4PFZA

X-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
256
structure length
250
Chain Sequence
MRLGRIASPDGVAFVSIEGDGPDAVCKEIAEHPFGNPNFTGRSWPLADVRLLAPILASKVIAVGKNYAAHVAPEDPVIFLKPNTAIIGPNVPIQLPADADPVHHEGELAIVIGRPCKDVPAARAAEFILGYTIGNDVSARDQQRKDGQWMRAKGHDTFCPLGPWIVTDLDPSDVELRTEVNGQVRQRSRTSLLLHDIGRLVEWTSAVMTLLPGDVILTGTPEGVGPIEDGDTVSITVEGIGTLTNPVVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
molecule keywords 5-carboxymethyl-2-hydroxymuconate delta-isomerase
total genus 65
structure length 250
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4pfzA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4pfzA02
3RR6A 3V77A 3QDFA 5D2FA 2EB4A 2Q1AX 3R6OA 1WZOA 5D2IA 2EB5A 4PFZA 1SAWA 5D2KA 5D2HA 2Q19X 4QKUA 1NR9A 2Q1CX 1I7OA 2WQTA 4MAQA 2EB6A 4DBHA 5D2GA 2DFUA 3LZKA 4DBFA 2Q18X 1QCNA 1SV6A 1NKQA 1QQJA 1QCOA 3S52A 2Q1DX 5D2JA 3BQBA 1GTTA 1HYOA 2HZYA
chains in the Genus database with same CATH superfamily
2KVQG 1YHQA 5IXBA 4F7UA 4Z02A 1SAWA 4UC4A 1RAIB 3HFOA 2X4WA 3T9NA 5CO7A 4DOVA 1W2BA 1E6GA 2IIMA 4C92B 4BI3A 4C92E 1VYVA 4A4EA 1TUGB 5CKFA 4KH0B 2ATCB 4PNOA 4PJJA 4J9BA 5LJ5f 4AFSC 3CCSQ 3PIPA 1NJIR 1YI2T 1YIJQ 3EGXA 1SHGA 1Y57A 4FU6A 2EB5A 4JRQA 1RADB 1VYUA 2H3JA 3LX7A 3MKDA 4LDYA 1GFCA 4M7DG 3CCQT 1M2VB 2K2VA 4LNPA 3I55T 1G3WA 4J7IA 3JV3A 2WSEE 2MWPA 1K9MC 2RN8A 3CCMT 4F7UB 1VQMQ 3M55A 1VQPA 3NMZC 2QEXA 4PLIA 2P0QA 4ZN3A 4KRTA 4OP0A 1YJ9A 5LJ5j 2RJEA 2CZ6B 1HK9A 1Q81C 1KJWA 3CBPA 2P0PA 1G5VA 2LT4A 3M0UA 1MV3A 3RKWA 3FEOA 5GANe 2HCKA 2COZA 4M7AB 4DBHA 5D2GA 2DYBA 5GJVB 2FZCB 2WACA 3CCEQ 4LE9A 4OMOA 1BI1A 2O88A 3S3OA 2DF6A 4JZ3A 1JJ2S 4CC3A 2CT3A 2FB7A 2A0FB 3C95A 5CKHA 5D2KA 4M78A 4A4FA 1WGSA 4C8QC 1S72A 1VQ6A 1YNZA 2WQTA 4RKUE 3CCQQ 2GF7A 2DAQA 1IO6A 4L59A 4AG1C 3QIIA 4ZN1A 2FL7A 3LH0A 2PUKB 4DEYA 2YRDA 5A0GA 5D6WA 1MMAA 3A5ZB 3JCMQ 3QYHB 1TG0A 4IIMA 3LWHA 3BFMA 1NJIC 2ZPFB 1WIEA 2MK5A 1UGPB 1C1AA 3JCMe 2KBTA 4JLGA 1E7OA 1NBEB 4C0FA 2ZZDA 2QXFA 3EGDB 1YITA 1QP3A 3OSSC 2R5MA 3S3MA 1VQNT 5IHKA 1UGQB 3FDRA 1X69A 4BI4A 1LVKA 2ZPIB 2F2WA 2K9GA 2K57A 1SRLA 4TVRA 2FEIA 2KYMA 2JM9A 3QZ5B 1IXDA 4BY6C 1NR9A 2E4HA 3HRUA 3A8MB 2ED0A 5KYXB 5KYWB 2D8JA 4RG2A 3G4SA 4II1A 2OAUA 9ATCB 5LJ3h 2DXTA 4XU0A 4XTWA 2Q1DX 2L3PA 1PM3A 3QJYA 2MWOA 2QGFB 2DZCA 2AKKA 1M90U 2KEAA 1H641 2D9TA 4F17A 2RK1A 1VYTA 4QKUA 3R6NA 4HVVA 3EFSA 3M57A 1Y0MA 4FSSA 1LNXA 2RHZA 3CCVA 2RQRA 3J7AF 5DLQE 1ZLMA 3G6EQ 4XTZA 1B7TA 3A1PA 5L8RE 1K73C 1JEGA 1M9SA 5FLXE 1GBRA 2DVJA 2NUTA 2SRCA 2QA4A 2HKQB 2EYYA 1X6OA 4LDWA 2HKNA 2DXUA 4FW1A 2HMAA 3OYIA 1O75A 5D2JA 3PFSA 2FRWA 3BY7A 2DPPB 4F16A 4C5HA 3EH2A 1M3BA 2AZSA 2MIOA 4HT9A 2LJ1A 2W10A 1KC8C 2FHDA 4BDYA 3ER0A 1V1CA 1NJIU 2A36A 1R8OB 4RTWA 1LPLA 2QAZA 3GIBA 2ZGWA 1IREB 5J3BA 1CKBA 4PJOE 2KRMA 4PJOB 2J6KA 5GANh 3OS2A 3PTAA 1W4SA 5CK9A 2KRSA 3IQLA 4M7DF 3L42A 2LCLA 4OMQA 2W0ZA 2DXBA 3SFMA 5KYUA 3I55Q 2RF0A 4A4HA 4RG8A 1T0HA 1VQLT 4BY6B 2C06A 3QKJA 3SWNB 5IAYA 1NLOC 1NPRA 3RKXA 3X26B 1HXDA 3EG1A 4JS5A 4CI0C 2HQEA 1KC8R 1UE9A 3VV0A 1MUZA 1WHKA 5FW9A 2YDLA 1VQMA 1M5Q1 2WSFE 1YI2A 1BKBA 1VQPQ 1JJ2A 2Q1AX 3PT9A 2L3RA 1WI7A 4BE0A 3CC2A 1AWXA 2QEXQ 3V8KA 2FPEA 5FWBA 5EC7A 1OV3A 2RI3A 2YWWA 2XI9A 1BIBA 5CKBA 4X34A 2B8AA 1YJ9Q 3U23A 4PFPA 4M75A 2LJ3A 1RLQC 4C5IA 2Q18X 2A3LA 3G6ET 3V7SA 2NUZA 3CCET 4PJOA 1QVFP 2M9UA 1VQNQ 2P4TA 4JPBW 2E1HA 4J6YA 2DBMA 4PJOC 2KNBB 3VRZA 4FL6A 3JCMg 3MPUB 2CDTA 2CT4A 4M78C 1M27C 1FXXA 1OU9A 2DA9A 2YHTA 3I9QA 3QDRB 1I4K1 4M78E 1VQKT 2DE0X 2EQUA 3A8LB 2HBWA 1KC8U 3ZEHA 3OYCA 1XNIA 1D0ZA 3A8OB 5D2FA 3HSBA 2NUPA 2QTXA 2EBPA 3A8GB 3M4GA 1Y96A 1S72Q 3NPFA 4M75F 2JTFA 2O4XA 4NOYA 5A2QE 2LTOA 4DQ2A 4Z8AA 2P4RA 2DZ9A 2PVDB 2CGHA 4J8OA 3RUXA 2R5AA 4Z89A 5GANd 1WHHA 3H0HA 4OVAA 1I07A 5HK3A 5GMKl 2EJFA 1G83A 1PSEA 1XTDA 1G2BA 5KCOA 2EGCA 2PU9B 1BBZA 3JAME 3HPWA 4OB2B 2F5KA 1GCQA 2KI7A 2CSIA 4KGVB 2DEQA 1I5OB 2FZGB 4KGZB 4Y91A 2D8HA 4M7AD 1M8MA 3PGGA 3UDCA 2A37A 5CKEA 5DY9A 1C6VX 3VUZA 3E9FA 4DOWA 2KT8A 3ME9A 5L23A 2O31A 2HL5C 1XOVA 3VS1A 3ZFJA 3VS2A 3NFCA 4PJNA 2EPDA 3OW2S 2YRCA 4C5EA 1YIJT 3RDVA 4EDUA 2RA2A 4C0DC 1K0SA 1VQ5T 4JZ4A 2DL3A 2Y4XA 2EQJA 3JCMd 2LT1A 1N6AA 4QT7A 3RMQA 1PSFA 2C0IA 