4PFZA

X-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
250
Chain Sequence
MRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVRLLAPILASKVIAVGKNYAAHVAPEDPVIFLKPNTAIIGPNVPIQLPADADPVHHEGELAIVIGRPCKDVPAARAAEFILGYTIGNDVSARDQQRKDGQWMRAKGHDTFCPLGPWIVTDLDPSDVELRTEVNGQVRQRSRTSLLLHDIGRLVEWTSAVMTLLPGDVILTGTPEGVGPIEDGDTVSITVEGIGTLTNPVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
molecule keywords 5-carboxymethyl-2-hydroxymuconate delta-isomerase
total genus 65
structure length 250
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4pfzA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4pfzA02
1GTTA 1SAWA 4QKUA 3LZKA 5D2FA 1NKQA 1HYOA 2Q1AX 5D2GA 1WZOA 5D2HA 2DFUA 3QDFA 2EB5A 2EB4A 5D2JA 4DBFA 3V77A 1NR9A 2WQTA 3R6OA 4PFZA 1QCNA 1SV6A 3RR6A 2HZYA 2Q1DX 2Q18X 5D2KA 4MAQA 3BQBA 1QCOA 3S52A 2EB6A 2Q19X 2Q1CX 1I7OA 5D2IA 1QQJA 4DBHA
chains in the Genus database with same CATH superfamily
1JXMA 3JSCA 3NMZC 4R55A 1GRIA 2IG0A 1R0CB 3ME9A 3TEEA 2JVVA 4IUUA 4XTVA 3OYIA 3CCST 3CCJT 1RAIB 1YJNA 3S3MA 1H92A 2YUNA 3J81E 3S6WA 2HKNA 2DM1A 2E10A 2VUBA 3FDRA 3OSVA 4BDZA 2P0QA 1OX8A 3CC2A 1ACMB 2BKDN 3V8LA 2EB5A 1S72Q 5GANj 1F1BB 2CSQA 2JTFA 4M7DD 5FU7C 3M0SA 5KCOA 4PJOC 3GNFB 4FSSA 3EGDB 3PNWC 4L6V5 5GAMh 2YUOA 2YUQA 5CR2A 5KCHA 1E6GA 2QK0A 2DXUA 4PJNA 1OU8A 3VYGA 4WF2A 1RABB 4IIMA 3SB2A 3OB9A 2LJ3A 3H6ZA 5LJ5e 1ARKA 5FLXE 1YI2T 2NUTA 2JUFA 4ZNXA 4QW2A 2EBPA 5CKEA 5GANf 2OTJT 3JCMX 4M77F 4LD6A 1M2VA 4QT7A 4J83A 3PVQA 4EMKA 3CCUA 2SRCA 2XDDA 4EPCA 4RKUE 4XU3A 2XI9A 4NS5A 4LNPA 3MP6A 2QTVA 4KH0B 4ZGJB 3MEVA 1M90R 2MF2A 2G6FX 3JCMd 1SPKA 4ZGEB 4J6XA 2EGEA 3MEUA 2V1RA 1SEMA 2V8IA 2OAUA 1EIFA 3GNGA 2K3BA 4QQGA 1N8RU 4DQ2A 1JO8A 4XAXB 5GAMf 5A0DA 1SRLA 2VXFA 2DO3A 3H0HA 4RG2A 4M7DC 5LJ5j 2DE0X 1H641 3QHSA 1SAWA 5CAIA 2EKOA 4C0DB 4Z8AA 2K4YA 4OMMA 2EB4A 4IKFA 1YFNA 3REBB 2OTLT 2J7IA 3M57A 1JJ2P 4C0GA 2DXTA 4BDYA 3HSBA 4XTXA 1VQPQ 3E19A 3RKYA 2X35A 4ZGDB 1UGVA 2GTJA 4PL6A 3JCMh 3CC4Q 1VQNT 1BBZA 3DLMA 2DIGA 2F1LA 2MK5A 4PJOD 4LDXA 1BI0A 1VYVA 2KQWA 2RJDA 1WHGA 4AFSC 1YI2A 1IXDA 2A08A 3BW1A 1PKSA 3JB9F 1KHCA 2LDMA 2EW3A 4BI8B 1WJQA 1WXBA 3ZFJA 1MGQA 1VYTA 3CCVQ 2QA4Q 3SFMA 3QYGB 1R0BG 4M75G 4M77B 1PSFA 3D7SB 1PRMC 2B8AA 2OX7A 2K2VA 3CCUQ 5GAMd 3OS5A 2ED1A 3M55A 3M58A 4HCKA 1U8RA 3OS0A 1J3TA 2JW4A 4MZMA 5GANe 4NL3A 2YLCA 1VQKA 2EJGA 1LVKA 2W0ZA 3EHRA 1M1KU 1FMWA 1K8AR 2QQRA 1Y57A 1UJYA 3JB9G 4J9HA 1SKUB 2GQVA 2FPEA 3ZBDA 3VS4A 4A54A 4OF1A 1YITQ 1OZ2A 1BU1A 1ZQ1A 2FZGB 3JCMP 2RB6A 4C5EA 4XTWA 3FJ5A 2MYSA 3BDLA 2ECZA 2H8HA 3CCVA 2ROTA 4BB7A 3A8LB 1X43A 1I1JA 4PFZA 1VQOQ 5LJ3j 2AZVA 2IVWA 1WJSA 1BKBA 3OW2S 4PNOA 3LH5A 3P8HA 1K8AC 1ZUUA 1AHJB 8AT1B 1N9SA 3TVTA 1PC0A 1Q86C 2MWOA 2RQVA 2OTJA 4M78A 4F7UG 1VQMT 7AT1B 2EVRA 3I9QA 1PWTA 4HKEA 4DBRA 3FC3A 1ZUKA 3CPWP 2PU9B 4M75E 3MP8A 1S72A 1B34B 1SV6A 1Z9ZA 3EH1A 4C8QE 3J7AF 1WHHA 1UHFA 4A4GA 3PIPA 1GBQA 5I2SA 2J6FA 2VVKA 2X3WD 1H3HA 4EMHA 2RQTA 4C5HA 2DFUA 2M0OA 2HD0A 1M5Q1 5LJ3f 1NE8A 1AWWA 1BI2A 1NBEB 3VYHB 2QGFB 1GCQA 4C92D 2M1HA 2O31A 3CBMA 1ZLMA 2WSCE 2JN0A 1NLOC 1D3BA 1ZA1B 3NTKA 1VQ8A 2M16A 1GCPA 1WXTA 4FW1A 3G6EA 2Q1AX 3G4ST 3LWHA 3V7RA 1HXDA 2KRNA 3EGXA 2EYXA 4M78E 2QA4T 3I55T 3VS1A 3RKWA 4JZ4A 4PFPA 4LUEA 3QZ9B 5KYXA 2VYTA 3KBGA 1G83A 2QEXQ 1U1TA 5LL6S 1OEBA 4JRPA 2PTKA 3OYEA 4LDYA 4E7IA 2KYBA 2CH4A 2K2MA 1PRLC 3QG1A 4OVAA 5GMKm 3G4SQ 1WLPB 4HVUA 5FWCA 8ATCB 1RAEB 1QQJA 5LJ3g 1QVGA 4EMKB 2DMOA 3UWNA 1VQ6T 2L3PA 2RF0A 5HK3A 5LJ3d 3I35A 3O5ZA 4J9FA 2DKGA 1D3BB 3N5BB 5IN1A 1PM3A 1XNIA 2XIDA 2EKHA 3GBQA 2QEXT 2EYYA 4M77A 3CC4T 1NJIU 4BE2A 2FHDA 1QKWA 1VQKT 4DA4A 3EFSA 2KRSA 3EAEA 3OYDA 4E7JA 2ZZDA 3CMEA 2FYKA 3PIOA 4MDWA 1NYFA 1LPLA 3CC4A 1AWJA 1UGQB 2A28A 1PD0A 3RKXA 1NYGA 3PFSA 3QBYA 4FT2A 2HCKA 2COYA 5LJ5h 4M4ZA 1KIKA 4N0AA 3CMAA 4JLIA 2WACA 3CMET 1X6BA 2ESWA 4XTZA 4IURA 4M7DF 1K73U 3ER0A 2C0OA 2K5FA 2K5LA 3VUZA 4O5VA 2A37A 5D6YA 3X24B 1WXUA 2DF6A 4C8QD 4F04B 1K0SA 1T0JA 1I4K1 2RHYA 2KEAA 3DB4A 1GXIE 3HHTB 3A8HB 1BI3A 4BY6C 1SSHA 2MPXC 3A1PA 4X1VA 2Z0WA 2H3JA 2Q1CX 4M75D 3I5SA 2D9TA 1ZHIA 2C0TA 4IUPA 4J6WA 3QJ6A 1K4US 1AD5A 2RO0A 2QEXA 2K79A 1DJ7B 1MMNA 4J9GA 4O6JA 