5J4XA

Structure of tetrameric jacalin complexed with gal beta-(1,3) gal-beta-ome
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distortion of the ligand molecule as a strategy for modulating binding affinity: Further studies involving complexes of jacalin with beta-substituted disaccharides.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 28
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5j4xA00
1VBPA 4AK4A 2GUEA 4R6QA 1UH0A 4R6OA 2BN0A 1WS5C 1C3MA 4R6PA 2JZ4A 2GUXA 2BMZA 2HYQA 2BMYA 1UGWC 3P8SA 3O44A 2NUOA 3AQGA 3WOBA 1TOQA 1M26A 1OUWA 3LKYA 3VZGA 3LM1A 1UGWA 3VZFA 3R52A 1PXDA 4AKDA 5J51A 1WS4C 3LLZA 4MQ0A 2GUDA 3WOCA 1VBOA 4WOGA 5J50A 1UGYC 3MIVA 5JM1A 1J4SA 1KU8A 3LL0A 1TP8A 4R6RA 1JOTA 1WS4A 1UGXA 3MIUA 5J4TA 4PIFA 1J4UA 1X1VA 3VY6A 4R6NA 1UGYA 3VZEA 1JACA 1XEZA 4PIUA 1C3NA 4AKBA 3LL2A 3R51A 2GTYA 2GUCA 3R50A 1ZGRA 1XXQA 5BN6E 4GX7A 3LL1A 2HYRA 1J4TA 1UH1A 1C3KA 5AV7A 2NU5A 1XXRA 1KUJA 5EXGA 5J4XA 4PIKA 1WS5A 1ZGSA 3MITA 4DDNA 4AKCA 3VY7A 4PITA 3LLYA 3APAA
chains in the Genus database with same CATH superfamily
1VBPA 4AK4A 2GUEA 4R6QA 1UH0A 4R6OA 2BN0A 1WS5C 3TOWA 4QX3A 1C3MA 1JI6A 4QX0A 4R6PA 4W8JA 2JZ4A 2GUXA 2BMZA 2HYQA 2BMYA 1UGWC 3P8SA 3O44A 2NUOA 1CIYA 3AQGA 3WOBA 1TOQA 1M26A 1OUWA 3LKYA 3VZGA 1VMOA 3LM1A 1UGWA 3VZFA 3R52A 1PXDA 4AKDA 4D8MA 5J51A 1WS4C 4ARYA 3LLZA 4MQ0A 4MOAA 2GUDA 3WOCA 1VBOA 4WOGA 5J50A 1UGYC 3MIVA 5JM1A 1J4SA 1W99A 1KU8A 3LL0A 1TP8A 4R6RA 1JOTA 1WS4A 1I5PA 1UGXA 3MIUA 5J4TA 4PIFA 1J4UA 1X1VA 3VY6A 4R6NA 1UGYA 3VZEA 1JACA 1XEZA 4PIUA 1C3NA 4QX1A 2QP2A 4AKBA 4QX2A 3LL2A 3R51A 2GTYA 2GUCA 3R50A 1ZGRA 1XXQA 5BN6E 3EB7A 4GX7A 3LL1A 2HYRA 2C9KA 1J4TA 1UH1A 1C3KA 5AV7A 2NU5A 1XXRA 1KUJA 5EXGA 5J4XA 4PIKA 1WS5A 1ZGSA 3MITA 4ARXA 4DDNA 1DLCA 4AKCA 3VY7A 4PITA 3LLYA 3APAA
chains in the Genus database with same CATH topology
1VBPA 4AK4A 2GUEA 4R6QA 1UH0A 4R6OA 2BN0A 1WS5C 1C3MA 4R6PA 2JZ4A 2GUXA 2BMZA 2HYQA 2BMYA 1UGWC 3P8SA 3O44A 2NUOA 3AQGA 3WOBA 1TOQA 1M26A 1OUWA 3LKYA 3VZGA 3LM1A 1UGWA 3VZFA 3R52A 1PXDA 4AKDA 5J51A 1WS4C 3LLZA 4MQ0A 2GUDA 3WOCA 1VBOA 4WOGA 5J50A 1UGYC 3MIVA 5JM1A 1J4SA 1KU8A 3LL0A 1TP8A 4R6RA 1JOTA 1WS4A 1UGXA 3MIUA 5J4TA 4PIFA 1J4UA 1X1VA 3VY6A 4R6NA 1UGYA 3VZEA 1JACA 1XEZA 4PIUA 1C3NA 4AKBA 3LL2A 3R51A 2GTYA 2GUCA 3R50A 1ZGRA 1XXQA 5BN6E 4GX7A 3LL1A 2HYRA 1J4TA 1UH1A 1C3KA 5AV7A 2NU5A 1XXRA 1KUJA 5EXGA 5J4XA 4PIKA 1WS5A 1ZGSA 3MITA 4DDNA 4AKCA 3VY7A 4PITA 3LLYA 3APAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBP A;  4AK4 A;  2GUE A;  4R6Q A;  1UH0 A;  4R6O A;  2BN0 A;  1WS5 C;  1C3M A;  4R6P A;  2JZ4 A;  2GUX A;  2BMZ A;  2HYQ A;  2BMY A;  1UGW C;  3P8S A;  3O44 A;  2NUO A;  3AQG A;  3WOB A;  1TOQ A;  1M26 A;  1OUW A;  3LKY A;  3VZG A;  3LM1 A;  1UGW A;  