5GAMg 4BDZA 3A8HB 4J9FA 1BI0A 2GNCA 2LC4A 4MZMA 3OYBA 1OOTA 2MAMA 2QQAA 4XU3A 1B34B 1JJ2P 4N4IA 1S1NA 3CCVQ 3QJ6A 5LJ3g 3G6EA 5GAOl 5FRNA 3A98A 4R56A 5C6SA 3TU4K 2VC8A 1MGQA 1Q82R 4M78G 4E47A 1IGUA 2BKDN 4M77C 3E19A 2NWMA 5GMKi 4M7AA 2K3BA 2O9VA 1KHCA 2M0OA 4XTUA 2B86A 2LDMA 2ZCFB 3MEUA 1JQQA 4F7UG 1WPYA 2RHIA 3O5ZA 4J7FA 4ESRA 2COYA 2L3QA 2V8JA 1TS9A 5GAOm 1G3SA 2EJ9A 4Y92A 4A53A 2QASA 2EJGA 2JXBA 3L2WA 3R6OA 1T3LA 3CC2T 2QTVA 4DEXA 3PIOA 2J6OA 2HQXA 2O9SA 1WFWA 4ZNXA 5KYUB 1QLYA 4HVUA 5IH2A 2RMOA 3QSUA 3MJXA 2PZ1A 3M58A 4HA8A 2DM1A 2DRKA 2VV5A 3ULRB 1UGSB 2EQMA 2BIVA 2LRQA 1Y7XA 3L2ZA 1OQKA 2RO0A 3P8DA 1H92A 3RIRA 5GANf 1FMKA 3P8BB 4NS5A 4M7AC 1NPPA 2LNVA 4LDXA 4NL2A 3UPUA 2V26A 4KH1B 1YFNA 3JB9H 3L1AA 1HJDA 2CP7A 2KYBA 2OTJQ 4JUVA 1VQOT 3HHTB 3I55A 1VQ8Q 2M0YA 1Y96B 2QDYB 2YRVA 4MDXA 1RLPC 1ZUUA 2HAXA 4FM4B 4IUUA 3REAB 4PJOG 3GP8A 2HL3A 4BB7A 1SG5A 5I2MA 2K4YA 1YI2Q 4PJOF 2OJ2A 2CP2A 3DLMA 3CC2Q 2K7AA 2X3WD 1UFFA 3TSZA 4OB3B 4Q5WA 2CP6A 2DD5A 1J3TA 2RQTA 5AT1B 3OYHA 1TTHB 2DEUA 3M4YA 4EPCA 4BE1A 4M75B 1WJRA 2RNAA 1VQNA 4HCBA 2RQVA 4X1VA 3REBB 1H3HA 5J26A 2XKOC 4EMHA 4LD9K 2BZXA 2DTHA 5AYFA 1JB0E 1WYXA 1WNLA 3NHNA 4PK4A 5LJ3j 3JB9G 5GAMd 4C8QG 1KFZA 3EG9B 3MO8A 1BCOA 1SHFA 4GY5A 4RTYA 5CKDA 3VKIA 2E5KA 2GFUA 1VQOA 2GQIA 2FZKB 3RERA 2RPNA 2JTMA 1EFNA 3V7CA 2ROLA 3OW2A 3JCMJ 5D2HA 4PFOA 8AT1B 3LLRA 3I5RA 1VQLQ 2P84A 2L5QA 4BACA 2L0AA 2MYSA 1IB8A 1YITT 1QCOA 4OMPA 5FRMA 3OYMA 2KXDA 2F2XA 3M0QA 4C8QF 1VQMT 2XU8A 1HYOA 5LJ3f 2DL7A 4IUTA 1SV6A 4P5NA 2KRNA 1FYNA 5GAMh 1K1ZA 3CPWP 1B07A 1QWEA 5KYXA 1U06A 4F04B 4C5GA 2M51A 1WLPB 1M3CA 1HD3A 2CP0A 1B34A 3RBBB 2H3EB 4C0ZA 4N0AC 1K9AA 4C0DB 3TSWA 3UATA 3OS0A 1UHCA 1PC0A 1R0CB 3EGDA 4N4HA 4PFZA 2CP3A 1RAHB 1Q82C 3CQTA 2Y4YA 1M1GA 2PUOB 4QQDA 2YUPA 2JZ2A 3VRYA 2CP5A 2P0KA 3HRSA 4J9IA 3UWNA 2VGMA 3CCUT 2MI6A 1Q7YR 3VS0A 1ZSGA 3S3NA 2VKNA 3MP8A 5D6YA 3HKSA 1RL2A 2VYTA 1WHJA 3OYJA 4IUVA 3JCMh 1QCFA 1BI2A 2IVWA 3M54A 4QVDA 4E2FB 2SEMA 5IHNA 2CREA 3CBOA 2QEXT 3CMAT 3WVEB 2Z0WA 1UJ0A 1NM7A 1Z9ZA 5A0DA 3JB9I 1BU1A 2J06A 1YJWA 4D8DA 5GMKm 1X01A 2EQKA 4OGEA 1M1KR 3QZ9B 2VXEA 1YBYA 4Y28E 1OX8A 2DBKA 5FROA 1BI3A 1WDXA 5J39A 1VA7A 5CIUA 3OY9A 3L2UA 2RI2A 4LD6A 1C0MA 2K3XA 4HKEA 3PVQA 1KK7A 1TUCA 5KCHA 5GAMf 4EMGA 1FWZA 3EH1A 2LX9A 2BTTA 7AT1B 1RAAB 3MEAA 2O2OA 1K4US 1VQPT 1U5SA 5FWCA 4YTLA 2DTIA 3OYNA 3CXCS 4EMKA 1VQ4A 1S72T 5GAOr 1VQ7A 4JRKA 2ZPBB 3VUBA 1I7OA 2KT1A 3FJ5A 3OA6A 4J6XA 4OMLA 4M77G 2KR3A 1ZSZC 3CCUA 2DJZA 2LQWA 1M1FA 2GGRA 1EIFA 2I0NA 1AZEA 3CCST 5D2IA 1W6XA 3CCRQ 1XQHA 2BUDA 4M77B 2YUQA 4M77E 3UA7A 5LJ5d 1ZX6A 3CMEA 2J05A 4B6MA 4XU2A 3LWIA 5IXFA 1OYXA 3OYGA 1RABB 4JS4A 3M56A 3DB3A 2OTJA 1VQ8A 4LXCA 2K5FA 3CPWA 1IHVA 1YJNT 2GFAA 3BE3A 1YCYA 2LJ0A 1PHTA 1ZQ1A 1ZBJA 2EYQA 4M75E 3URGA 1ABQA 3NGPA 5IT9E 2RK2A 6AT1B 5GANg 3PNWC 2XDDA 1P92A 1QKWA 2MOXA 3H41A 3OYKA 3EG9A 4CRIA 4BUGA 2E41A 2RQWA 2JJ9A 4C8QA 3EGUA 3OB9A 3G71Q 2AT1B 2X4XA 2NYSA 3QYGB 4OMFB 3GLXA 2EYZA 1RACB 2GCXA 2FRYA 1X27A 1Q95G 4XTVA 3ZBDA 4RTZA 1ZUYA 3META 2C0TA 2CKKA 2K2MA 1D1AA 3V7RA 5GAOq 1BYMA 2I2LA 1VQ9Q 3DKMA 2LQ8A 2DMOA 3VJPA 4O5VA 4CC7A 2KMTA 3GNGA 1W2BP 1AWWA 1PNJA 4JJDA 2EYXA 1X2QA 2EFIA 4ELYC 2EYWA 3E2UA 4HVWA 3C12A 1M8VA 1DJ7B 2CH4W 1VQOQ 1VQ8T 4E7SA 1D09B 3GNFB 3VYGA 3MEVA 1AEYA 2PVOB 1MMNA 4C92D 5HCKA 3L2VA 1PCXA 1X6BA 2L2PA 3HP9A 1D3BB 1N8RR 3QHSA 3CEYA 1VQLA 3C0CA 1IRXA 2EIFA 4KUDK 3FB9A 2YLBA 3OYLA 2KY9A 2OTLQ 5LJ5h 3CMAQ 3H6ZA 3QG1A 2VVKA 3QPHA 1MV0B 3EFRA 2VASA 3V8LA 4QVCA 4WF2A 3I35A 1I8FA 4GBQA 5I21A 4O6JA 1KSWA 1AD5A 2VUBA 3HL8A 3CCMQ 2GBQA 1YP5A 3E9GA 4JDSA 3Q1JA 3JCMX 4LDUA 2X3XD 4A63B 3ASKA 1YWOA 4JJBA 4J83A 2EGAA 2E10A 2DXCA 2G6FX 1Q7YU 1WXBA 1WZOA 2RJDA 4ATOA 3AT1B 2M02A 2EGEA 2EQIA 2CYZB 1MMGA 5GJWB 4N0AA 3FIFA 4C8QE 1W1FA 2K5IA 3C94A 1SSHA 4VUBA 5GAN6 1Q82U 3SD4A 4ANJA 4ZTJA 1T0JA 3SWNC 3I56A 4M7AE 2FPDA 5FU7C 1ZA2B 1AOJA 3CC7A 2A7YA 3GOXA 2E12A 1UGRB 2AZVA 2VGNA 1KQ1A 2RHUA 4HCKA 2RJFA 4J9HA 4XTYA 2M16A 3LW5E 1PG5B 4M4ZA 3LZKA 2CSQA 2MPXC 1YJWQ 2K79A 5GAMe 2KROA 1X75C 1M4ZA 1KQSP 4J9EA 5KYYA 5LJ5g 3I56T 1CKAA 4M78F 1GCQC 4HT8A 2EB4A 1UECA 5KE3A 2CUDA 3LH5A 1JXOA 4PJLA 1WX6A 