4J8OA 2DVJA 4CC7A 2RQRA 1NJIR 2DIQA 4HA8A 3CEYA 1Q82U 4M77C 1YHQA 2OJ2A 4LN2A 4M78D 4Z02A 3L2RA 1R77A 2E4HA 3VV0A 3JCMe 2GCXA 1X2KA 2R5AA 1I7OA 1Q81C 1WDXA 4Q5WA 3G7ZA 2F5KA 2O4XA 1Q7YC 1PSEA 3TU4K 4RTYA 2RI3A 3A8GB 1JRIA 4TVRA 2MWPA 1ZBXA 4PJMA 2HSPA 4OMFB 1YJ9T 3R6OA 1CKAA 3NTIA 1KD1U 2HQEA 3NPFA 1OI1A 3RR6A 1EZZB 1WX6A 1LOJA 2L8DA 1AVZC 2K5IA 1AWOA 5GAOn 5LJ5d 4HCCA 2XKOC 4M7AB 4JDSA 2NUPA 1WIEA 3JCMg 2M51A 3M53A 1UJ0A 3CC7A 3VS7A 4K11A 2HBWA 1SF9A 3LYIA 3PT9A 1RLPC 3OMCA 5CK9A 3QZ5B 1ZSZB 5KE2A 4Z88A 4RTUA 2CUBA 5IHIA 1NEGA 1M3AA 2XG8D 1SG5A 4J9DA 1TOVA 1W70A 3I56A 3DLLA 1VQ4A 4KGZB 3MO8A 4Z89A 2YDLA 4KBMB 4XQ3A 3O8VA 2FB7A 1PHTA 1NKQA 2D8HA 3CCVT 2RMOA 4OGEA 2FZCB 3RIRA 2K3XA 4OB1B 3CCJQ 4QVZA 5GAN2 2F2XA 2CT4A 2P4TA 3SWNB 2AK5A 5DY9A 1RAAB 2FEIA 1TS9A 4J9IA 4B9WA 3M9QA 5GJWB 4OGCA 1VUBA 2YSQA 2C06A 5D2FA 3TCJA 4NL2A 1BYMA 4ZTFA 3JCMc 3CCEQ 2EYQA 1QP2A 3EFOB 1I5OB 1VOMA 3CCRT 2A7YA 2ZPHB 1G3WA 3HTRA 3M0UA 5GAN3 3QSUA 4M7DG 2PVDB 1BCOA 3FLGA 5EC7A 2AKKA 2RM4A 2JS0A 1BIBA 4N4HA 2QAZA 1YITA 3HFNA 1D1BA 4GY5A 1AOJA 1AT1B 2DL7A 5GMKh 4XTYA 4M78B 1KFZA 4FT4A 3GP8A 3L2VA 4ATOA 2QYZA 2CZ7B 4X9DA 3URGA 4J9BA 3I56T 3OYBA 2PQWA 4KULA 3VS2A 5M9OA 2D6FA 1QVPA 3M4YA 2PVOB 5KYYB 2RHXA 1VQKQ 1KC8C 5HY6A 2DK3A 2AT1B 3CBOA 4YTLA 3QDFA 5FROA 2CP0A 4PK4A 3WXMB 1QVFA 3PMIA 2PUOB 1TUDA 5D6XA 5KYYA 3JAME 5ECAA 4JJDA 4C8QA 1C1AA 1YNZA 4C0ZA 4IUTA 3QIIA 5J26A 1KQSA 3CMAQ 2MOXA 5CQYA 4LD9K 2A3LA 2B86A 4PLIA 4OB3B 2QDLA 2CSIA 5I21A 1WHMA 2XK0A 3EHQA 4CI0C 1IO6A 5IH2A 2WSFE 3PMTA 1VQNA 2KI7A 2KXCA 4N4IA 1BB9A 2RD1A 1KQ1A 2ZPEB 2DEUA 4RUGA 1U5SA 1WHLA 4RMOA 5FWBA 4OB0B 2GF7A 4MZPA 1Y96A 2HSEB 3JCMQ 2OTLA 1Y71A 1VQOA 3RUXA 3JRZA 2LJ0A 1YCSB 3NGPA 1V29B 3CCQA 1VQ7Q 4OB2B 3H0FA 2EB6A 2PNIA 3QO3A 3CD6T 3P8DA 1I5LA 4J6YA 3LLRA 4B6MA 4OMQA 2FZKB 2KK4A 3C94A 2KNBB 4HCZA 5CVIA 1IHVA 1VIEA 5D6WA 2VB6A 4P5NA 2BZ8A 2FRWA 3M4GA 4FU6A 3HKSA 3G6ET 1RI0A 3HPWA 2RPNA 1GFCA 3MKDA 5GAN5 5KYWA 1KQ2A 3E2UA 4M7DA 1K9MC 1B3QA 3CCMA 4F7UA 4C0DC 4E2FB 3ULRB 3S3OA 1W6XA 4LDVA 2GGRA 4FL6A 1B34A 2R57A 1ZSGA 4RCCA 1QCNA 2X4XA 4F7UE 2YRDA 4AG2C 2A0FB 2LC4A 1Y7XA 2XU8A 4AFUC 4M7DE 1N9RA 4LDWA 2NUPB 4KUIA 1UDLA 1WHKA 5LJ5f 1TG0A 2YHTA 2X4JA 3LX7A 5D2JA 1QKXA 3OYFA 4OMNA 1AZGB 3OSSC 2ENMA 1YJ9Q 1Q7YU 1M2VB 2PZ1A 2F2VA 4IIOA 1JBMA 1JU5C 1UE9A 2E64A 3MHXA 4HT8A 3UDCA 2CT3A 1KQSS 1IB8A 4L59A 3CPWS 3EFRA 5IXBA 1EFNA 4J9EA 4LDUA 4XU0A 3CCJA 1YJNT 4Y92A 3RMQA 1UHCA 1K73C 4A4FA 2WQTA 1JJ2S 1QVFS 3CCEA 4JS4A 1UUEA 1RAFB 2HZYA 1XOVA 3OW2P 3LW5E 3J80E 5HCKA 3CCSA 5KYUA 2CZ6B 1BCMA 2F5TX 3NFCA 4JUVA 1O75A 5D7UA 1HSQA 3C4SA 1E6HA 5GAOr 2KXDA 2FG0A 2L3SA 3FEOA 5J39A 3UA6A 5GANh 2JNGA 3CCLT 4RTZA 1WYXA 1OZ3A 2FPDA 4M7AD 1RLQC 1MHNA 5GAMj 2RQWA 5CKHA 2NWMA 1MNEA 2Y4XA 2CGHA 4E7ZA 4PJOA 2ZGWA 5FW9A 2JM8A 2EQIA 2SEMA 2K3YA 3INZA 1VQ9A 2M02A 4N4GA 2LVMA 3H41A 1Q7YR 3CCMT 3V77A 2NUTB 2P4RA 3E1SA 5HK0A 5DLQE 4KT0E 2QDYB 1UGPB 2KYMA 2LMJA 3M0TA 2EGCA 2I0NA 2DL4A 1G2BA 5GAN4 3SDZA 2P0KA 1RADB 1X01A 3CD6A 3CCSQ 1OV3A 1SRMA 4JZ3A 2X4WA 4FCYA 2F69A 2MIOA 2HAXA 2RH2A 2RI5A 2X4YA 1Q95G 4B9XA 3PVLA 1KHIA 1VQ5A 2QQSA 2KT1A 4A53A 3S52A 2DX1A 1U1SA 2RNAA 4PLLA 1M30A 2JS2A 3FIFA 3X26B 2DBKA 2DETA 2ED0A 1QVGS 3QDRB 1VQOT 3CXCS 4D8KA 4Y91A 4FYWB 2QGGA 3KFVA 4KGVB 1JQQA 1IREB 5FU6C 4C8QC 2J05A 3KXTA 1FMKA 2DL5A 2DRMA 2EJ9A 2ATCB 2JMCA 1X6OA 4RCBA 5J3BA 4E47A 3LGFA 3CCQQ 2KBTA 3BQBA 3OS1A 4DEYA 1ZBJA 5GMKe 1GFDA 2CP3A 3P8BB 5GAN6 3MP1A 2CZ0B 5FRNA 3UT1A 1M4ZA 4RTWA 3EGXB 1KD1C 1Q86R 2V26A 3EG2A 1UG1A 4BUGA 1P92A 1HK9A 1OPKA 3G4SA 4M7AF 2D8JA 5I22A 3I56Q 3BFMA 4C8QF 3CXCP 3Q1JA 1D1AA 2X9HA 3CPWA 1UGRB 4QKUA 4ELYC 3VU3C 1VQ9T 4C92B 1M1KR 2AZSA 4PFOA 2E12A 4CC4B 4BY6B 1NR9A 4AMCA 1MMDA 2BZYA 1QW1A 3OY9A 1W2BA 4F7UF 4J7IA 4MAQA 1TTHB 1Y96B 2E1HA 4DOVA 3CD6Q 1G5VA 3PGGA 1W2BS 3CCLA 3H8ZA 2C0IA 2RJCA 2KT8A 2JMAA 1YITT 4CC2A 1W1FA 3ZL7C 1BK2A 3CC2T 2O9SA 3DKMA 5GMKl 2DERA 2BIVA 2AKLA 5CKFA 2NYSA 2CP7A 2RK1A 5DLOA 2CP5A 3QWYA 4X9CA 3M5AA 1AWXA 2HL3A 1RACB 2DJQA 1QVGP 4UC4A 1FMVA 3BDUA 1ZSZC 3ZEHA 4QQ6A 1YCYA 1VQMQ 1OULA 5GAOl 1FX7A 4D8DA 4ZN3A 5KH6A 4BE1A 1WQWA 3TSWA 2R58A 4EMKC 1X6GA 1CKBA 1YHQQ 