3VZF A;  3R52 A;  1PXD A;  4AKD A;  5J51 A;  1WS4 C;  3LLZ A;  4MQ0 A;  2GUD A;  3WOC A;  1VBO A;  4WOG A;  5J50 A;  1UGY C;  3MIV A;  5JM1 A;  1J4S A;  1KU8 A;  3LL0 A;  1TP8 A;  4R6R A;  1JOT A;  1WS4 A;  1UGX A;  3MIU A;  5J4T A;  4PIF A;  1J4U A;  1X1V A;  3VY6 A;  4R6N A;  1UGY A;  3VZE A;  1JAC A;  1XEZ A;  4PIU A;  1C3N A;  4AKB A;  3LL2 A;  3R51 A;  2GTY A;  2GUC A;  3R50 A;  1ZGR A;  1XXQ A;  5BN6 E;  4GX7 A;  3LL1 A;  2HYR A;  1J4T A;  1UH1 A;  1C3K A;  5AV7 A;  2NU5 A;  1XXR A;  1KUJ A;  5EXG A;  5J4X A;  4PIK A;  1WS5 A;  1ZGS A;  3MIT A;  4DDN A;  4AKC A;  3VY7 A;  4PIT A;  3LLY A;  3APA A; 
#chains in the Genus database with same CATH topology
 1VBP A;  4AK4 A;  2GUE A;  4R6Q A;  1UH0 A;  4R6O A;  2BN0 A;  1WS5 C;  3TOW A;  4QX3 A;  1C3M A;  1JI6 A;  4QX0 A;  4R6P A;  4W8J A;  2JZ4 A;  2GUX A;  2BMZ A;  2HYQ A;  2BMY A;  1UGW C;  3P8S A;  3O44 A;  2NUO A;  1CIY A;  3AQG A;  3WOB A;  1TOQ A;  1M26 A;  1OUW A;  3LKY A;  3VZG A;  1VMO A;  3LM1 A;  1UGW A;  3VZF A;  3R52 A;  1PXD A;  4AKD A;  4D8M A;  5J51 A;  1WS4 C;  4ARY A;  3LLZ A;  4MQ0 A;  4MOA A;  2GUD A;  3WOC A;  1VBO A;  4WOG A;  5J50 A;  1UGY C;  3MIV A;  5JM1 A;  1J4S A;  1W99 A;  1KU8 A;  3LL0 A;  1TP8 A;  4R6R A;  1JOT A;  1WS4 A;  1I5P A;  1UGX A;  3MIU A;  5J4T A;  4PIF A;  1J4U A;  1X1V A;  3VY6 A;  4R6N A;  1UGY A;  3VZE A;  1JAC A;  1XEZ A;  4PIU A;  1C3N A;  4QX1 A;  2QP2 A;  4AKB A;  4QX2 A;  3LL2 A;  3R51 A;  2GTY A;  2GUC A;  3R50 A;  1ZGR A;  1XXQ A;  5BN6 E;  3EB7 A;  4GX7 A;  3LL1 A;  2HYR A;  2C9K A;  1J4T A;  1UH1 A;  1C3K A;  5AV7 A;  2NU5 A;  1XXR A;  1KUJ A;  5EXG A;  5J4X A;  4PIK A;  1WS5 A;  1ZGS A;  3MIT A;  4ARX A;  4DDN A;  1DLC A;  4AKC A;  3VY7 A;  4PIT A;  3LLY A;  3APA A; 
#chains in the Genus database with same CATH homology
 1VBP A;  4AK4 A;  2GUE A;  4R6Q A;  1UH0 A;  4R6O A;  2BN0 A;  1WS5 C;  1C3M A;  4R6P A;  2JZ4 A;  2GUX A;  2BMZ A;  2HYQ A;  2BMY A;  1UGW C;  3P8S A;  3O44 A;  2NUO A;  3AQG A;  3WOB A;  1TOQ A;  1M26 A;  1OUW A;  3LKY A;  3VZG A;  3LM1 A;  1UGW A;  3VZF A;  3R52 A;  1PXD A;  4AKD A;  5J51 A;  1WS4 C;  3LLZ A;  4MQ0 A;  2GUD A;  3WOC A;  1VBO A;  4WOG A;  5J50 A;  1UGY C;  3MIV A;  5JM1 A;  1J4S A;  1KU8 A;  3LL0 A;  1TP8 A;  4R6R A;  1JOT A;  1WS4 A;  1UGX A;  3MIU A;  5J4T A;  4PIF A;  1J4U A;  1X1V A;  3VY6 A;  4R6N A;  1UGY A;  3VZE A;  1JAC A;  1XEZ A;  4PIU A;  1C3N A;  4AKB A;  3LL2 A;  3R51 A;  2GTY A;  2GUC A;  3R50 A;  1ZGR A;  1XXQ A;  5BN6 E;  4GX7 A;  3LL1 A;  2HYR A;  1J4T A;  1UH1 A;  1C3K A;  5AV7 A;  2NU5 A;  1XXR A;  1KUJ A;  5EXG A;  5J4X A;  4PIK A;  1WS5 A;  1ZGS A;  3MIT A;  4DDN A;  4AKC A;  3VY7 A;  4PIT A;  3LLY A;  3APA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...