3VU3C 3TQ7P 3VS4A 5GAN3 1Q86R 4M77F 1D0YA 1TSFA 2YXYA 3CCVT 4D8KA 1YN8A 2DLPA 1VOMA 1I5LA 1K73R 2AK5A 1VQ4Q 1EZZB 1VQ7Q 3GF5A 4M75C 2ABLA 5M9OA 1ARKA 1JO8A 4EMKC 3CCUQ 2KDSA 1T3SA 2O4XB 2LNHB 1VQ5Q 2PVGB 4RTTA 1NKQA 2KE9A 3D7SB 2JS2A 1BCMA 3CXCP 3CCRA 3SEMA 2AIRB 3QXEB 3OYEA 4FYWB 4RMOA 3G1JA 3CMEQ 4OMMA 1R77A 1N27A 2EW3A 1KD1C 1U3OA 2DIQA 1UTIA 3X20B 1Q7YC 1PKSA 2PQWA 2JOYA 4E7ZA 1WQ7A 1FMWA 1QQJA 4M75D 3JCMb 1OZ3A 4PJOD 2E64A 3M59A 2JNGA 4RTXA 1QVGP 4QQGA 2DERA 1NYFA 5GAN7 2AKLA 4M78D 3LGLA 2DKGA 5GAN5 4PKCC 3CCJT 4K11A 4F7UE 3NTIA 2XG8D 2E6NA 3TEEA 2DFUA 4V2SA 3PE0A 3LGFA 2J6FA 4D6WA 2HDAA 3G71A 2DVEA 2CH4A 5GAN2 1KD1R 1NEBA 2HZYA 3QDFA 4AFUC 1UJYA 4E6RA 1PD0A 3SWNA 2LCSA 1SF9A 3CCJQ 1OPKA 3RMSA 1RUWA 1GRIA 4ZGJB 3JRZA 4HCZA 3VS5A 1ZA1B 2RD1A 1NEGA 1WQWA 8ATCB 2DO3A 1VQ9A 1HSQA 3RESA 2J7IA 2LMJA 1EX4A 1VQKQ 1YJWT 2YUOA 1UDLA 2ROTA 3L2QA 2QK0A 2D0QB 2AHJB 5D7UA 1SPKA 1WHLA 2ZPEB 3FRNA 1K8AR 2QQ9A 3JB9F 4PL6A 2MCNA 1VQ6T 2LVMA 4RCBA 4NL3A 5GAOn 1Q86C 3M53A 1YJ9T 3EHQA 2V8IA 5KH6A 2F2VA 2RH2A 4XU1A 2MMPA 4ZGEB 2NLUA 3CCLT 2OTLA 3O8VA 2D1XA 2JTEA 1VQ4T 4JJNK 3CMAA 1UB4A 2BE7D 1Q81R 2F5TX 1X43A 2DYIA 3EG2A 4LUEA 5LJ5e 4AFZC 3OBWA 1UGVA 2XD0A 2OAWA 1R0BG 5GAN8 3CCMA 3M0PA 4QVZA 1G3TA 2E6ZA 3G7ZA 3OQ5A 1K9MR 5GANj 4L6V5 1U1TA 2FPFA 1TWBA 1X2KA 1QP2A 2HD0A 2LCCA 2OI3A 4QQ6A 4M77D 3DB4A 2E3IA 1WJSA 1IHWA 1B3QA 1QWFA 2VWFA 3S52A 3JCMc 1KG1A 1WA7A 1SRMA 3M9QA 1YJNQ 4J9GA 4KUIA 4IIOA 1QVGA 2GTJA 1M30A 1E6HA 2DJQA 4MDWA 1A0NB 3CC4Q 4J9DA 1JU5C 1W2BS 1X6GA 1FX7A 1NG2A 3OBYA 3I56Q 2G3RA 3G71T 1TOVA 1KQSS 3CC7Q 1M3AA 1M2OA 1F1BB 3MP6A 1KIKA 3SHWA 2E3HA 3CXCA 3OSVA 2NUPB 3CCLA 1Z9QA 1QKXA 3PMIA 3CMET 2QA4T 3JCMP 2KQWA 5ECAA 5FU6C 2DL8A 3J81E 1ABOA 1VQ9T 3DLLA 2DD4A 3V8JA 1YWPA 4FYVB 1OEBA 2KXCA 1N8RU 2YLCA 3E1SA 4KT0E 2A08A 4HXJA 1D3BA 3CC7T 4R0KA 3EG0A 5IN1A 1AWOA 1UG1A 2EVRA 3GPLA 4HCCA 3OS1A 2KK4A 2PNIA 1AVZC 2A28A 3CD6Q 5EG2A 2DL4A 2LQKA 1AT1B 2DX1A 2JVVA 3QUIA 3CPWS 3M0RA 1AHJB 4EIKA 1BK2A 4IUQA 5GAN4 3MP1A 4AFQC 4ZGDB 5LJ3e 2DRMA 3CD6T 1GXIE 2HSPA 5GAOp 1D0XA 1Y71A 1VQ5A 4BI8B 3WVDB 2DK3A 4M7DD 1K76A 4E7HA 1JBMA 2QGGA 3VS3A 2RI5A 1ZSZA 1NE8A 1OI1A 4E7LA 2HQHA 4F14A 4MZPA 2LX7A 4PLLA 5IHIA 2LP5A 2FYKA 3MCAB 3MHXA 2JW4A 4DBQA 2ZPHB 4M77A 1ZBXA 5FU7B 5DLOA 4LUDA 1TH7A 3JB9J 4R55A 1N9SA 4JLIA 4OB1B 3F70A 1YCSB 2X4JA 5CAIA 1WHMA 3KBGA 4B9WA 3JCMf 4X9CA 2KAFA 2YT6A 3M0SA 2RHYA 4RUGA 4C0GA 1WHGA 3WXMB 2QDLA 2DIGA 1FMVA 2E65A 2WSCE 3UF4A 1I81A 4QW2A 5KYYB 1I1JA 4MMLA 2D0NA 1TU0B 2CUBA 4BE2A 1ZSZB 4AMCA 3OYFA 5CR2A 3QBYA 3RR6A 3NTKA 5HK0A 5GMKe 2XMFA 3CCJA 3I5SA 4A4GA 4E7KA 3M0TA 4LN2A 5CQYA 4AT1B 1N5ZA 3H0IA 5I11A 4KBMB 1Q81U 2RHXA 1WXTA 4XQ3A 3KFVA 4WTOB 1VQKA 1G8XA 4IUPA 3RNJA 2K6DA 2QYZA 2F1LA 1JXMA 3QWYA 4L5GA 2X9HA 4ZTFA 3EG3A 2D6FA 4C92F 1VUBA 2HEQA 3V77A 1BB9A 3HTRA 4C92G 1W70A 3THKA 1QVFS 4GLKA 2CZ7B 2EB6A 1LCKA 2BZ8A 4FIBA 2X4YA 2FG0A 2C0OA 2QI2A 1OU8A 2KSSA 1QW1A 3NTHA 4M7DC 1ZUKA 3OMGA 4XAXB 1IZ6A 1M1KC 1QVGS 4E7IA 1YHQQ 2Y90A 2L8DA 1LOJA 4M78B 3FC3A 5LJ3d 2V8KA 4M7DA 2L89A 1AWJA 2XDPA 1KD1U 1RAGB 1PRMC 2EWNA 3L2RA 4A4KA 2GQVA 1GBQA 2DETA 1GTTA 1KQSA 2ECZA 2DNUA 3CCSA 1YHQT 4N4GA 3VS7A 3X28B 3UA6A 1YIJA 3HRTA 3CC4T 2JMCA 3P8HA 1PRLC 3JCMV 4BD3A 4MZTA 3CPFA 1KHIA 2XDBA 4X9DA 2OTJT 1VIFA 2HNIA 1QCNA 3N5BB 4PJMA 1RI9A 2CZ0B 2XICA 3QWXX 1WJQA 1LJOA 5KYWA 1YJNA 1SSFA 3BQBA 4FSXA 2X51A 2DILA 1MNEA 1G3YA 2XHCA 5I22A 3GBQA 3BDUA 1RAEB 2RQUA 3CC4A 1CSKA 2ZAEA 2Q19X 1NYGA 1MMDA 2O01E 3C4SA 4J6WA 2XK0A 2QQRA 1D1CA 1V76A 2GTOA 1UHFA 2CS7A 2E5QA 5D6XA 3OW2P 1RAFB 3QO3A 4OGCA 3BW1A 1U8RA 1M90C 3OMCA 3UT1A 1MNDA 4FW2A 3CCLQ 4GLMA 3MEWA 4OMNA 3VS6A 2RB6A 2QG9B 3H0FA 1IGQA 2HSEB 2EKHA 2LZ6B 3TCJA 3PMTA 3G4ST 5KE2A 4JJCA 5C0MA 1SEMA 1VIEA 3VYHB 3CCEA 4FYXB 1K73U 3ZL7C 4OF1A 1Q86U 2ESWA 2BZYA 2K3YA 5CQXA 3JCMW 1PKTA 4A54A 2JT4A 4DBRA 4M7DB 3OYAA 4M75G 4M7DE 3X24B 3CD6A 2PTKA 5KYNA 4E7JA 1GL5A 2FO0A 1VQ6Q 2V1QA 1GFDA 4M7AG 1Y07A 3CCQA 3H8ZA 1M1KU 2RJCA 5HY6A 3KUFA 5FU6B 4CC4B 1OZ2A 1H3ZA 3LYIA 1SKUB 1U1SA 1BIAA 2XIDA 1K8AC 1K0XA 4M7AF 1PWTA 3H9NA 5GMKh 5I2SA 3OYYA 3EAEA 2OTLT 2ZPGB 1JRIA 1OULA 3S6WA 4ELZC 3M5AA 1V29B 1O9SA 