2CZ1B 4AFQC 4LE9A 3L42A 1VQ4T 1WNLA 3VS0A 1AZEA 2YRCA 1Q82R 2LX9A 4D6WA 1YIJA 2LQNA 1VQLQ 3R6NA 1JJ2A 4ESRA 2DZCA 3JCMW 3OYJA 2K57A 2EQJA 1IGQA 4DBQA 1Z9QA 2VGNA 2KMTA 1I81A 2OI3A 1YJNQ 2LJ1A 3GLXA 2DVEA 2VV5A 1E7OA 1WJRA 5A2QE 3JV3A 2LTOA 3OYCA 4PJOE 4C92F 3GPLA 2V1QA 1CSKA 5GMKi 2DLPA 4RTVA 2DL3A 1WA7A 4BACA 1N27A 1TXQA 2E6NA 1C0MA 1WZOA 3I55Q 5AYFA 4C92E 1YWPA 3OYAA 1WQ7A 3VUBA 1K0XA 5LJ3h 3OYYA 2K9GA 4DEXA 4JRIA 1U06A 5D2IA 4BI3A 1Y0MA 2KVQG 2L5QA 4RTXA 5GAMe 3H0IA 1D0XA 2LT1A 1WPYA 3CC2Q 3GOXA 1YJWT 2RJEA 3C0CA 1SSFA 2VC8A 3H9NA 4FSXA 5LJ5g 4N0AC 2QASA 4JLGA 2L89A 1IHWA 4M78F 5KYXB 1M90U 2G3RA 2DTIA 2VWFA 2JOYA 1T3SA 3RDVA 4JS5A 3JCMb 3SHWA 2RK2A 3L2WA 2WSEE 1NM7A 3LH0A 5GJVB 1GTTA 1K9MR 4M77D 2DAQA 3I5RA 3SWNA 4FYXB 2LCLA 1Q81R 3SEMA 3G71A 1QP3A 4NOYA 5GAMg 2L2PA 1ABOA 4J9CA 1GL5A 4F7UB 4MMKA 3OYKA 1VQLA 5D2KA 2EQUA 2DD4A 1TU0B 3QPHA 3GIBA 2QG9B 2QXFA 1MMAA 2HL5C 2LRQA 4HCBA 4M7AG 3VS5A 1VQPT 1NG2A 2J6OA 2DTOA 2HQHA 2KE9A 2ZPGB 1B7TA 3FRNA 3CQTA 2QQBA 1M3BA 2MAMA 1VQPA 3CPFA 3M54A 4GBQA 2L0AA 1IRXA 4GLKA 3CMAT 2I2LA 2KGTA 1QWFA 1XJWB 4ANJA 2DXCA 3OYHA 1B07A 1RAGB 1VQLT 1MV0B 1NPPA 1UEBA 2EQMA 1VQ9Q 1GCQC 2FVUA 1N5ZA 3G71Q 3CCRQ 1QMCA 1YI2Q 3OA6A 1W4SA 2AIRB 3TQ7P 3MJXA 2QQAA 4PJLA 3UATA 3HRTA 2O4XB 2P84A 2YLBA 1VQ8Q 2RN8A 2GNCA 3M59A 1N8RC 2YT6A 1M8MA 1OU9A 2E5QA 1SHGA 2W10A 4HVVA 4JJCA 3JCMf 2X51A 3GF5A 5C6SA 1LJOA 1G3YA 1PCXA 1K8AU 1W2BP 2DJZA 1M8VA 4LXCA 4VUBA 5GAOq 5GANg 4E7KA 3HL8A 4ORZA 3X25B 2LCCA 4OP0A 5IT9E 2IPOB 3MCAB 3RMSA 2KRMA 4M77G 4RTTA 2JTEA 3U23A 2M0YA 1VQ8T 2LZ6B 2LX7A 3ASKA 2PVGB 4JJBA 4ZN1A 4C5GA 2FL7A 3UPUA 2EYWA 1VQ4Q 3OS2A 4M7DB 4OMLA 1X75C 2KR3A 2VASA 1OYXA 2BTTA 2LQ8A 4BD3A 4JJNK 5EG2A 2V8JA 2DILA 1S72T 3L2QA 3F70A 4CC3A 5L8RE 5CIUA 3OBWA 4ELZC 3EG0A 1LNXA 1RL2A 2FO0A 3TSZA 3A5ZB 3CCET 2E5KA 2EWNA 2BE7D 4KRTA 4CRIA 1G3SA 2EPDA 4MMLA 3V8KA 1IGUA 1PG5B 4C92A 1NZ9A 2O9VA 1FWZA 4JRQA 1XQHA 5GANd 2XD0A 1WHJA 3M56A 2QTXA 3V7CA 5CKDA 2YWWA 4C8QG 1K9AA 4RG8A 1KC8R 1K76A 2ZPIB 4JRKA 1UGSB 2LNHB 2KDSA 1TWBA 2HDAA 3CCLQ 4A4HA 2XICA 3MPUB 3HP9A 1NPRA 3TREA 5C0MA 5FU7B 3EH2A 4PJOB 4XU1A 1JEGA 2JTMA 3CXCA 1RUWA 2Y90A 2Q19X 1K1ZA 1ZX6A 1N8RR 1MMGA 3AT1B 4OMPA 3RBBB 4QVDA 1HYOA 1M2OA 5D2GA 3KUFA 1YJWQ 3SD4A 5HKCA 4M75F 3LWIA 1ZA2B 4L5GA 4M7AC 1OOTA 1KJWA 5GAN8 5GAOp 3X28B 2D1XA 3RESA 1UECA 1OPLA 1M27C 3M0QA 1UB4A 2EIFA 1M1FA 3OYLA 5A0LA 1X69A 1KK7A 3G1JA 2CH4W 4HT9A 1QLYA 2ZPFB 2H3EB 5GAN7 2LCSA 2M9UA 2L3QA 1VYUA 4EDUA 2EGAA 1I07A 1TUCA 2NUZA 2CYZB 1NEBA 3AHUA 2QQ9A 1OQKA 1KC8U 1TUGB 3EGDA 3EG9B 2ABLA 3OYGA 2DRKA 1PNJA 4KH1B 4E7SA 3PE0A 3E9FA 1MUZA 4M77E 4F14A 1VQ7T 4FYVB 1VQ6A 2EFIA 1YJWA 2JT4A 2KSSA 1G3TA 3EFOA 3JB9H 4PJOF 1VQ5Q 3EGUA 2COZA 1EX4A 3VRZA 4DOWA 3VS6A 1Q86U 5CQXA 5FRMA 4FIBA 3REAB 4EMGA 1WI7A 3BY7A 3CCMQ 1A0NB 2E3IA 1O9SA 3UA7A 4J5YA 3M0PA 4AFZC 3JB9I 4QQDA 1X27A 4E7HA 4WTOB 2XDPA 4C92C 2Q18X 2D0NA 1QCOA 5IHNA 3DB3A 3RNJA 3PTAA 4FYYB 1M3CA 3OYNA 4X34A 4A4KA 2BUDA 4HXJA 3OMGA 1VQ5T 2DYIA 3CCRA 5DM7R 2A36A 1V76A 4ME7A 1T0HA 4XTUA 3OW2A 4KUDK 2XHCA 6AT1B 3OQ5A 5I2MA 3E9GA 1YIJT 3CC7T 2LQWA 2GFUA 2LP5A 1M90C 3HRUA 5I11A 3VS3A 3QWXX 4M7AA 1BI1A 5GMKj 3IQLA 4LUDA 1D0ZA 4XK8E 4FM4B 1UFFA 4AG1C 1YJ9A 3A8OB 4R0KA 5FU6B 4C8QB 1X2QA 3EG1A 5CO7A 2E6ZA 3META 1C6VX 1QCFA 1M1KC 2R5MA 1R8OB 1D1CA 3CBPA 2YRVA 1VQ6Q 2RQUA 1LCKA 2VGMA 3CC7Q 3RERA 2YUPA 4M75A 4GLMA 3JB9D 2OTLQ 1S1NA 2OAWA 3A98A 2MCNA 2GBQA 2KAFA 3C95A 5IXFA 2IIMA 2V8KA 2O88A 4ZTJA 1MV3A 5KYNA 2LNVA 1WGSA 5GAOm 5L23A 1KQSP 2ZPBB 3QUIA 1I0CA 2ZCFB 2YXYA 4PJJA 3JCMJ 4QVCA 5IHKA 3VJPA 1TSFA 2CKKA 2DYBA 2PUKB 2NLUA 2EJFA 4II1A 4C92G 3CMEQ 1UTIA 3S3NA 1SHFA 3QJYA 1HJDA 4V2SA 3WVEB 1D09B 3QKJA 3JB9J 1NLPC 1V1CA 1VQ7A 4A4EA 2KROA 2JM9A 2DD5A 3OBYA 4PJOG 4XU2A 2DZ9A 1ABQA 9ATCB 1K73R 1QVFP 3EG9A 4A63B 2HNIA 3HRSA 2BE9B 4F17A 2EYZA 3VKIA 2F2WA 2L3RA 2MI6A 2HQXA 2OTJQ 3C12A 4E6RA 2DA9A 5D2HA 2DTHA 2MMPA 1VIFA 3NTHA 1QWEA 4C0FA 1Y07A 3FB9A 3L1AA 3QXEB 2FPFA 1TH7A 1WFWA 4MZTA 1ZSZA 2HEQA 2CREA 1JB0E 2VKNA 1HD3A 2QI2A 4F16A 1G8XA 4PKCC 3V8JA 2CDTA 2ZAEA 3V7SA 4R56A 2RI2A 4DBFA 4E7LA 2CS7A 2FRYA 2O2OA 1M9SA 3OYMA 4EIKA 5KYUB 2GQIA 1Q82C 2RHUA 