The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
180
|
structure length |
161
|
Chain Sequence |
QPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Novel Biochemical and Structural Insights into the Interaction of Myristoylated Cargo with Unc119 Protein and Their Release by Arl2/3.
pubmed doi rcsb |
| molecule keywords |
Protein unc-119 homolog A
|
| molecule tags |
Lipid binding protein
|
| source organism |
Homo sapiens
|
| total genus |
42
|
| structure length |
161
|
| sequence length |
180
|
| chains with identical sequence |
G
|
| ec nomenclature | |
| pdb deposition date | 2016-06-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05351 | GMP_PDE_delta | GMP-PDE, delta subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Coagulation Factor XIII; Chain A, domain 1 | GMP phosphodiesterase, delta subunit |
#chains in the Genus database with same CATH superfamily 5E8F A; 1KSH B; 3T5G B; 4GOK C; 4JV6 B; 5L7K A; 4GOJ C; 4JVF B; 5TB5 B; 5F2U A; 4JV8 B; 4JHP B; 4JVB B; 1KSG B; 5TAR B; 3T5I A; 3GQQ A; 3RBQ A; 5E80 A; 1KSJ B; #chains in the Genus database with same CATH topology 2BEM A; 4ALQ A; 4B5Q A; 2YET A; 2JHS A; 5DQE A; 1FT0 A; 1QVY A; 5IJU A; 1DS6 B; 4EIR A; 5EMW A; 2JI0 A; 2JHX A; 2JHT A; 4F38 B; 1FST A; 4JVB B; 1KSG B; 2JHU A; 5ACJ A; 2JHV A; 3RBQ A; 1KSJ B; 4OY7 A; 1KMT A; 1GDF A; 2BXW A; 4GOK C; 4EIS B; 5HGU A; 5L7K A; 4GOJ C; 2R5O A; 5AA7 A; 4QI8 A; 2YOX A; 4JV8 B; 2YOY A; 4D7U A; 4ALC A; 5ACG A; 3KYS A; 5EMV A; 5HNP A; 2LHS A; 2BEN A; 4ALS A; 1KSH B; 5DQ8 A; 3T5G B; 2JHW A; 4JVF B; 1FSO A; 3UAM A; 5FJQ A; 5F2U A; 4ALT A; 3L15 A; 4OY8 A; 4GBO A; 4JHP B; 3T5I A; 4OY6 A; 1AJW A; 5HNO A; 1DOA B; 5E80 A; 3JUA A; 1FT3 A; 2JHZ A; 4LN0 A; 2XWX A; 4MAH A; 5FOH A; 4ALR A; 5E8F A; 1RHO A; 1HH4 D; 4JV6 B; 5ACI A; 3EII A; 5ACF A; 5TB5 B; 4RE1 A; 4ALE A; 4EIS A; 5FTZ A; 3ZUD A; 3EJA A; 4MAI A; 4A02 A; 5ACH A; 5TAR B; 4D7V A; 2YOW A; 4FMR A; 3GQQ A; 2JHY A; 2VTC A; #chains in the Genus database with same CATH homology 5E8F A; 1KSH B; 3T5G B; 4GOK C; 4JV6 B; 5L7K A; 4GOJ C; 4JVF B; 5TB5 B; 5F2U A; 4JV8 B; 4JHP B; 4JVB B; 1KSG B; 5TAR B; 3T5I A; 3GQQ A; 3RBQ A; 5E80 A; 1KSJ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