1N9RA 2EAYA 1OPLA 4RCCA 4MAQA 2YUNA 2JN0A 5GMKj 3X25B 1RI0A 4DA4A 4IURA 3EFOB 3JSCA 4OB0B 2X35A 4FT4A 2MF2A 4J9CA 2YSQA 5HKCA 1YITQ 1KQ2A 4WCIA 4ME7A 4J5YA 2R57A 4XK8E 3PVLA 1UUEA 1M90R 2Q1CX 1VQ7T 2K5LA 3J80E 1MHNA 2QQBA 1WXUA 2H8HA 1H8KA 4MMKA 2HBPA 1AZGB 1TXQA 3FJPA 2VXFA 3FLGA 2IPOB 1QMCA 2OX7A 2FVUA 3G4SQ 3CCRT 2F69A 4KGXB 1QVPA 2RM4A 3OS5A 5GAMj 4JRIA 5CVIA 5DM7R 3INZA 2KGTA 4JRPA 4LDVA 4C92C 2BE9B 1QVFA 5LL6S 1K9MU 3OYDA 2COWA 4EMKB 3EFOA 4KULA 1ZHIA 4FCYA 1GCPA 4C92A 2R58A 4FYYB 2CZ1B 4ORZA 3KXTA 1N8RC 1M2VA 1UEBA 1PD1A 5A0LA 3EGXB 1I0CA 2M1HA 3SB2A 2V1RA 4F7UF 4CC2A 2QA4Q 2DL5A 4RTVA 5CCAA 2IG0A 3RKYA 1NLPC 2DTOA 3AHUA 4B9XA 2JS0A 2EKOA 1D1BA 2E70A 2JM8A 4AG2C 1XJWB 2ENMA 4FT2A 2L3SA 3SDZA 3BDLA 2QQSA 1ACMB 3HFNA 3CBMA 4Z88A 1K8AU 4C8QB 1OX9A 4DBFA 4XTXA 1TUDA 3TREA 2JMAA 3JB9D 1NZ9A 4RTUA 4IKFA 4C8QD 3TVTA 2NUTB 3EHRA 2JUFA 2LQNA 2VB6A 2ED1A
chains in the Genus database with same CATH topology
3RR6A 3V77A 3QDFA 5D2FA 2EB4A 2Q1AX 3R6OA 1WZOA 5D2IA 2EB5A 4PFZA 1SAWA 5D2KA 5D2HA 2Q19X 4QKUA 1NR9A 2Q1CX 1I7OA 2WQTA 4MAQA 2EB6A 4DBHA 5D2GA 2DFUA 3LZKA 4DBFA 2Q18X 1QCNA 1SV6A 1NKQA 1QQJA 1QCOA 3S52A 2Q1DX 5D2JA 3BQBA 1GTTA 1HYOA 2HZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR6 A;  3V77 A;  3QDF A;  5D2F A;  2EB4 A;  2Q1A X;  3R6O A;  1WZO A;  5D2I A;  2EB5 A;  4PFZ A;  1SAW A;  5D2K A;  5D2H A;  2Q19 X;  4QKU A;  1NR9 A;  2Q1C X;  1I7O A;  2WQT A;  4MAQ A;  2EB6 A;  4DBH A;  5D2G A;  2DFU A;  3LZK A;  4DBF A;  2Q18 X;  1QCN A;  1SV6 A;  1NKQ A;  1QQJ A;  1QCO A;  3S52 A;  2Q1D X;  5D2J A;  3BQB A;  1GTT A;  1HYO A;  2HZY A; 
#chains in the Genus database with same CATH topology
 2KVQ G;  1YHQ A;  5IXB A;  4F7U A;  4Z02 A;  1SAW A;  4UC4 A;  1RAI B;  3HFO A;  2X4W A;  3T9N A;  5CO7 A;  4DOV A;  1W2B A;  1E6G A;  2IIM A;  4C92 B;  4BI3 A;  4C92 E;  1VYV A;  4A4E A;  1TUG B;  5CKF A;  4KH0 B;  2ATC B;  4PNO A;  4PJJ A;  4J9B A;  5LJ5 f;  4AFS C;  3CCS Q;  3PIP A;  1NJI R;  1YI2 T;  1YIJ Q;  3EGX A;  1SHG A;  1Y57 A;  4FU6 A;  2EB5 A;  4JRQ A;  1RAD B;  1VYU A;  2H3J A;  3LX7 A;  3MKD A;  4LDY A;  1GFC A;  4M7D G;  3CCQ T;  1M2V B;  2K2V A;  4LNP A;  3I55 T;  1G3W A;  4J7I A;  3JV3 A;  2WSE E;  2MWP A;  1K9M C;  2RN8 A;  3CCM T;  4F7U B;  1VQM Q;  3M55 A;  1VQP A;  3NMZ C;  2QEX A;  4PLI A;  2P0Q A;  4ZN3 A;  4KRT A;  4OP0 A;  1YJ9 A;  5LJ5 j;  2RJE A;  2CZ6 B;  1HK9 A;  1Q81 C;  1KJW A;  3CBP A;  2P0P A;  1G5V A;  2LT4 A;  3M0U A;  1MV3 A;  3RKW A;  3FEO A;  5GAN e;  2HCK A;  2COZ A;  4M7A B;  4DBH A;  5D2G A;  2DYB A;  5GJV B;  2FZC B;  2WAC A;  3CCE Q;  4LE9 A;  4OMO A;  1BI1 A;  2O88 A;  3S3O A;  2DF6 A;  4JZ3 A;  1JJ2 S;  4CC3 A;  2CT3 A;  2FB7 A;  2A0F B;  3C95 A;  5CKH A;  5D2K A;  4M78 A;  4A4F A;  1WGS A;  4C8Q C;  1S72 A;  1VQ6 A;  1YNZ A;  2WQT A;  4RKU E;  3CCQ Q;  2GF7 A;  2DAQ A;  1IO6 A;  4L59 A;  4AG1 C;  3QII A;  4ZN1 A;  2FL7 A;  3LH0 A;  2PUK B;  4DEY A;  2YRD A;  5A0G A;  5D6W A;  1MMA A;  3A5Z B;  3JCM Q;  3QYH B;  1TG0 A;  4IIM A;  3LWH A;  3BFM A;  1NJI C;  2ZPF B;  1WIE A;  2MK5 A;  1UGP B;  1C1A A;  3JCM e;  2KBT A;  4JLG A;  1E7O A;  1NBE B;  4C0F A;  2ZZD A;  2QXF A;  3EGD B;  1YIT A;  1QP3 A;  3OSS C;  2R5M A;  3S3M A;  1VQN T;  5IHK A;  1UGQ B;  3FDR A;  1X69 A;  4BI4 A;  1LVK A;  2ZPI B;  2F2W A;  2K9G A;  2K57 A;  1SRL A;  4TVR A;  2FEI A;  2KYM A;  2JM9 A;  3QZ5 B;  1IXD A;  4BY6 C;  1NR9 A;  2E4H A;  3HRU A;  3A8M B;  2ED0 A;  5KYX B;  5KYW B;  2D8J A;  4RG2 A;  3G4S A;  4II1 A;  2OAU A;  9ATC B;  5LJ3 h;  2DXT A;  4XU0 A;  4XTW A;  2Q1D X;  2L3P A;  1PM3 A;  3QJY A;  2MWO A;  2QGF B;  2DZC A;  2AKK A;  1M90 U;  2KEA A;  1H64 1;  2D9T A;  4F17 A;  2RK1 A;  1VYT A;  4QKU A;  3R6N A;  4HVV A;  3EFS A;  3M57 A;  1Y0M A;  4FSS A;  1LNX A;  2RHZ A;  3CCV A;  2RQR A;  3J7A F;  5DLQ E;  1ZLM A;  3G6E Q;  4XTZ A;  1B7T A;  3A1P A;  5L8R E;  1K73 C;  1JEG A;  1M9S A;  5FLX E;  1GBR A;  2DVJ A;  2NUT A;  2SRC A;  2QA4 A;  2HKQ B;  2EYY A;  1X6O A;  4LDW A;  2HKN A;  2DXU A;  4FW1 A;  2HMA A;  3OYI A;  1O75 A;  5D2J A;  3PFS A;  2FRW A;  3BY7 A;  2DPP B;  4F16 A;  4C5H A;  