2Q1DX 2CUDA 2D0QB 2CP6A 4OMOA 1K9MU 1RI9A 3HFOA 1H8KA 1Q81U 2CP2A 1M1GA 2EQKA 3I55A 2EAYA 2JXBA 1D0YA 2LQKA 3CCQT 4JPBW 1YBYA 5CKBA 5KE3A 1U3OA 2DPPB 5CCAA 2LT4A 2K7AA 2HKQB 3NHNA 2HMAA 2XMFA 4M78C 2RHIA 1VQNQ 1RAHB 3A8MB 3MEWA 1N6AA 2E65A 1H3ZA 1JXOA 2DBMA 1YHQT 1T3LA 2KY9A 4C5IA 4M78G 1XTDA 3X20B 1KG1A 2E41A 4HVWA 1ZUYA 1YN8A 2GTOA 2E70A 2JJ9A 1PKTA 2DXBA 3EG3A 3CCUT 4KGXB 5IAYA 2Y4YA 3L2ZA 4AT1B 2HBPA 2P0PA 2GFAA 1NJIC 1YP5A 2DL8A 1FXXA 4IUQA 3MEAA 2JZ2A 2RJFA 3G6EQ 5KYWB 2QA4A 2K6DA 3JCMV 4WCIA 2VXEA 1I8FA 2AHJB 3SWNC 4BI4A 1FYNA 1GBRA 2RHZA 1YWOA 4M7AE 4M75C 1IZ6A 2BZXA 1KD1R 1VQMA 1VA7A 1AEYA 1YIJQ 4DBHA 1KSWA 2ROLA 1MNDA 4J7FA 3QYHB 3T9NA 4BE0A 4MDXA 3WVDB 3LZKA 3LGLA 2DNUA 5LJ3e 2X3XD 3FJPA 3G71T 3VRYA 1BIAA 3BE3A 2COWA 2O01E 2XDBA 2RA2A 2E3HA 4Y28E 2J06A 1OX9A 2J6KA 4M75B 5A0GA 3M0RA 3THKA 4IUVA 5AT1B 3L2UA 1PD1A 4FW2A 3UF4A 2DEQA
chains in the Genus database with same CATH topology
1GTTA 1SAWA 4QKUA 3LZKA 5D2FA 1NKQA 1HYOA 2Q1AX 5D2GA 1WZOA 5D2HA 2DFUA 3QDFA 2EB5A 2EB4A 5D2JA 4DBFA 3V77A 1NR9A 2WQTA 3R6OA 4PFZA 1QCNA 1SV6A 3RR6A 2HZYA 2Q1DX 2Q18X 5D2KA 4MAQA 3BQBA 1QCOA 3S52A 2EB6A 2Q19X 2Q1CX 1I7OA 5D2IA 1QQJA 4DBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTT A;  1SAW A;  4QKU A;  3LZK A;  5D2F A;  1NKQ A;  1HYO A;  2Q1A X;  5D2G A;  1WZO A;  5D2H A;  2DFU A;  3QDF A;  2EB5 A;  2EB4 A;  5D2J A;  4DBF A;  3V77 A;  1NR9 A;  2WQT A;  3R6O A;  4PFZ A;  1QCN A;  1SV6 A;  3RR6 A;  2HZY A;  2Q1D X;  2Q18 X;  5D2K A;  4MAQ A;  3BQB A;  1QCO A;  3S52 A;  2EB6 A;  2Q19 X;  2Q1C X;  1I7O A;  5D2I A;  1QQJ A;  4DBH A; 
#chains in the Genus database with same CATH topology
 1JXM A;  3JSC A;  3NMZ C;  4R55 A;  1GRI A;  2IG0 A;  1R0C B;  3ME9 A;  3TEE A;  2JVV A;  4IUU A;  4XTV A;  3OYI A;  3CCS T;  3CCJ T;  1RAI B;  1YJN A;  3S3M A;  1H92 A;  2YUN A;  3J81 E;  3S6W A;  2HKN A;  2DM1 A;  2E10 A;  2VUB A;  3FDR A;  3OSV A;  4BDZ A;  2P0Q A;  1OX8 A;  3CC2 A;  1ACM B;  2BKD N;  3V8L A;  2EB5 A;  1S72 Q;  5GAN j;  1F1B B;  2CSQ A;  2JTF A;  4M7D D;  5FU7 C;  3M0S A;  5KCO A;  4PJO C;  3GNF B;  4FSS A;  3EGD B;  3PNW C;  4L6V 5;  5GAM h;  2YUO A;  2YUQ A;  5CR2 A;  5KCH A;  1E6G A;  2QK0 A;  2DXU A;  4PJN A;  1OU8 A;  3VYG A;  4WF2 A;  1RAB B;  4IIM A;  3SB2 A;  3OB9 A;  2LJ3 A;  3H6Z A;  5LJ5 e;  1ARK A;  5FLX E;  1YI2 T;  2NUT A;  2JUF A;  4ZNX A;  4QW2 A;  2EBP A;  5CKE A;  5GAN f;  2OTJ T;  3JCM X;  4M77 F;  4LD6 A;  1M2V A;  4QT7 A;  4J83 A;  3PVQ A;  4EMK A;  3CCU A;  2SRC A;  2XDD A;  4EPC A;  4RKU E;  4XU3 A;  2XI9 A;  4NS5 A;  4LNP A;  3MP6 A;  2QTV A;  4KH0 B;  4ZGJ B;  3MEV A;  1M90 R;  2MF2 A;  2G6F X;  3JCM d;  1SPK A;  4ZGE B;  4J6X A;  2EGE A;  3MEU A;  2V1R A;  1SEM A;  2V8I A;  2OAU A;  1EIF A;  3GNG A;  2K3B A;  4QQG A;  1N8R U;  4DQ2 A;  1JO8 A;  4XAX B;  5GAM f;  5A0D A;  1SRL A;  2VXF A;  2DO3 A;  3H0H A;  4RG2 A;  4M7D C;  5LJ5 j;  2DE0 X;  1H64 1;  3QHS A;  1SAW A;  5CAI A;  2EKO A;  4C0D B;  4Z8A A;  2K4Y A;  4OMM A;  2EB4 A;  4IKF A;  1YFN A;  3REB B;  2OTL T;  2J7I A;  3M57 A;  1JJ2 P;  4C0G A;  2DXT A;  4BDY A;  3HSB A;  4XTX A;  1VQP Q;  3E19 A;  3RKY A;  2X35 A;  4ZGD B;  1UGV A;  2GTJ A;  4PL6 A;  3JCM h;  3CC4 Q;  1VQN T;  1BBZ A;  3DLM A;  2DIG A;  2F1L A;  2MK5 A;  4PJO D;  4LDX A;  1BI0 A;  1VYV A;  2KQW A;  2RJD A;  1WHG A;  4AFS C;  1YI2 A;  1IXD A;  2A08 A;  3BW1 A;  1PKS A;  3JB9 F;  1KHC A;  2LDM A;  2EW3 A;  4BI8 B;  1WJQ A;  1WXB A;  3ZFJ A;  1MGQ A;  1VYT A;  3CCV Q;  2QA4 Q;  3SFM A;  3QYG B;  1R0B G;  4M75 G;  4M77 B;  1PSF A;  3D7S B;  1PRM C;  2B8A A;  2OX7 A;  2K2V A;  3CCU Q;  5GAM d;  3OS5 A;  2ED1 A;  3M55 A;  3M58 A;  4HCK A;  1U8R A;  3OS0 A;  1J3T A;  2JW4 A;  4MZM A;  5GAN e;  4NL3 A;  2YLC A;  1VQK A;  2EJG A;  1LVK A;  2W0Z A;  3EHR A;  1M1K U;  1FMW A;  1K8A R;  2QQR A;  1Y57 A;  1UJY A;  3JB9 G;  4J9H A;  1SKU B;  2GQV A;  2FPE A;  3ZBD A;  3VS4 A;  4A54 A;  4OF1 A;  1YIT Q;  1OZ2 A;  1BU1 A;  1ZQ1 A;  2FZG B;  3JCM P;  2RB6 A;  4C5E A;  4XTW A;  3FJ5 A;  2MYS A;  3BDL A;  2ECZ A;  2H8H A;  3CCV A;  2ROT A;  4BB7 A;  3A8L B;  1X43 A;  1I1J A;  