5J50A

Structure of tetrameric jacalin complexed with gal beta-(1,3) galnac-alpha-opnp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of tetrameric jacalin complexed with Gal beta-(1,3) GalNAc-alpha-OPNP
rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5j50A00
3APAA 5EXGA 3VY7A 2HYRA 3LKYA 4PIFA 2HYQA 2JZ4A 1UGWA 4R6QA 3VY6A 1TOQA 3R50A 3VZFA 1WS4A 3R52A 4AK4A 3LLZA 5JM1A 2GTYA 4R6RA 1KUJA 4DDNA 5BN6E 4WOGA 1UH0A 5J4XA 1OUWA 1UGYC 3WOBA 4PIUA 2BMZA 4PITA 3LL2A 3LL1A 5J51A 3MIUA 3WOCA 1UGWC 3MITA 2BMYA 1VBOA 1VBPA 3VZEA 1C3NA 2NU5A 1WS5C 1TP8A 4R6NA 3VZGA 1PXDA 3MIVA 1C3KA 2GUXA 4R6PA 4AKCA 3R51A 4GX7A 1ZGRA 1XEZA 4MQ0A 3LL0A 2GUDA 1J4SA 1WS4C 1J4TA 3O44A 1XXRA 1XXQA 2GUEA 1C3MA 1UGYA 5J50A 1JACA 1ZGSA 1UGXA 3AQGA 2BN0A 1X1VA 3P8SA 5AV7A 1JOTA 1J4UA 1M26A 4PIKA 3LLYA 2GUCA 1WS5A 2NUOA 4AKBA 1KU8A 4R6OA 1UH1A 4AKDA 3LM1A 5J4TA
chains in the Genus database with same CATH superfamily
3APAA 5EXGA 3VY7A 2HYRA 3LKYA 4PIFA 2HYQA 2JZ4A 1UGWA 4R6QA 3VY6A 1TOQA 3R50A 3VZFA 1WS4A 3R52A 4AK4A 3LLZA 5JM1A 2GTYA 4R6RA 1KUJA 4DDNA 5BN6E 4WOGA 1UH0A 5J4XA 1OUWA 4QX3A 1UGYC 3WOBA 4PIUA 4W8JA 2BMZA 4PITA 1VMOA 3LL2A 3LL1A 5J51A 3MIUA 3WOCA 1UGWC 3MITA 2BMYA 1VBOA 1VBPA 3VZEA 1C3NA 2NU5A 1WS5C 4QX1A 1TP8A 4R6NA 3TOWA 3VZGA 1W99A 2C9KA 1PXDA 4QX0A 3MIVA 1C3KA 2GUXA 4R6PA 4AKCA 3R51A 4GX7A 4ARXA 1ZGRA 1XEZA 4D8MA 4MQ0A 3LL0A 2GUDA 4ARYA 1DLCA 1J4SA 3EB7A 1WS4C 1J4TA 2QP2A 3O44A 1XXRA 1XXQA 2GUEA 1C3MA 1UGYA 5J50A 1JACA 1ZGSA 4MOAA 1UGXA 1I5PA 3AQGA 2BN0A 4QX2A 1X1VA 3P8SA 5AV7A 1JOTA 1CIYA 1J4UA 1M26A 4PIKA 3LLYA 2GUCA 1WS5A 2NUOA 4AKBA 1KU8A 4R6OA 1UH1A 1JI6A 4AKDA 3LM1A 5J4TA
chains in the Genus database with same CATH topology
3APAA 5EXGA 3VY7A 2HYRA 3LKYA 4PIFA 2HYQA 2JZ4A 1UGWA 4R6QA 3VY6A 1TOQA 3R50A 3VZFA 1WS4A 3R52A 4AK4A 3LLZA 5JM1A 2GTYA 4R6RA 1KUJA 4DDNA 5BN6E 4WOGA 1UH0A 5J4XA 1OUWA 1UGYC 3WOBA 4PIUA 2BMZA 4PITA 3LL2A 3LL1A 5J51A 3MIUA 3WOCA 1UGWC 3MITA 2BMYA 1VBOA 1VBPA 3VZEA 1C3NA 2NU5A 1WS5C 1TP8A 4R6NA 3VZGA 1PXDA 3MIVA 1C3KA 2GUXA 4R6PA 4AKCA 3R51A 4GX7A 1ZGRA 1XEZA 4MQ0A 3LL0A 2GUDA 1J4SA 1WS4C 1J4TA 3O44A 1XXRA 1XXQA 2GUEA 1C3MA 1UGYA 5J50A 1JACA 1ZGSA 1UGXA 3AQGA 2BN0A 1X1VA 3P8SA 5AV7A 1JOTA 1J4UA 1M26A 4PIKA 3LLYA 2GUCA 1WS5A 2NUOA 4AKBA 1KU8A 4R6OA 1UH1A 4AKDA 3LM1A 5J4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APA A;  5EXG A;  3VY7 A;  2HYR A;  3LKY A;  4PIF A;  2HYQ A;  2JZ4 A;  1UGW A;  4R6Q A;  3VY6 A;  1TOQ A;  3R50 A;  3VZF A;  1WS4 A;  3R52 A;  4AK4 A;  3LLZ A;  5JM1 A;  2GTY A;  4R6R A;  1KUJ A;  4DDN A;  5BN6 E;  4WOG A;  1UH0 A;  5J4X A;  1OUW A;  1UGY C;  3WOB A;  4PIU A;  2BMZ A;  4PIT A;  3LL2 A;  3LL1 A;  5J51 A;  