3EH2 A;  1M3B A;  2AZS A;  2MIO A;  4HT9 A;  2LJ1 A;  2W10 A;  1KC8 C;  2FHD A;  4BDY A;  3ER0 A;  1V1C A;  1NJI U;  2A36 A;  1R8O B;  4RTW A;  1LPL A;  2QAZ A;  3GIB A;  2ZGW A;  1IRE B;  5J3B A;  1CKB A;  4PJO E;  2KRM A;  4PJO B;  2J6K A;  5GAN h;  3OS2 A;  3PTA A;  1W4S A;  5CK9 A;  2KRS A;  3IQL A;  4M7D F;  3L42 A;  2LCL A;  4OMQ A;  2W0Z A;  2DXB A;  3SFM A;  5KYU A;  3I55 Q;  2RF0 A;  4A4H A;  4RG8 A;  1T0H A;  1VQL T;  4BY6 B;  2C06 A;  3QKJ A;  3SWN B;  5IAY A;  1NLO C;  1NPR A;  3RKX A;  3X26 B;  1HXD A;  3EG1 A;  4JS5 A;  4CI0 C;  2HQE A;  1KC8 R;  1UE9 A;  3VV0 A;  1MUZ A;  1WHK A;  5FW9 A;  2YDL A;  1VQM A;  1M5Q 1;  2WSF E;  1YI2 A;  1BKB A;  1VQP Q;  1JJ2 A;  2Q1A X;  3PT9 A;  2L3R A;  1WI7 A;  4BE0 A;  3CC2 A;  1AWX A;  2QEX Q;  3V8K A;  2FPE A;  5FWB A;  5EC7 A;  1OV3 A;  2RI3 A;  2YWW A;  2XI9 A;  1BIB A;  5CKB A;  4X34 A;  2B8A A;  1YJ9 Q;  3U23 A;  4PFP A;  4M75 A;  2LJ3 A;  1RLQ C;  4C5I A;  2Q18 X;  2A3L A;  3G6E T;  3V7S A;  2NUZ A;  3CCE T;  4PJO A;  1QVF P;  2M9U A;  1VQN Q;  2P4T A;  4JPB W;  2E1H A;  4J6Y A;  2DBM A;  4PJO C;  2KNB B;  3VRZ A;  4FL6 A;  3JCM g;  3MPU B;  2CDT A;  2CT4 A;  4M78 C;  1M27 C;  1FXX A;  1OU9 A;  2DA9 A;  2YHT A;  3I9Q A;  3QDR B;  1I4K 1;  4M78 E;  1VQK T;  2DE0 X;  2EQU A;  3A8L B;  2HBW A;  1KC8 U;  3ZEH A;  3OYC A;  1XNI A;  1D0Z A;  3A8O B;  5D2F A;  3HSB A;  2NUP A;  2QTX A;  2EBP A;  3A8G B;  3M4G A;  1Y96 A;  1S72 Q;  3NPF A;  4M75 F;  2JTF A;  2O4X A;  4NOY A;  5A2Q E;  2LTO A;  4DQ2 A;  4Z8A A;  2P4R A;  2DZ9 A;  2PVD B;  2CGH A;  4J8O A;  3RUX A;  2R5A A;  4Z89 A;  5GAN d;  1WHH A;  3H0H A;  4OVA A;  1I07 A;  5HK3 A;  5GMK l;  2EJF A;  1G83 A;  1PSE A;  1XTD A;  1G2B A;  5KCO A;  2EGC A;  2PU9 B;  1BBZ A;  3JAM E;  3HPW A;  4OB2 B;  2F5K A;  1GCQ A;  2KI7 A;  2CSI A;  4KGV B;  2DEQ A;  1I5O B;  2FZG B;  4KGZ B;  4Y91 A;  2D8H A;  4M7A D;  1M8M A;  3PGG A;  3UDC A;  2A37 A;  5CKE A;  5DY9 A;  1C6V X;  3VUZ A;  3E9F A;  4DOW A;  2KT8 A;  3ME9 A;  5L23 A;  2O31 A;  2HL5 C;  1XOV A;  3VS1 A;  3ZFJ A;  3VS2 A;  3NFC A;  4PJN A;  2EPD A;  3OW2 S;  2YRC A;  4C5E A;  1YIJ T;  3RDV A;  4EDU A;  2RA2 A;  4C0D C;  1K0S A;  1VQ5 T;  4JZ4 A;  2DL3 A;  2Y4X A;  2EQJ A;  3JCM d;  2LT1 A;  1N6A A;  4QT7 A;  3RMQ A;  1PSF A;  2C0I A;  5GAM g;  4BDZ A;  3A8H B;  4J9F A;  1BI0 A;  2GNC A;  2LC4 A;  4MZM A;  3OYB A;  1OOT A;  2MAM A;  2QQA A;  4XU3 A;  1B34 B;  1JJ2 P;  4N4I A;  1S1N A;  3CCV Q;  3QJ6 A;  5LJ3 g;  3G6E A;  5GAO l;  5FRN A;  3A98 A;  4R56 A;  5C6S A;  3TU4 K;  2VC8 A;  1MGQ A;  1Q82 R;  4M78 G;  4E47 A;  1IGU A;  2BKD N;  4M77 C;  3E19 A;  2NWM A;  5GMK i;  4M7A A;  2K3B A;  2O9V A;  1KHC A;  2M0O A;  4XTU A;  2B86 A;  2LDM A;  2ZCF B;  3MEU A;  1JQQ A;  4F7U G;  1WPY A;  2RHI A;  3O5Z A;  4J7F A;  4ESR A;  2COY A;  2L3Q A;  2V8J A;  1TS9 A;  5GAO m;  1G3S A;  2EJ9 A;  4Y92 A;  4A53 A;  2QAS A;  2EJG A;  2JXB A;  3L2W A;  3R6O A;  1T3L A;  3CC2 T;  2QTV A;  4DEX A;  3PIO A;  2J6O A;  2HQX A;  2O9S A;  1WFW A;  4ZNX A;  5KYU B;  1QLY A;  4HVU A;  5IH2 A;  2RMO A;  3QSU A;  3MJX A;  2PZ1 A;  3M58 A;  4HA8 A;  2DM1 A;  2DRK A;  2VV5 A;  3ULR B;  1UGS B;  2EQM A;  2BIV A;  2LRQ A;  1Y7X A;  3L2Z A;  1OQK A;  2RO0 A;  3P8D A;  1H92 A;  3RIR A;  5GAN f;  1FMK A;  3P8B B;  4NS5 A;  4M7A C;  1NPP A;  2LNV A;  4LDX A;  4NL2 A;  3UPU A;  2V26 A;  4KH1 B;  1YFN A;  3JB9 H;  3L1A A;  1HJD A;  2CP7 A;  2KYB A;  2OTJ Q;  4JUV A;  1VQO T;  3HHT B;  3I55 A;  1VQ8 Q;  2M0Y A;  1Y96 B;  2QDY B;  2YRV A;  4MDX A;  1RLP C;  1ZUU A;  2HAX A;  4FM4 B;  4IUU A;  3REA B;  4PJO G;  3GP8 A;  2HL3 A;  4BB7 A;  1SG5 A;  5I2M A;  2K4Y A;  1YI2 Q;  4PJO F;  2OJ2 A;  2CP2 A;  3DLM A;  3CC2 Q;  2K7A A;  2X3W D;  1UFF A;  3TSZ A;  4OB3 B;  4Q5W A;  2CP6 A;  2DD5 A;  1J3T A;  2RQT A;  5AT1 B;  3OYH A;  1TTH B;  2DEU A;  3M4Y A;  4EPC A;  4BE1 A;  4M75 B;  1WJR A;  2RNA A;  1VQN A;  4HCB A;  2RQV A;  4X1V A;  3REB B;  1H3H A;  5J26 A;  2XKO C;  4EMH A;  4LD9 K;  2BZX A;  2DTH A;  5AYF A;  1JB0 E;  1WYX A;  1WNL A;  3NHN A;  4PK4 A;  5LJ3 j;  3JB9 G;  5GAM d;  4C8Q G;  1KFZ A;  