4PFZ A;  1VQO Q;  5LJ3 j;  2AZV A;  2IVW A;  1WJS A;  1BKB A;  3OW2 S;  4PNO A;  3LH5 A;  3P8H A;  1K8A C;  1ZUU A;  1AHJ B;  8AT1 B;  1N9S A;  3TVT A;  1PC0 A;  1Q86 C;  2MWO A;  2RQV A;  2OTJ A;  4M78 A;  4F7U G;  1VQM T;  7AT1 B;  2EVR A;  3I9Q A;  1PWT A;  4HKE A;  4DBR A;  3FC3 A;  1ZUK A;  3CPW P;  2PU9 B;  4M75 E;  3MP8 A;  1S72 A;  1B34 B;  1SV6 A;  1Z9Z A;  3EH1 A;  4C8Q E;  3J7A F;  1WHH A;  1UHF A;  4A4G A;  3PIP A;  1GBQ A;  5I2S A;  2J6F A;  2VVK A;  2X3W D;  1H3H A;  4EMH A;  2RQT A;  4C5H A;  2DFU A;  2M0O A;  2HD0 A;  1M5Q 1;  5LJ3 f;  1NE8 A;  1AWW A;  1BI2 A;  1NBE B;  3VYH B;  2QGF B;  1GCQ A;  4C92 D;  2M1H A;  2O31 A;  3CBM A;  1ZLM A;  2WSC E;  2JN0 A;  1NLO C;  1D3B A;  1ZA1 B;  3NTK A;  1VQ8 A;  2M16 A;  1GCP A;  1WXT A;  4FW1 A;  3G6E A;  2Q1A X;  3G4S T;  3LWH A;  3V7R A;  1HXD A;  2KRN A;  3EGX A;  2EYX A;  4M78 E;  2QA4 T;  3I55 T;  3VS1 A;  3RKW A;  4JZ4 A;  4PFP A;  4LUE A;  3QZ9 B;  5KYX A;  2VYT A;  3KBG A;  1G83 A;  2QEX Q;  1U1T A;  5LL6 S;  1OEB A;  4JRP A;  2PTK A;  3OYE A;  4LDY A;  4E7I A;  2KYB A;  2CH4 A;  2K2M A;  1PRL C;  3QG1 A;  4OVA A;  5GMK m;  3G4S Q;  1WLP B;  4HVU A;  5FWC A;  8ATC B;  1RAE B;  1QQJ A;  5LJ3 g;  1QVG A;  4EMK B;  2DMO A;  3UWN A;  1VQ6 T;  2L3P A;  2RF0 A;  5HK3 A;  5LJ3 d;  3I35 A;  3O5Z A;  4J9F A;  2DKG A;  1D3B B;  3N5B B;  5IN1 A;  1PM3 A;  1XNI A;  2XID A;  2EKH A;  3GBQ A;  2QEX T;  2EYY A;  4M77 A;  3CC4 T;  1NJI U;  4BE2 A;  2FHD A;  1QKW A;  1VQK T;  4DA4 A;  3EFS A;  2KRS A;  3EAE A;  3OYD A;  4E7J A;  2ZZD A;  3CME A;  2FYK A;  3PIO A;  4MDW A;  1NYF A;  1LPL A;  3CC4 A;  1AWJ A;  1UGQ B;  2A28 A;  1PD0 A;  3RKX A;  1NYG A;  3PFS A;  3QBY A;  4FT2 A;  2HCK A;  2COY A;  5LJ5 h;  4M4Z A;  1KIK A;  4N0A A;  3CMA A;  4JLI A;  2WAC A;  3CME T;  1X6B A;  2ESW A;  4XTZ A;  4IUR A;  4M7D F;  1K73 U;  3ER0 A;  2C0O A;  2K5F A;  2K5L A;  3VUZ A;  4O5V A;  2A37 A;  5D6Y A;  3X24 B;  1WXU A;  2DF6 A;  4C8Q D;  4F04 B;  1K0S A;  1T0J A;  1I4K 1;  2RHY A;  2KEA A;  3DB4 A;  1GXI E;  3HHT B;  3A8H B;  1BI3 A;  4BY6 C;  1SSH A;  2MPX C;  3A1P A;  4X1V A;  2Z0W A;  2H3J A;  2Q1C X;  4M75 D;  3I5S A;  2D9T A;  1ZHI A;  2C0T A;  4IUP A;  4J6W A;  3QJ6 A;  1K4U S;  1AD5 A;  2RO0 A;  2QEX A;  2K79 A;  1DJ7 B;  1MMN A;  4J9G A;  4O6J A;  4J8O A;  2DVJ A;  4CC7 A;  2RQR A;  1NJI R;  2DIQ A;  4HA8 A;  3CEY A;  1Q82 U;  4M77 C;  1YHQ A;  2OJ2 A;  4LN2 A;  4M78 D;  4Z02 A;  3L2R A;  1R77 A;  2E4H A;  3VV0 A;  3JCM e;  2GCX A;  1X2K A;  2R5A A;  1I7O A;  1Q81 C;  1WDX A;  4Q5W A;  3G7Z A;  2F5K A;  2O4X A;  1Q7Y C;  1PSE A;  3TU4 K;  4RTY A;  2RI3 A;  3A8G B;  1JRI A;  4TVR A;  2MWP A;  1ZBX A;  4PJM A;  2HSP A;  4OMF B;  1YJ9 T;  3R6O A;  1CKA A;  3NTI A;  1KD1 U;  2HQE A;  3NPF A;  1OI1 A;  3RR6 A;  1EZZ B;  1WX6 A;  1LOJ A;  2L8D A;  1AVZ C;  2K5I A;  1AWO A;  5GAO n;  5LJ5 d;  4HCC A;  2XKO C;  4M7A B;  4JDS A;  2NUP A;  1WIE A;  3JCM g;  2M51 A;  3M53 A;  1UJ0 A;  3CC7 A;  3VS7 A;  4K11 A;  2HBW A;  1SF9 A;  3LYI A;  3PT9 A;  1RLP C;  3OMC A;  5CK9 A;  3QZ5 B;  1ZSZ B;  5KE2 A;  4Z88 A;  4RTU A;  2CUB A;  5IHI A;  1NEG A;  1M3A A;  2XG8 D;  1SG5 A;  4J9D A;  1TOV A;  1W70 A;  3I56 A;  3DLL A;  1VQ4 A;  4KGZ B;  3MO8 A;  4Z89 A;  2YDL A;  4KBM B;  4XQ3 A;  3O8V A;  2FB7 A;  1PHT A;  1NKQ A;  2D8H A;  3CCV T;  2RMO A;  4OGE A;  2FZC B;  3RIR A;  2K3X A;  4OB1 B;  3CCJ Q;  4QVZ A;  5GAN 2;  2F2X A;  2CT4 A;  2P4T A;  3SWN B;  2AK5 A;  5DY9 A;  1RAA B;  2FEI A;  1TS9 A;  4J9I A;  4B9W A;  3M9Q A;  5GJW B;  4OGC A;  1VUB A;  2YSQ A;  2C06 A;  5D2F A;  3TCJ A;  4NL2 A;  1BYM A;  4ZTF A;  3JCM c;  3CCE Q;  2EYQ A;  1QP2 A;  3EFO B;  1I5O B;  1VOM A;  3CCR T;  2A7Y A;  2ZPH B;  1G3W A;  3HTR A;  3M0U A;  5GAN 3;  3QSU A;  4M7D G;  2PVD B;  1BCO A;  3FLG A;  5EC7 A;  2AKK A;  2RM4 A;  2JS0 A;  1BIB A;  4N4H A;  2QAZ A;  1YIT A;  3HFN A;  1D1B A;  4GY5 A;  1AOJ A;  1AT1 B;  2DL7 A;  5GMK h;  4XTY A;  4M78 B;  1KFZ A;  4FT4 A;  3GP8 A;  3L2V A;  4ATO A;  2QYZ A;  2CZ7 B;  4X9D A;  3URG A;  4J9B A;  3I56 T;  3OYB A;  2PQW A;  4KUL A;  3VS2 A;  5M9O A;  2D6F