5BN6E

Crystal structure of frutalin from artocarpus incisa in complex with galactose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITGFTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Frutalin from Artocarpus incisa in complex with galactose
rcsb
molecule keywords Jacalin
molecule tags Sugar binding protein
total genus 28
structure length 133
sequence length 133
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5bn6E00
2BMYA 1ZGRA 1C3MA 3R52A 1PXDA 1TOQA 1WS5C 3R50A 1UH1A 5BN6E 4R6PA 3LL2A 1WS4A 3VZEA 4WOGA 2JZ4A 3LLYA 3LLZA 1M26A 2GTYA 2GUXA 5J4TA 1UGWA 4R6QA 4MQ0A 3MITA 1WS4C 5J50A 2GUEA 1OUWA 4AKDA 3WOBA 3P8SA 5AV7A 1UGWC 1X1VA 1KUJA 2BMZA 3MIUA 2NU5A 1KU8A 5J51A 5JM1A 3VY7A 1XXRA 2HYQA 1J4SA 3LL1A 4DDNA 3AQGA 1XEZA 1UH0A 1J4UA 2BN0A 4AKCA 3WOCA 1VBPA 1C3NA 1VBOA 3APAA 2GUCA 1ZGSA 1UGXA 2HYRA 4R6NA 1UGYA 4GX7A 4PITA 4PIFA 5EXGA 4AK4A 3MIVA 1J4TA 1XXQA 3VY6A 3LM1A 4PIKA 1C3KA 1JOTA 1JACA 1UGYC 4AKBA 5J4XA 4R6OA 4PIUA 3O44A 3R51A 3VZFA 3LL0A 1WS5A 1TP8A 3VZGA 2GUDA 2NUOA 3LKYA 4R6RA
chains in the Genus database with same CATH superfamily
2BMYA 1ZGRA 1C3MA 3R52A 1PXDA 1TOQA 1WS5C 3R50A 1UH1A 5BN6E 4R6PA 4QX1A 1DLCA 3LL2A 4QX2A 1WS4A 3VZEA 4WOGA 2JZ4A 3LLYA 3LLZA 1M26A 2GTYA 4MOAA 4W8JA 2GUXA 5J4TA 1UGWA 4R6QA 4MQ0A 3MITA 1WS4C 1CIYA 3TOWA 5J50A 2GUEA 1OUWA 4AKDA 3WOBA 3P8SA 5AV7A 1UGWC 1X1VA 1KUJA 4ARYA 2BMZA 4ARXA 3MIUA 2NU5A 1KU8A 5J51A 5JM1A 3VY7A 1XXRA 2HYQA 1JI6A 1J4SA 3LL1A 4DDNA 2C9KA 1XEZA 3AQGA 1VMOA 1UH0A 1J4UA 2BN0A 4AKCA 4D8MA 3WOCA 1VBPA 1C3NA 1VBOA 3APAA 1W99A 2GUCA 4QX3A 1ZGSA 1UGXA 2HYRA 4R6NA 1UGYA 4GX7A 4PITA 4PIFA 5EXGA 4AK4A 3MIVA 2QP2A 1J4TA 1XXQA 3VY6A 1I5PA 3LM1A 4PIKA 1C3KA 1JOTA 1JACA 1UGYC 4AKBA 5J4XA 3EB7A 4R6OA 4PIUA 3O44A 3R51A 3VZFA 4QX0A 3LL0A 1WS5A 1TP8A 3VZGA 2GUDA 2NUOA 3LKYA 4R6RA
chains in the Genus database with same CATH topology
2BMYA 1ZGRA 1C3MA 3R52A 1PXDA 1TOQA 1WS5C 3R50A 1UH1A 5BN6E 4R6PA 3LL2A 1WS4A 3VZEA 4WOGA 2JZ4A 3LLYA 3LLZA 1M26A 2GTYA 2GUXA 5J4TA 1UGWA 4R6QA 4MQ0A 3MITA 1WS4C 5J50A 2GUEA 1OUWA 4AKDA 3WOBA 3P8SA 5AV7A 1UGWC 1X1VA 1KUJA 2BMZA 3MIUA 2NU5A 1KU8A 5J51A 5JM1A 3VY7A 1XXRA 2HYQA 1J4SA 3LL1A 4DDNA 3AQGA 1XEZA 1UH0A 1J4UA 2BN0A 4AKCA 3WOCA 1VBPA 1C3NA 1VBOA 3APAA 2GUCA 1ZGSA 1UGXA 2HYRA 4R6NA 1UGYA 4GX7A 4PITA 4PIFA 5EXGA 4AK4A 3MIVA 1J4TA 1XXQA 3VY6A 3LM1A 4PIKA 1C3KA 1JOTA 1JACA 1UGYC 4AKBA 5J4XA 4R6OA 4PIUA 3O44A 3R51A 3VZFA 3LL0A 1WS5A 1TP8A 3VZGA 2GUDA 2NUOA 3LKYA 4R6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMY A;  1ZGR A;  1C3M A;  3R52 A;  1PXD A;  1TOQ A;  1WS5 C;  3R50 A;  1UH1 A;  5BN6 E;  4R6P A;  3LL2 A;  1WS4 A;  3VZE A;  4WOG A;  2JZ4 A;  3LLY A;  3LLZ A;  1M26 A;  2GTY A;  2GUX A;  5J4T A;  1UGW A;  4R6Q A;  4MQ0 A;  3MIT A;  1WS4 C;  