3EG9 B;  3MO8 A;  1BCO A;  1SHF A;  4GY5 A;  4RTY A;  5CKD A;  3VKI A;  2E5K A;  2GFU A;  1VQO A;  2GQI A;  2FZK B;  3RER A;  2RPN A;  2JTM A;  1EFN A;  3V7C A;  2ROL A;  3OW2 A;  3JCM J;  5D2H A;  4PFO A;  8AT1 B;  3LLR A;  3I5R A;  1VQL Q;  2P84 A;  2L5Q A;  4BAC A;  2L0A A;  2MYS A;  1IB8 A;  1YIT T;  1QCO A;  4OMP A;  5FRM A;  3OYM A;  2KXD A;  2F2X A;  3M0Q A;  4C8Q F;  1VQM T;  2XU8 A;  1HYO A;  5LJ3 f;  2DL7 A;  4IUT A;  1SV6 A;  4P5N A;  2KRN A;  1FYN A;  5GAM h;  1K1Z A;  3CPW P;  1B07 A;  1QWE A;  5KYX A;  1U06 A;  4F04 B;  4C5G A;  2M51 A;  1WLP B;  1M3C A;  1HD3 A;  2CP0 A;  1B34 A;  3RBB B;  2H3E B;  4C0Z A;  4N0A C;  1K9A A;  4C0D B;  3TSW A;  3UAT A;  3OS0 A;  1UHC A;  1PC0 A;  1R0C B;  3EGD A;  4N4H A;  4PFZ A;  2CP3 A;  1RAH B;  1Q82 C;  3CQT A;  2Y4Y A;  1M1G A;  2PUO B;  4QQD A;  2YUP A;  2JZ2 A;  3VRY A;  2CP5 A;  2P0K A;  3HRS A;  4J9I A;  3UWN A;  2VGM A;  3CCU T;  2MI6 A;  1Q7Y R;  3VS0 A;  1ZSG A;  3S3N A;  2VKN A;  3MP8 A;  5D6Y A;  3HKS A;  1RL2 A;  2VYT A;  1WHJ A;  3OYJ A;  4IUV A;  3JCM h;  1QCF A;  1BI2 A;  2IVW A;  3M54 A;  4QVD A;  4E2F B;  2SEM A;  5IHN A;  2CRE A;  3CBO A;  2QEX T;  3CMA T;  3WVE B;  2Z0W A;  1UJ0 A;  1NM7 A;  1Z9Z A;  5A0D A;  3JB9 I;  1BU1 A;  2J06 A;  1YJW A;  4D8D A;  5GMK m;  1X01 A;  2EQK A;  4OGE A;  1M1K R;  3QZ9 B;  2VXE A;  1YBY A;  4Y28 E;  1OX8 A;  2DBK A;  5FRO A;  1BI3 A;  1WDX A;  5J39 A;  1VA7 A;  5CIU A;  3OY9 A;  3L2U A;  2RI2 A;  4LD6 A;  1C0M A;  2K3X A;  4HKE A;  3PVQ A;  1KK7 A;  1TUC A;  5KCH A;  5GAM f;  4EMG A;  1FWZ A;  3EH1 A;  2LX9 A;  2BTT A;  7AT1 B;  1RAA B;  3MEA A;  2O2O A;  1K4U S;  1VQP T;  1U5S A;  5FWC A;  4YTL A;  2DTI A;  3OYN A;  3CXC S;  4EMK A;  1VQ4 A;  1S72 T;  5GAO r;  1VQ7 A;  4JRK A;  2ZPB B;  3VUB A;  1I7O A;  2KT1 A;  3FJ5 A;  3OA6 A;  4J6X A;  4OML A;  4M77 G;  2KR3 A;  1ZSZ C;  3CCU A;  2DJZ A;  2LQW A;  1M1F A;  2GGR A;  1EIF A;  2I0N A;  1AZE A;  3CCS T;  5D2I A;  1W6X A;  3CCR Q;  1XQH A;  2BUD A;  4M77 B;  2YUQ A;  4M77 E;  3UA7 A;  5LJ5 d;  1ZX6 A;  3CME A;  2J05 A;  4B6M A;  4XU2 A;  3LWI A;  5IXF A;  1OYX A;  3OYG A;  1RAB B;  4JS4 A;  3M56 A;  3DB3 A;  2OTJ A;  1VQ8 A;  4LXC A;  2K5F A;  3CPW A;  1IHV A;  1YJN T;  2GFA A;  3BE3 A;  1YCY A;  2LJ0 A;  1PHT A;  1ZQ1 A;  1ZBJ A;  2EYQ A;  4M75 E;  3URG A;  1ABQ A;  3NGP A;  5IT9 E;  2RK2 A;  6AT1 B;  5GAN g;  3PNW C;  2XDD A;  1P92 A;  1QKW A;  2MOX A;  3H41 A;  3OYK A;  3EG9 A;  4CRI A;  4BUG A;  2E41 A;  2RQW A;  2JJ9 A;  4C8Q A;  3EGU A;  3OB9 A;  3G71 Q;  2AT1 B;  2X4X A;  2NYS A;  3QYG B;  4OMF B;  3GLX A;  2EYZ A;  1RAC B;  2GCX A;  2FRY A;  1X27 A;  1Q95 G;  4XTV A;  3ZBD A;  4RTZ A;  1ZUY A;  3MET A;  2C0T A;  2CKK A;  2K2M A;  1D1A A;  3V7R A;  5GAO q;  1BYM A;  2I2L A;  1VQ9 Q;  3DKM A;  2LQ8 A;  2DMO A;  3VJP A;  4O5V A;  4CC7 A;  2KMT A;  3GNG A;  1W2B P;  1AWW A;  1PNJ A;  4JJD A;  2EYX A;  1X2Q A;  2EFI A;  4ELY C;  2EYW A;  3E2U A;  4HVW A;  3C12 A;  1M8V A;  1DJ7 B;  2CH4 W;  1VQO Q;  1VQ8 T;  4E7S A;  1D09 B;  3GNF B;  3VYG A;  3MEV A;  1AEY A;  2PVO B;  1MMN A;  4C92 D;  5HCK A;  3L2V A;  1PCX A;  1X6B A;  2L2P A;  3HP9 A;  1D3B B;  1N8R R;  3QHS A;  3CEY A;  1VQL A;  3C0C A;  1IRX A;  2EIF A;  4KUD K;  3FB9 A;  2YLB A;  3OYL A;  2KY9 A;  2OTL Q;  5LJ5 h;  3CMA Q;  3H6Z A;  3QG1 A;  2VVK A;  3QPH A;  1MV0 B;  3EFR A;  2VAS A;  3V8L A;  4QVC A;  4WF2 A;  3I35 A;  1I8F A;  4GBQ A;  5I21 A;  4O6J A;  1KSW A;  1AD5 A;  2VUB A;  3HL8 A;  3CCM Q;  2GBQ A;  1YP5 A;  3E9G A;  4JDS A;  3Q1J A;  3JCM X;  4LDU A;  2X3X D;  4A63 B;  3ASK A;  1YWO A;  4JJB A;  4J83 A;  2EGA A;  2E10 A;  2DXC A;  2G6F X;  1Q7Y U;  1WXB A;  1WZO A;  2RJD A;  4ATO A;  3AT1 B;  2M02 A;  2EGE A;  2EQI A;  2CYZ B;  1MMG A;  5GJW B;  4N0A A;  3FIF A;  4C8Q E;  1W1F A;  2K5I A;  3C94 A;  1SSH A;  4VUB A;  5GAN 6;  1Q82 U;  3SD4 A;  4ANJ A;  4ZTJ A;  1T0J A;  3SWN C;  3I56 A;  4M7A E;  2FPD A;  5FU7 C;  1ZA2 B;  1AOJ A;  3CC7 A;  2A7Y A;  3GOX A;  2E12 A;  1UGR B;  2AZV A;  2VGN A;  1KQ1 A;  2RHU A;  4HCK A;  2RJF A;  4J9H A;  4XTY A;  2M16 A;  3LW5 E;  1PG5 B;  4M4Z A;  