A;  1QVP A;  3M4Y A;  2PVO B;  5KYY B;  2RHX A;  1VQK Q;  1KC8 C;  5HY6 A;  2DK3 A;  2AT1 B;  3CBO A;  4YTL A;  3QDF A;  5FRO A;  2CP0 A;  4PK4 A;  3WXM B;  1QVF A;  3PMI A;  2PUO B;  1TUD A;  5D6X A;  5KYY A;  3JAM E;  5ECA A;  4JJD A;  4C8Q A;  1C1A A;  1YNZ A;  4C0Z A;  4IUT A;  3QII A;  5J26 A;  1KQS A;  3CMA Q;  2MOX A;  5CQY A;  4LD9 K;  2A3L A;  2B86 A;  4PLI A;  4OB3 B;  2QDL A;  2CSI A;  5I21 A;  1WHM A;  2XK0 A;  3EHQ A;  4CI0 C;  1IO6 A;  5IH2 A;  2WSF E;  3PMT A;  1VQN A;  2KI7 A;  2KXC A;  4N4I A;  1BB9 A;  2RD1 A;  1KQ1 A;  2ZPE B;  2DEU A;  4RUG A;  1U5S A;  1WHL A;  4RMO A;  5FWB A;  4OB0 B;  2GF7 A;  4MZP A;  1Y96 A;  2HSE B;  3JCM Q;  2OTL A;  1Y71 A;  1VQO A;  3RUX A;  3JRZ A;  2LJ0 A;  1YCS B;  3NGP A;  1V29 B;  3CCQ A;  1VQ7 Q;  4OB2 B;  3H0F A;  2EB6 A;  2PNI A;  3QO3 A;  3CD6 T;  3P8D A;  1I5L A;  4J6Y A;  3LLR A;  4B6M A;  4OMQ A;  2FZK B;  2KK4 A;  3C94 A;  2KNB B;  4HCZ A;  5CVI A;  1IHV A;  1VIE A;  5D6W A;  2VB6 A;  4P5N A;  2BZ8 A;  2FRW A;  3M4G A;  4FU6 A;  3HKS A;  3G6E T;  1RI0 A;  3HPW A;  2RPN A;  1GFC A;  3MKD A;  5GAN 5;  5KYW A;  1KQ2 A;  3E2U A;  4M7D A;  1K9M C;  1B3Q A;  3CCM A;  4F7U A;  4C0D C;  4E2F B;  3ULR B;  3S3O A;  1W6X A;  4LDV A;  2GGR A;  4FL6 A;  1B34 A;  2R57 A;  1ZSG A;  4RCC A;  1QCN A;  2X4X A;  4F7U E;  2YRD A;  4AG2 C;  2A0F B;  2LC4 A;  1Y7X A;  2XU8 A;  4AFU C;  4M7D E;  1N9R A;  4LDW A;  2NUP B;  4KUI A;  1UDL A;  1WHK A;  5LJ5 f;  1TG0 A;  2YHT A;  2X4J A;  3LX7 A;  5D2J A;  1QKX A;  3OYF A;  4OMN A;  1AZG B;  3OSS C;  2ENM A;  1YJ9 Q;  1Q7Y U;  1M2V B;  2PZ1 A;  2F2V A;  4IIO A;  1JBM A;  1JU5 C;  1UE9 A;  2E64 A;  3MHX A;  4HT8 A;  3UDC A;  2CT3 A;  1KQS S;  1IB8 A;  4L59 A;  3CPW S;  3EFR A;  5IXB A;  1EFN A;  4J9E A;  4LDU A;  4XU0 A;  3CCJ A;  1YJN T;  4Y92 A;  3RMQ A;  1UHC A;  1K73 C;  4A4F A;  2WQT A;  1JJ2 S;  1QVF S;  3CCE A;  4JS4 A;  1UUE A;  1RAF B;  2HZY A;  1XOV A;  3OW2 P;  3LW5 E;  3J80 E;  5HCK A;  3CCS A;  5KYU A;  2CZ6 B;  1BCM A;  2F5T X;  3NFC A;  4JUV A;  1O75 A;  5D7U A;  1HSQ A;  3C4S A;  1E6H A;  5GAO r;  2KXD A;  2FG0 A;  2L3S A;  3FEO A;  5J39 A;  3UA6 A;  5GAN h;  2JNG A;  3CCL T;  4RTZ A;  1WYX A;  1OZ3 A;  2FPD A;  4M7A D;  1RLQ C;  1MHN A;  5GAM j;  2RQW A;  5CKH A;  2NWM A;  1MNE A;  2Y4X A;  2CGH A;  4E7Z A;  4PJO A;  2ZGW A;  5FW9 A;  2JM8 A;  2EQI A;  2SEM A;  2K3Y A;  3INZ A;  1VQ9 A;  2M02 A;  4N4G A;  2LVM A;  3H41 A;  1Q7Y R;  3CCM T;  3V77 A;  2NUT B;  2P4R A;  3E1S A;  5HK0 A;  5DLQ E;  4KT0 E;  2QDY B;  1UGP B;  2KYM A;  2LMJ A;  3M0T A;  2EGC A;  2I0N A;  2DL4 A;  1G2B A;  5GAN 4;  3SDZ A;  2P0K A;  1RAD B;  1X01 A;  3CD6 A;  3CCS Q;  1OV3 A;  1SRM A;  4JZ3 A;  2X4W A;  4FCY A;  2F69 A;  2MIO A;  2HAX A;  2RH2 A;  2RI5 A;  2X4Y A;  1Q95 G;  4B9X A;  3PVL A;  1KHI A;  1VQ5 A;  2QQS A;  2KT1 A;  4A53 A;  3S52 A;  2DX1 A;  1U1S A;  2RNA A;  4PLL A;  1M30 A;  2JS2 A;  3FIF A;  3X26 B;  2DBK A;  2DET A;  2ED0 A;  1QVG S;  3QDR B;  1VQO T;  3CXC S;  4D8K A;  4Y91 A;  4FYW B;  2QGG A;  3KFV A;  4KGV B;  1JQQ A;  1IRE B;  5FU6 C;  4C8Q C;  2J05 A;  3KXT A;  1FMK A;  2DL5 A;  2DRM A;  2EJ9 A;  2ATC B;  2JMC A;  1X6O A;  4RCB A;  5J3B A;  4E47 A;  3LGF A;  3CCQ Q;  2KBT A;  3BQB A;  3OS1 A;  4DEY A;  1ZBJ A;  5GMK e;  1GFD A;  2CP3 A;  3P8B B;  5GAN 6;  3MP1 A;  2CZ0 B;  5FRN A;  3UT1 A;  1M4Z A;  4RTW A;  3EGX B;  1KD1 C;  1Q86 R;  2V26 A;  3EG2 A;  1UG1 A;  4BUG A;  1P92 A;  1HK9 A;  1OPK A;  3G4S A;  4M7A F;  2D8J A;  5I22 A;  3I56 Q;  3BFM A;  4C8Q F;  3CXC P;  3Q1J A;  1D1A A;  2X9H A;  3CPW A;  1UGR B;  4QKU A;  4ELY C;  3VU3 C;  1VQ9 T;  4C92 B;  1M1K R;  2AZS A;  4PFO A;  2E12 A;  4CC4 B;  4BY6 B;  1NR9 A;  4AMC A;  1MMD A;  2BZY A;  1QW1 A;  3OY9 A;  1W2B A;  4F7U F;  4J7I A;  4MAQ A;  1TTH B;  1Y96 B;  2E1H A;  4DOV A;  3CD6 Q;  1G5V A;  3PGG A;  1W2B S;  3CCL A;  3H8Z A;  2C0I A;  2RJC A;  2KT8 A;  2JMA A;  1YIT T;  4CC2 A;  1W1F A;  3ZL7 C;  1BK2 A;  3CC2 T;  2O9S A;  3DKM A;  5GMK l;  2DER A;  2BIV A;  2AKL A;  5CKF A;  2NYS A;  2CP7 A;  2RK1 A;  5DLO A;  2CP5 A;  3QWY A;  4X9C A;  3M5A A;  1AWX