3MIU A;  3WOC A;  1UGW C;  3MIT A;  2BMY A;  1VBO A;  1VBP A;  3VZE A;  1C3N A;  2NU5 A;  1WS5 C;  1TP8 A;  4R6N A;  3VZG A;  1PXD A;  3MIV A;  1C3K A;  2GUX A;  4R6P A;  4AKC A;  3R51 A;  4GX7 A;  1ZGR A;  1XEZ A;  4MQ0 A;  3LL0 A;  2GUD A;  1J4S A;  1WS4 C;  1J4T A;  3O44 A;  1XXR A;  1XXQ A;  2GUE A;  1C3M A;  1UGY A;  5J50 A;  1JAC A;  1ZGS A;  1UGX A;  3AQG A;  2BN0 A;  1X1V A;  3P8S A;  5AV7 A;  1JOT A;  1J4U A;  1M26 A;  4PIK A;  3LLY A;  2GUC A;  1WS5 A;  2NUO A;  4AKB A;  1KU8 A;  4R6O A;  1UH1 A;  4AKD A;  3LM1 A;  5J4T A; 
#chains in the Genus database with same CATH topology
 3APA A;  5EXG A;  3VY7 A;  2HYR A;  3LKY A;  4PIF A;  2HYQ A;  2JZ4 A;  1UGW A;  4R6Q A;  3VY6 A;  1TOQ A;  3R50 A;  3VZF A;  1WS4 A;  3R52 A;  4AK4 A;  3LLZ A;  5JM1 A;  2GTY A;  4R6R A;  1KUJ A;  4DDN A;  5BN6 E;  4WOG A;  1UH0 A;  5J4X A;  1OUW A;  4QX3 A;  1UGY C;  3WOB A;  4PIU A;  4W8J A;  2BMZ A;  4PIT A;  1VMO A;  3LL2 A;  3LL1 A;  5J51 A;  3MIU A;  3WOC A;  1UGW C;  3MIT A;  2BMY A;  1VBO A;  1VBP A;  3VZE A;  1C3N A;  2NU5 A;  1WS5 C;  4QX1 A;  1TP8 A;  4R6N A;  3TOW A;  3VZG A;  1W99 A;  2C9K A;  1PXD A;  4QX0 A;  3MIV A;  1C3K A;  2GUX A;  4R6P A;  4AKC A;  3R51 A;  4GX7 A;  4ARX A;  1ZGR A;  1XEZ A;  4D8M A;  4MQ0 A;  3LL0 A;  2GUD A;  4ARY A;  1DLC A;  1J4S A;  3EB7 A;  1WS4 C;  1J4T A;  2QP2 A;  3O44 A;  1XXR A;  1XXQ A;  2GUE A;  1C3M A;  1UGY A;  5J50 A;  1JAC A;  1ZGS A;  4MOA A;  1UGX A;  1I5P A;  3AQG A;  2BN0 A;  4QX2 A;  1X1V A;  3P8S A;  5AV7 A;  1JOT A;  1CIY A;  1J4U A;  1M26 A;  4PIK A;  3LLY A;  2GUC A;  1WS5 A;  2NUO A;  4AKB A;  1KU8 A;  4R6O A;  1UH1 A;  1JI6 A;  4AKD A;  3LM1 A;  5J4T A; 
#chains in the Genus database with same CATH homology
 3APA A;  5EXG A;  3VY7 A;  2HYR A;  3LKY A;  4PIF A;  2HYQ A;  2JZ4 A;  1UGW A;  4R6Q A;  3VY6 A;  1TOQ A;  3R50 A;  3VZF A;  1WS4 A;  3R52 A;  4AK4 A;  3LLZ A;  5JM1 A;  2GTY A;  4R6R A;  1KUJ A;  4DDN A;  5BN6 E;  4WOG A;  1UH0 A;  5J4X A;  1OUW A;  1UGY C;  3WOB A;  4PIU A;  2BMZ A;  4PIT A;  3LL2 A;  3LL1 A;  5J51 A;  3MIU A;  3WOC A;  1UGW C;  3MIT A;  2BMY A;  1VBO A;  1VBP A;  3VZE A;  1C3N A;  2NU5 A;  1WS5 C;  1TP8 A;  4R6N A;  3VZG A;  1PXD A;  3MIV A;  1C3K A;  2GUX A;  4R6P A;  4AKC A;  3R51 A;  4GX7 A;  1ZGR A;  1XEZ A;  4MQ0 A;  3LL0 A;  2GUD A;  1J4S A;  1WS4 C;  1J4T A;  3O44 A;  1XXR A;  1XXQ A;  2GUE A;  1C3M A;  1UGY A;  5J50 A;  1JAC A;  1ZGS A;  1UGX A;  3AQG A;  2BN0 A;  1X1V A;  3P8S A;  5AV7 A;  1JOT A;  1J4U A;  1M26 A;  4PIK A;  3LLY A;  2GUC A;  1WS5 A;  2NUO A;  4AKB A;  1KU8 A;  4R6O A;  1UH1 A;  4AKD A;  3LM1 A;  5J4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...