3LZK A;  2CSQ A;  2MPX C;  1YJW Q;  2K79 A;  5GAM e;  2KRO A;  1X75 C;  1M4Z A;  1KQS P;  4J9E A;  5KYY A;  5LJ5 g;  3I56 T;  1CKA A;  4M78 F;  1GCQ C;  4HT8 A;  2EB4 A;  1UEC A;  5KE3 A;  2CUD A;  3LH5 A;  1JXO A;  4PJL A;  1WX6 A;  3VU3 C;  3TQ7 P;  3VS4 A;  5GAN 3;  1Q86 R;  4M77 F;  1D0Y A;  1TSF A;  2YXY A;  3CCV T;  4D8K A;  1YN8 A;  2DLP A;  1VOM A;  1I5L A;  1K73 R;  2AK5 A;  1VQ4 Q;  1EZZ B;  1VQ7 Q;  3GF5 A;  4M75 C;  2ABL A;  5M9O A;  1ARK A;  1JO8 A;  4EMK C;  3CCU Q;  2KDS A;  1T3S A;  2O4X B;  2LNH B;  1VQ5 Q;  2PVG B;  4RTT A;  1NKQ A;  2KE9 A;  3D7S B;  2JS2 A;  1BCM A;  3CXC P;  3CCR A;  3SEM A;  2AIR B;  3QXE B;  3OYE A;  4FYW B;  4RMO A;  3G1J A;  3CME Q;  4OMM A;  1R77 A;  1N27 A;  2EW3 A;  1KD1 C;  1U3O A;  2DIQ A;  1UTI A;  3X20 B;  1Q7Y C;  1PKS A;  2PQW A;  2JOY A;  4E7Z A;  1WQ7 A;  1FMW A;  1QQJ A;  4M75 D;  3JCM b;  1OZ3 A;  4PJO D;  2E64 A;  3M59 A;  2JNG A;  4RTX A;  1QVG P;  4QQG A;  2DER A;  1NYF A;  5GAN 7;  2AKL A;  4M78 D;  3LGL A;  2DKG A;  5GAN 5;  4PKC C;  3CCJ T;  4K11 A;  4F7U E;  3NTI A;  2XG8 D;  2E6N A;  3TEE A;  2DFU A;  4V2S A;  3PE0 A;  3LGF A;  2J6F A;  4D6W A;  2HDA A;  3G71 A;  2DVE A;  2CH4 A;  5GAN 2;  1KD1 R;  1NEB A;  2HZY A;  3QDF A;  4AFU C;  1UJY A;  4E6R A;  1PD0 A;  3SWN A;  2LCS A;  1SF9 A;  3CCJ Q;  1OPK A;  3RMS A;  1RUW A;  1GRI A;  4ZGJ B;  3JRZ A;  4HCZ A;  3VS5 A;  1ZA1 B;  2RD1 A;  1NEG A;  1WQW A;  8ATC B;  2DO3 A;  1VQ9 A;  1HSQ A;  3RES A;  2J7I A;  2LMJ A;  1EX4 A;  1VQK Q;  1YJW T;  2YUO A;  1UDL A;  2ROT A;  3L2Q A;  2QK0 A;  2D0Q B;  2AHJ B;  5D7U A;  1SPK A;  1WHL A;  2ZPE B;  3FRN A;  1K8A R;  2QQ9 A;  3JB9 F;  4PL6 A;  2MCN A;  1VQ6 T;  2LVM A;  4RCB A;  4NL3 A;  5GAO n;  1Q86 C;  3M53 A;  1YJ9 T;  3EHQ A;  2V8I A;  5KH6 A;  2F2V A;  2RH2 A;  4XU1 A;  2MMP A;  4ZGE B;  2NLU A;  3CCL T;  2OTL A;  3O8V A;  2D1X A;  2JTE A;  1VQ4 T;  4JJN K;  3CMA A;  1UB4 A;  2BE7 D;  1Q81 R;  2F5T X;  1X43 A;  2DYI A;  3EG2 A;  4LUE A;  5LJ5 e;  4AFZ C;  3OBW A;  1UGV A;  2XD0 A;  2OAW A;  1R0B G;  5GAN 8;  3CCM A;  3M0P A;  4QVZ A;  1G3T A;  2E6Z A;  3G7Z A;  3OQ5 A;  1K9M R;  5GAN j;  4L6V 5;  1U1T A;  2FPF A;  1TWB A;  1X2K A;  1QP2 A;  2HD0 A;  2LCC A;  2OI3 A;  4QQ6 A;  4M77 D;  3DB4 A;  2E3I A;  1WJS A;  1IHW A;  1B3Q A;  1QWF A;  2VWF A;  3S52 A;  3JCM c;  1KG1 A;  1WA7 A;  1SRM A;  3M9Q A;  1YJN Q;  4J9G A;  4KUI A;  4IIO A;  1QVG A;  2GTJ A;  1M30 A;  1E6H A;  2DJQ A;  4MDW A;  1A0N B;  3CC4 Q;  4J9D A;  1JU5 C;  1W2B S;  1X6G A;  1FX7 A;  1NG2 A;  3OBY A;  3I56 Q;  2G3R A;  3G71 T;  1TOV A;  1KQS S;  3CC7 Q;  1M3A A;  1M2O A;  1F1B B;  3MP6 A;  1KIK A;  3SHW A;  2E3H A;  3CXC A;  3OSV A;  2NUP B;  3CCL A;  1Z9Q A;  1QKX A;  3PMI A;  3CME T;  2QA4 T;  3JCM P;  2KQW A;  5ECA A;  5FU6 C;  2DL8 A;  3J81 E;  1ABO A;  1VQ9 T;  3DLL A;  2DD4 A;  3V8J A;  1YWP A;  4FYV B;  1OEB A;  2KXC A;  1N8R U;  2YLC A;  3E1S A;  4KT0 E;  2A08 A;  4HXJ A;  1D3B A;  3CC7 T;  4R0K A;  3EG0 A;  5IN1 A;  1AWO A;  1UG1 A;  2EVR A;  3GPL A;  4HCC A;  3OS1 A;  2KK4 A;  2PNI A;  1AVZ C;  2A28 A;  3CD6 Q;  5EG2 A;  2DL4 A;  2LQK A;  1AT1 B;  2DX1 A;  2JVV A;  3QUI A;  3CPW S;  3M0R A;  1AHJ B;  4EIK A;  1BK2 A;  4IUQ A;  5GAN 4;  3MP1 A;  4AFQ C;  4ZGD B;  5LJ3 e;  2DRM A;  3CD6 T;  1GXI E;  2HSP A;  5GAO p;  1D0X A;  1Y71 A;  1VQ5 A;  4BI8 B;  3WVD B;  2DK3 A;  4M7D D;  1K76 A;  4E7H A;  1JBM A;  2QGG A;  3VS3 A;  2RI5 A;  1ZSZ A;  1NE8 A;  1OI1 A;  4E7L A;  2HQH A;  4F14 A;  4MZP A;  2LX7 A;  4PLL A;  5IHI A;  2LP5 A;  2FYK A;  3MCA B;  3MHX A;  2JW4 A;  4DBQ A;  2ZPH B;  4M77 A;  1ZBX A;  5FU7 B;  5DLO A;  4LUD A;  1TH7 A;  3JB9 J;  4R55 A;  1N9S A;  4JLI A;  4OB1 B;  3F70 A;  1YCS B;  2X4J A;  5CAI A;  1WHM A;  3KBG A;  4B9W A;  3JCM f;  4X9C A;  2KAF A;  2YT6 A;  3M0S A;  2RHY A;  4RUG A;  4C0G A;  1WHG A;  3WXM B;  2QDL A;  2DIG A;  1FMV A;  2E65 A;  2WSC E;  3UF4 A;  1I81 A;  4QW2 A;  5KYY B;  1I1J A;  4MML A;  2D0N A;  1TU0 B;  2CUB A;  4BE2 A;  1ZSZ B;  4AMC A;  3OYF A;  5CR2 A;  3QBY A;  3RR6 A;  3NTK A;  5HK0 A;  5GMK e;  2XMF A;  3CCJ A;  3I5S A;  4A4G A;  