A;  2HL3 A;  1RAC B;  2DJQ A;  1QVG P;  4UC4 A;  1FMV A;  3BDU A;  1ZSZ C;  3ZEH A;  4QQ6 A;  1YCY A;  1VQM Q;  1OUL A;  5GAO l;  1FX7 A;  4D8D A;  4ZN3 A;  5KH6 A;  4BE1 A;  1WQW A;  3TSW A;  2R58 A;  4EMK C;  1X6G A;  1CKB A;  1YHQ Q;  2CZ1 B;  4AFQ C;  4LE9 A;  3L42 A;  1VQ4 T;  1WNL A;  3VS0 A;  1AZE A;  2YRC A;  1Q82 R;  2LX9 A;  4D6W A;  1YIJ A;  2LQN A;  1VQL Q;  3R6N A;  1JJ2 A;  4ESR A;  2DZC A;  3JCM W;  3OYJ A;  2K57 A;  2EQJ A;  1IGQ A;  4DBQ A;  1Z9Q A;  2VGN A;  2KMT A;  1I81 A;  2OI3 A;  1YJN Q;  2LJ1 A;  3GLX A;  2DVE A;  2VV5 A;  1E7O A;  1WJR A;  5A2Q E;  3JV3 A;  2LTO A;  3OYC A;  4PJO E;  4C92 F;  3GPL A;  2V1Q A;  1CSK A;  5GMK i;  2DLP A;  4RTV A;  2DL3 A;  1WA7 A;  4BAC A;  1N27 A;  1TXQ A;  2E6N A;  1C0M A;  1WZO A;  3I55 Q;  5AYF A;  4C92 E;  1YWP A;  3OYA A;  1WQ7 A;  3VUB A;  1K0X A;  5LJ3 h;  3OYY A;  2K9G A;  4DEX A;  4JRI A;  1U06 A;  5D2I A;  4BI3 A;  1Y0M A;  2KVQ G;  2L5Q A;  4RTX A;  5GAM e;  3H0I A;  1D0X A;  2LT1 A;  1WPY A;  3CC2 Q;  3GOX A;  1YJW T;  2RJE A;  3C0C A;  1SSF A;  2VC8 A;  3H9N A;  4FSX A;  5LJ5 g;  4N0A C;  2QAS A;  4JLG A;  2L89 A;  1IHW A;  4M78 F;  5KYX B;  1M90 U;  2G3R A;  2DTI A;  2VWF A;  2JOY A;  1T3S A;  3RDV A;  4JS5 A;  3JCM b;  3SHW A;  2RK2 A;  3L2W A;  2WSE E;  1NM7 A;  3LH0 A;  5GJV B;  1GTT A;  1K9M R;  4M77 D;  2DAQ A;  3I5R A;  3SWN A;  4FYX B;  2LCL A;  1Q81 R;  3SEM A;  3G71 A;  1QP3 A;  4NOY A;  5GAM g;  2L2P A;  1ABO A;  4J9C A;  1GL5 A;  4F7U B;  4MMK A;  3OYK A;  1VQL A;  5D2K A;  2EQU A;  2DD4 A;  1TU0 B;  3QPH A;  3GIB A;  2QG9 B;  2QXF A;  1MMA A;  2HL5 C;  2LRQ A;  4HCB A;  4M7A G;  3VS5 A;  1VQP T;  1NG2 A;  2J6O A;  2DTO A;  2HQH A;  2KE9 A;  2ZPG B;  1B7T A;  3FRN A;  3CQT A;  2QQB A;  1M3B A;  2MAM A;  1VQP A;  3CPF A;  3M54 A;  4GBQ A;  2L0A A;  1IRX A;  4GLK A;  3CMA T;  2I2L A;  2KGT A;  1QWF A;  1XJW B;  4ANJ A;  2DXC A;  3OYH A;  1B07 A;  1RAG B;  1VQL T;  1MV0 B;  1NPP A;  1UEB A;  2EQM A;  1VQ9 Q;  1GCQ C;  2FVU A;  1N5Z A;  3G71 Q;  3CCR Q;  1QMC A;  1YI2 Q;  3OA6 A;  1W4S A;  2AIR B;  3TQ7 P;  3MJX A;  2QQA A;  4PJL A;  3UAT A;  3HRT A;  2O4X B;  2P84 A;  2YLB A;  1VQ8 Q;  2RN8 A;  2GNC A;  3M59 A;  1N8R C;  2YT6 A;  1M8M A;  1OU9 A;  2E5Q A;  1SHG A;  2W10 A;  4HVV A;  4JJC A;  3JCM f;  2X51 A;  3GF5 A;  5C6S A;  1LJO A;  1G3Y A;  1PCX A;  1K8A U;  1W2B P;  2DJZ A;  1M8V A;  4LXC A;  4VUB A;  5GAO q;  5GAN g;  4E7K A;  3HL8 A;  4ORZ A;  3X25 B;  2LCC A;  4OP0 A;  5IT9 E;  2IPO B;  3MCA B;  3RMS A;  2KRM A;  4M77 G;  4RTT A;  2JTE A;  3U23 A;  2M0Y A;  1VQ8 T;  2LZ6 B;  2LX7 A;  3ASK A;  2PVG B;  4JJB A;  4ZN1 A;  4C5G A;  2FL7 A;  3UPU A;  2EYW A;  1VQ4 Q;  3OS2 A;  4M7D B;  4OML A;  1X75 C;  2KR3 A;  2VAS A;  1OYX A;  2BTT A;  2LQ8 A;  4BD3 A;  4JJN K;  5EG2 A;  2V8J A;  2DIL A;  1S72 T;  3L2Q A;  3F70 A;  4CC3 A;  5L8R E;  5CIU A;  3OBW A;  4ELZ C;  3EG0 A;  1LNX A;  1RL2 A;  2FO0 A;  3TSZ A;  3A5Z B;  3CCE T;  2E5K A;  2EWN A;  2BE7 D;  4KRT A;  4CRI A;  1G3S A;  2EPD A;  4MML A;  3V8K A;  1IGU A;  1PG5 B;  4C92 A;  1NZ9 A;  2O9V A;  1FWZ A;  4JRQ A;  1XQH A;  5GAN d;  2XD0 A;  1WHJ A;  3M56 A;  2QTX A;  3V7C A;  5CKD A;  2YWW A;  4C8Q G;  1K9A A;  4RG8 A;  1KC8 R;  1K76 A;  2ZPI B;  4JRK A;  1UGS B;  2LNH B;  2KDS A;  1TWB A;  2HDA A;  3CCL Q;  4A4H A;  2XIC A;  3MPU B;  3HP9 A;  1NPR A;  3TRE A;  5C0M A;  5FU7 B;  3EH2 A;  4PJO B;  4XU1 A;  1JEG A;  2JTM A;  3CXC A;  1RUW A;  2Y90 A;  2Q19 X;  1K1Z A;  1ZX6 A;  1N8R R;  1MMG A;  3AT1 B;  4OMP A;  3RBB B;  4QVD A;  1HYO A;  1M2O A;  5D2G A;  3KUF A;  1YJW Q;  3SD4 A;  5HKC A;  4M75 F;  3LWI A;  1ZA2 B;  4L5G A;  4M7A C;  1OOT A;  1KJW A;  5GAN 8;  5GAO p;  3X28 B;  2D1X A;  3RES A;  1UEC A;  1OPL A;  1M27 C;  3M0Q A;  1UB4 A;  2EIF A;  1M1F A;  3OYL A;  5A0L A;  1X69 A;  1KK7 A;  3G1J A;  2CH4 W;  4HT9 A;  1QLY A;  2ZPF B;  2H3E B;  5GAN 7;  2LCS A;  2M9U A;  2L3Q A;  1VYU A;  4EDU A;  2EGA A;  1I07 A;  1TUC A;  2NUZ A;  2CYZ B;  1NEB A;  3AHU A;  2QQ9 A;  1OQK A;  1KC8 U;  1TUG B;  3EGD A;  3EG9 B;  2ABL A;  3OYG A;  2DRK A;  1PNJ A;  4KH1 B;  4E7S A;  