus database with same CATH homology
 5D2J A;  1GTT A;  3S52 A;  1QQJ A;  2HZY A;  2Q1A X;  5D2H A;  2Q1C X;  2Q18 X;  2EB4 A;  4MAQ A;  2Q19 X;  3V77 A;  2WQT A;  2Q1D X;  3LZK A;  5D2F A;  4DBF A;  1NR9 A;  1SAW A;  3QDF A;  1HYO A;  5D2K A;  3RR6 A;  4PFZ A;  5D2G A;  1QCO A;  3R6O A;  4DBH A;  1SV6 A;  1I7O A;  1NKQ A;  4QKU A;  3BQB A;  1WZO A;  2EB5 A;  2DFU A;  5D2I A;  1QCN A;  2EB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...