5J50 A;  2GUE A;  1OUW A;  4AKD A;  3WOB A;  3P8S A;  5AV7 A;  1UGW C;  1X1V A;  1KUJ A;  2BMZ A;  3MIU A;  2NU5 A;  1KU8 A;  5J51 A;  5JM1 A;  3VY7 A;  1XXR A;  2HYQ A;  1J4S A;  3LL1 A;  4DDN A;  3AQG A;  1XEZ A;  1UH0 A;  1J4U A;  2BN0 A;  4AKC A;  3WOC A;  1VBP A;  1C3N A;  1VBO A;  3APA A;  2GUC A;  1ZGS A;  1UGX A;  2HYR A;  4R6N A;  1UGY A;  4GX7 A;  4PIT A;  4PIF A;  5EXG A;  4AK4 A;  3MIV A;  1J4T A;  1XXQ A;  3VY6 A;  3LM1 A;  4PIK A;  1C3K A;  1JOT A;  1JAC A;  1UGY C;  4AKB A;  5J4X A;  4R6O A;  4PIU A;  3O44 A;  3R51 A;  3VZF A;  3LL0 A;  1WS5 A;  1TP8 A;  3VZG A;  2GUD A;  2NUO A;  3LKY A;  4R6R A; 
#chains in the Genus database with same CATH topology
 2BMY A;  1ZGR A;  1C3M A;  3R52 A;  1PXD A;  1TOQ A;  1WS5 C;  3R50 A;  1UH1 A;  5BN6 E;  4R6P A;  4QX1 A;  1DLC A;  3LL2 A;  4QX2 A;  1WS4 A;  3VZE A;  4WOG A;  2JZ4 A;  3LLY A;  3LLZ A;  1M26 A;  2GTY A;  4MOA A;  4W8J A;  2GUX A;  5J4T A;  1UGW A;  4R6Q A;  4MQ0 A;  3MIT A;  1WS4 C;  1CIY A;  3TOW A;  5J50 A;  2GUE A;  1OUW A;  4AKD A;  3WOB A;  3P8S A;  5AV7 A;  1UGW C;  1X1V A;  1KUJ A;  4ARY A;  2BMZ A;  4ARX A;  3MIU A;  2NU5 A;  1KU8 A;  5J51 A;  5JM1 A;  3VY7 A;  1XXR A;  2HYQ A;  1JI6 A;  1J4S A;  3LL1 A;  4DDN A;  2C9K A;  1XEZ A;  3AQG A;  1VMO A;  1UH0 A;  1J4U A;  2BN0 A;  4AKC A;  4D8M A;  3WOC A;  1VBP A;  1C3N A;  1VBO A;  3APA A;  1W99 A;  2GUC A;  4QX3 A;  1ZGS A;  1UGX A;  2HYR A;  4R6N A;  1UGY A;  4GX7 A;  4PIT A;  4PIF A;  5EXG A;  4AK4 A;  3MIV A;  2QP2 A;  1J4T A;  1XXQ A;  3VY6 A;  1I5P A;  3LM1 A;  4PIK A;  1C3K A;  1JOT A;  1JAC A;  1UGY C;  4AKB A;  5J4X A;  3EB7 A;  4R6O A;  4PIU A;  3O44 A;  3R51 A;  3VZF A;  4QX0 A;  3LL0 A;  1WS5 A;  1TP8 A;  3VZG A;  2GUD A;  2NUO A;  3LKY A;  4R6R A; 
#chains in the Genus database with same CATH homology
 2BMY A;  1ZGR A;  1C3M A;  3R52 A;  1PXD A;  1TOQ A;  1WS5 C;  3R50 A;  1UH1 A;  5BN6 E;  4R6P A;  3LL2 A;  1WS4 A;  3VZE A;  4WOG A;  2JZ4 A;  3LLY A;  3LLZ A;  1M26 A;  2GTY A;  2GUX A;  5J4T A;  1UGW A;  4R6Q A;  4MQ0 A;  3MIT A;  1WS4 C;  5J50 A;  2GUE A;  1OUW A;  4AKD A;  3WOB A;  3P8S A;  5AV7 A;  1UGW C;  1X1V A;  1KUJ A;  2BMZ A;  3MIU A;  2NU5 A;  1KU8 A;  5J51 A;  5JM1 A;  3VY7 A;  1XXR A;  2HYQ A;  1J4S A;  3LL1 A;  4DDN A;  3AQG A;  1XEZ A;  1UH0 A;  1J4U A;  2BN0 A;  4AKC A;  3WOC A;  1VBP A;  1C3N A;  1VBO A;  3APA A;  2GUC A;  1ZGS A;  1UGX A;  2HYR A;  4R6N A;  1UGY A;  4GX7 A;  4PIT A;  4PIF A;  5EXG A;  4AK4 A;  3MIV A;  1J4T A;  1XXQ A;  3VY6 A;  3LM1 A;  4PIK A;  1C3K A;  1JOT A;  1JAC A;  1UGY C;  4AKB A;  5J4X A;  4R6O A;  4PIU A;  3O44 A;  3R51 A;  3VZF A;  3LL0 A;  1WS5 A;  1TP8 A;  3VZG A;  2GUD A;  2NUO A;  3LKY A;  4R6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...