3PE0 A;  3E9F A;  1MUZ A;  4M77 E;  4F14 A;  1VQ7 T;  4FYV B;  1VQ6 A;  2EFI A;  1YJW A;  2JT4 A;  2KSS A;  1G3T A;  3EFO A;  3JB9 H;  4PJO F;  1VQ5 Q;  3EGU A;  2COZ A;  1EX4 A;  3VRZ A;  4DOW A;  3VS6 A;  1Q86 U;  5CQX A;  5FRM A;  4FIB A;  3REA B;  4EMG A;  1WI7 A;  3BY7 A;  3CCM Q;  1A0N B;  2E3I A;  1O9S A;  3UA7 A;  4J5Y A;  3M0P A;  4AFZ C;  3JB9 I;  4QQD A;  1X27 A;  4E7H A;  4WTO B;  2XDP A;  4C92 C;  2Q18 X;  2D0N A;  1QCO A;  5IHN A;  3DB3 A;  3RNJ A;  3PTA A;  4FYY B;  1M3C A;  3OYN A;  4X34 A;  4A4K A;  2BUD A;  4HXJ A;  3OMG A;  1VQ5 T;  2DYI A;  3CCR A;  5DM7 R;  2A36 A;  1V76 A;  4ME7 A;  1T0H A;  4XTU A;  3OW2 A;  4KUD K;  2XHC A;  6AT1 B;  3OQ5 A;  5I2M A;  3E9G A;  1YIJ T;  3CC7 T;  2LQW A;  2GFU A;  2LP5 A;  1M90 C;  3HRU A;  5I11 A;  3VS3 A;  3QWX X;  4M7A A;  1BI1 A;  5GMK j;  3IQL A;  4LUD A;  1D0Z A;  4XK8 E;  4FM4 B;  1UFF A;  4AG1 C;  1YJ9 A;  3A8O B;  4R0K A;  5FU6 B;  4C8Q B;  1X2Q A;  3EG1 A;  5CO7 A;  2E6Z A;  3MET A;  1C6V X;  1QCF A;  1M1K C;  2R5M A;  1R8O B;  1D1C A;  3CBP A;  2YRV A;  1VQ6 Q;  2RQU A;  1LCK A;  2VGM A;  3CC7 Q;  3RER A;  2YUP A;  4M75 A;  4GLM A;  3JB9 D;  2OTL Q;  1S1N A;  2OAW A;  3A98 A;  2MCN A;  2GBQ A;  2KAF A;  3C95 A;  5IXF A;  2IIM A;  2V8K A;  2O88 A;  4ZTJ A;  1MV3 A;  5KYN A;  2LNV A;  1WGS A;  5GAO m;  5L23 A;  1KQS P;  2ZPB B;  3QUI A;  1I0C A;  2ZCF B;  2YXY A;  4PJJ A;  3JCM J;  4QVC A;  5IHK A;  3VJP A;  1TSF A;  2CKK A;  2DYB A;  2PUK B;  2NLU A;  2EJF A;  4II1 A;  4C92 G;  3CME Q;  1UTI A;  3S3N A;  1SHF A;  3QJY A;  1HJD A;  4V2S A;  3WVE B;  1D09 B;  3QKJ A;  3JB9 J;  1NLP C;  1V1C A;  1VQ7 A;  4A4E A;  2KRO A;  2JM9 A;  2DD5 A;  3OBY A;  4PJO G;  4XU2 A;  2DZ9 A;  1ABQ A;  9ATC B;  1K73 R;  1QVF P;  3EG9 A;  4A63 B;  2HNI A;  3HRS A;  2BE9 B;  4F17 A;  2EYZ A;  3VKI A;  2F2W A;  2L3R A;  2MI6 A;  2HQX A;  2OTJ Q;  3C12 A;  4E6R A;  2DA9 A;  5D2H A;  2DTH A;  2MMP A;  1VIF A;  3NTH A;  1QWE A;  4C0F A;  1Y07 A;  3FB9 A;  3L1A A;  3QXE B;  2FPF A;  1TH7 A;  1WFW A;  4MZT A;  1ZSZ A;  2HEQ A;  2CRE A;  1JB0 E;  2VKN A;  1HD3 A;  2QI2 A;  4F16 A;  1G8X A;  4PKC C;  3V8J A;  2CDT A;  2ZAE A;  3V7S A;  4R56 A;  2RI2 A;  4DBF A;  4E7L A;  2CS7 A;  2FRY A;  2O2O A;  1M9S A;  3OYM A;  4EIK A;  5KYU B;  2GQI A;  1Q82 C;  2RHU A;  2Q1D X;  2CUD A;  2D0Q B;  2CP6 A;  4OMO A;  1K9M U;  1RI9 A;  3HFO A;  1H8K A;  1Q81 U;  2CP2 A;  1M1G A;  2EQK A;  3I55 A;  2EAY A;  2JXB A;  1D0Y A;  2LQK A;  3CCQ T;  4JPB W;  1YBY A;  5CKB A;  5KE3 A;  1U3O A;  2DPP B;  5CCA A;  2LT4 A;  2K7A A;  2HKQ B;  3NHN A;  2HMA A;  2XMF A;  4M78 C;  2RHI A;  1VQN Q;  1RAH B;  3A8M B;  3MEW A;  1N6A A;  2E65 A;  1H3Z A;  1JXO A;  2DBM A;  1YHQ T;  1T3L A;  2KY9 A;  4C5I A;  4M78 G;  1XTD A;  3X20 B;  1KG1 A;  2E41 A;  4HVW A;  1ZUY A;  1YN8 A;  2GTO A;  2E70 A;  2JJ9 A;  1PKT A;  2DXB A;  3EG3 A;  3CCU T;  4KGX B;  5IAY A;  2Y4Y A;  3L2Z A;  4AT1 B;  2HBP A;  2P0P A;  2GFA A;  1NJI C;  1YP5 A;  2DL8 A;  1FXX A;  4IUQ A;  3MEA A;  2JZ2 A;  2RJF A;  3G6E Q;  5KYW B;  2QA4 A;  2K6D A;  3JCM V;  4WCI A;  2VXE A;  1I8F A;  2AHJ B;  3SWN C;  4BI4 A;  1FYN A;  1GBR A;  2RHZ A;  1YWO A;  4M7A E;  4M75 C;  1IZ6 A;  2BZX A;  1KD1 R;  1VQM A;  1VA7 A;  1AEY A;  1YIJ Q;  4DBH A;  1KSW A;  2ROL A;  1MND A;  4J7F A;  3QYH B;  3T9N A;  4BE0 A;  4MDX A;  3WVD B;  3LZK A;  3LGL A;  2DNU A;  5LJ3 e;  2X3X D;  3FJP A;  3G71 T;  3VRY A;  1BIA A;  3BE3 A;  2COW A;  2O01 E;  2XDB A;  2RA2 A;  2E3H A;  4Y28 E;  2J06 A;  1OX9 A;  2J6K A;  4M75 B;  5A0G A;  3M0R A;  3THK A;  4IUV A;  5AT1 B;  3L2U A;  1PD1 A;  4FW2 A;  3UF4 A;  2DEQ A; 
#chains in the Genus database with same CATH homology
 1GTT A;  1SAW A;  4QKU A;  3LZK A;  5D2F A;  1NKQ A;  1HYO A;  2Q1A X;  5D2G A;  1WZO A;  5D2H A;  2DFU A;  3QDF A;  2EB5 A;  2EB4 A;  5D2J A;  4DBF A;  3V77 A;  1NR9 A;  2WQT A;  3R6O A;  4PFZ A;  1QCN A;  1SV6 A;  3RR6 A;  2HZY A;  2Q1D X;  2Q18 X;  5D2K A;  4MAQ A;  3BQB A;  1QCO A;  3S52 A;  2EB6 A;  2Q19 X;  2Q1C X;  1I7O A;  5D2I A;  1QQJ A;  4DBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...