4E7K A;  3M0T A;  4LN2 A;  5CQY A;  4AT1 B;  1N5Z A;  3H0I A;  5I11 A;  4KBM B;  1Q81 U;  2RHX A;  1WXT A;  4XQ3 A;  3KFV A;  4WTO B;  1VQK A;  1G8X A;  4IUP A;  3RNJ A;  2K6D A;  2QYZ A;  2F1L A;  1JXM A;  3QWY A;  4L5G A;  2X9H A;  4ZTF A;  3EG3 A;  2D6F A;  4C92 F;  1VUB A;  2HEQ A;  3V77 A;  1BB9 A;  3HTR A;  4C92 G;  1W70 A;  3THK A;  1QVF S;  4GLK A;  2CZ7 B;  2EB6 A;  1LCK A;  2BZ8 A;  4FIB A;  2X4Y A;  2FG0 A;  2C0O A;  2QI2 A;  1OU8 A;  2KSS A;  1QW1 A;  3NTH A;  4M7D C;  1ZUK A;  3OMG A;  4XAX B;  1IZ6 A;  1M1K C;  1QVG S;  4E7I A;  1YHQ Q;  2Y90 A;  2L8D A;  1LOJ A;  4M78 B;  3FC3 A;  5LJ3 d;  2V8K A;  4M7D A;  2L89 A;  1AWJ A;  2XDP A;  1KD1 U;  1RAG B;  1PRM C;  2EWN A;  3L2R A;  4A4K A;  2GQV A;  1GBQ A;  2DET A;  1GTT A;  1KQS A;  2ECZ A;  2DNU A;  3CCS A;  1YHQ T;  4N4G A;  3VS7 A;  3X28 B;  3UA6 A;  1YIJ A;  3HRT A;  3CC4 T;  2JMC A;  3P8H A;  1PRL C;  3JCM V;  4BD3 A;  4MZT A;  3CPF A;  1KHI A;  2XDB A;  4X9D A;  2OTJ T;  1VIF A;  2HNI A;  1QCN A;  3N5B B;  4PJM A;  1RI9 A;  2CZ0 B;  2XIC A;  3QWX X;  1WJQ A;  1LJO A;  5KYW A;  1YJN A;  1SSF A;  3BQB A;  4FSX A;  2X51 A;  2DIL A;  1MNE A;  1G3Y A;  2XHC A;  5I22 A;  3GBQ A;  3BDU A;  1RAE B;  2RQU A;  3CC4 A;  1CSK A;  2ZAE A;  2Q19 X;  1NYG A;  1MMD A;  2O01 E;  3C4S A;  4J6W A;  2XK0 A;  2QQR A;  1D1C A;  1V76 A;  2GTO A;  1UHF A;  2CS7 A;  2E5Q A;  5D6X A;  3OW2 P;  1RAF B;  3QO3 A;  4OGC A;  3BW1 A;  1U8R A;  1M90 C;  3OMC A;  3UT1 A;  1MND A;  4FW2 A;  3CCL Q;  4GLM A;  3MEW A;  4OMN A;  3VS6 A;  2RB6 A;  2QG9 B;  3H0F A;  1IGQ A;  2HSE B;  2EKH A;  2LZ6 B;  3TCJ A;  3PMT A;  3G4S T;  5KE2 A;  4JJC A;  5C0M A;  1SEM A;  1VIE A;  3VYH B;  3CCE A;  4FYX B;  1K73 U;  3ZL7 C;  4OF1 A;  1Q86 U;  2ESW A;  2BZY A;  2K3Y A;  5CQX A;  3JCM W;  1PKT A;  4A54 A;  2JT4 A;  4DBR A;  4M7D B;  3OYA A;  4M75 G;  4M7D E;  3X24 B;  3CD6 A;  2PTK A;  5KYN A;  4E7J A;  1GL5 A;  2FO0 A;  1VQ6 Q;  2V1Q A;  1GFD A;  4M7A G;  1Y07 A;  3CCQ A;  3H8Z A;  1M1K U;  2RJC A;  5HY6 A;  3KUF A;  5FU6 B;  4CC4 B;  1OZ2 A;  1H3Z A;  3LYI A;  1SKU B;  1U1S A;  1BIA A;  2XID A;  1K8A C;  1K0X A;  4M7A F;  1PWT A;  3H9N A;  5GMK h;  5I2S A;  3OYY A;  3EAE A;  2OTL T;  2ZPG B;  1JRI A;  1OUL A;  3S6W A;  4ELZ C;  3M5A A;  1V29 B;  1O9S A;  1N9R A;  2EAY A;  1OPL A;  4RCC A;  4MAQ A;  2YUN A;  2JN0 A;  5GMK j;  3X25 B;  1RI0 A;  4DA4 A;  4IUR A;  3EFO B;  3JSC A;  4OB0 B;  2X35 A;  4FT4 A;  2MF2 A;  4J9C A;  2YSQ A;  5HKC A;  1YIT Q;  1KQ2 A;  4WCI A;  4ME7 A;  4J5Y A;  2R57 A;  4XK8 E;  3PVL A;  1UUE A;  1M90 R;  2Q1C X;  1VQ7 T;  2K5L A;  3J80 E;  1MHN A;  2QQB A;  1WXU A;  2H8H A;  1H8K A;  4MMK A;  2HBP A;  1AZG B;  1TXQ A;  3FJP A;  2VXF A;  3FLG A;  2IPO B;  1QMC A;  2OX7 A;  2FVU A;  3G4S Q;  3CCR T;  2F69 A;  4KGX B;  1QVP A;  2RM4 A;  3OS5 A;  5GAM j;  4JRI A;  5CVI A;  5DM7 R;  3INZ A;  2KGT A;  4JRP A;  4LDV A;  4C92 C;  2BE9 B;  1QVF A;  5LL6 S;  1K9M U;  3OYD A;  2COW A;  4EMK B;  3EFO A;  4KUL A;  1ZHI A;  4FCY A;  1GCP A;  4C92 A;  2R58 A;  4FYY B;  2CZ1 B;  4ORZ A;  3KXT A;  1N8R C;  1M2V A;  1UEB A;  1PD1 A;  5A0L A;  3EGX B;  1I0C A;  2M1H A;  3SB2 A;  2V1R A;  4F7U F;  4CC2 A;  2QA4 Q;  2DL5 A;  4RTV A;  5CCA A;  2IG0 A;  3RKY A;  1NLP C;  2DTO A;  3AHU A;  4B9X A;  2JS0 A;  2EKO A;  1D1B A;  2E70 A;  2JM8 A;  4AG2 C;  1XJW B;  2ENM A;  4FT2 A;  2L3S A;  3SDZ A;  3BDL A;  2QQS A;  1ACM B;  3HFN A;  3CBM A;  4Z88 A;  1K8A U;  4C8Q B;  1OX9 A;  4DBF A;  4XTX A;  1TUD A;  3TRE A;  2JMA A;  3JB9 D;  1NZ9 A;  4RTU A;  4IKF A;  4C8Q D;  3TVT A;  2NUT B;  3EHR A;  2JUF A;  2LQN A;  2VB6 A;  2ED1 A; 
#chains in the Genus database with same CATH homology
 3RR6 A;  3V77 A;  3QDF A;  5D2F A;  2EB4 A;  2Q1A X;  3R6O A;  1WZO A;  5D2I A;  2EB5 A;  4PFZ A;  1SAW A;  5D2K A;  5D2H A;  2Q19 X;  4QKU A;  1NR9 A;  2Q1C X;  1I7O A;  2WQT A;  4MAQ A;  2EB6 A;  4DBH A;  5D2G A;  2DFU A;  3LZK A;  4DBF A;  2Q18 X;  1QCN A;  1SV6 A;  1NKQ A;  1QQJ A;  1QCO A;  3S52 A;  2Q1D X;  5D2J A;  3BQB A;  1GTT A;  1HYO A;  2HZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...