The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
132
|
sequence length |
371
|
structure length |
371
|
Chain Sequence |
LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELSTFEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIEIMEALPKNTHPMGALRTIISYLGNIDDSGDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPKEKLSHAANFLYMLHGEEPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQFMEIGSPEKVEEWFFKALQQKRKIMGAGHRVYKTYDPRARIFKKYASKLGDKKLFEIAERLERLVEEYLSKKGISINVDYWSGLVFYGMKIPIELYTTIFAMGRIAGWTAHLAEYVSHNRIIRPRLQYVGEIGKKYLPIELRR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of citrate synthase from the hyperthermophilic archaeon pyrococcus furiosus at 1.9 A resolution,.
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Pyrococcus furiosus
|
molecule keywords |
CITRATE SYNTHASE
|
total genus |
132
|
structure length |
371
|
sequence length |
371
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.3.3.16: Citrate synthase (unknown stereospecificity). |
pdb deposition date | 1997-05-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00285 | Citrate_synt | Citrate synthase, C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Cytochrome p450-Terp; domain 2 | Cytochrome P450-Terp, domain 2 | ||
Mainly Alpha | Orthogonal Bundle | Citrate Synthase; domain 1 | Citrate Synthase, domain 1 |
#chains in the Genus database with same CATH superfamily 1CSH A; 3HWK A; 1OWC A; 4E6Y A; 4CSC A; 1A59 A; 3CSC A; 1IOM A; 4JAD A; 3TQG A; 2P2W A; 1VGP A; 5CTS A; 4JAF A; 3ENJ A; 1CSI A; 4JAE A; 1VGM A; 1NXG A; 1CSR A; 5CSC A; 1IXE A; 1AMZ A; 1CSS A; 2IBP A; 2IFC A; 4XGH A; 1OWB A; 4YBO A; 5CSC B; 1CSC A; 6CTS A; 2R9E A; 1AL6 A; 1AJ8 A; 4CTS A; 4TVM A; 6CSC A; 3MSU A; 3O8J A; 4JAG A; 2H12 A; 2CTS A; 2R26 A; 4G6B A; 2C6X A; 2CSC A; 1NXE A; 1CTS A; 1O7X A; #chains in the Genus database with same CATH topology 1CSH A; 3HWK A; 1OWC A; 4E6Y A; 4CSC A; 1A59 A; 3CSC A; 1IOM A; 4JAD A; 3TQG A; 2P2W A; 1VGP A; 5CTS A; 4JAF A; 3ENJ A; 1CSI A; 4JAE A; 1VGM A; 1NXG A; 1CSR A; 5CSC A; 1IXE A; 1AMZ A; 1CSS A; 2IBP A; 2IFC A; 4XGH A; 1OWB A; 4YBO A; 5CSC B; 1CSC A; 6CTS A; 2R9E A; 1AL6 A; 1AJ8 A; 4CTS A; 4TVM A; 6CSC A; 3MSU A; 3O8J A; 4JAG A; 2H12 A; 2CTS A; 2R26 A; 4G6B A; 2C6X A; 2CSC A; 1NXE A; 1CTS A; 1O7X A; #chains in the Genus database with same CATH homology 1CSH A; 3HWK A; 1OWC A; 4E6Y A; 4CSC A; 1A59 A; 3CSC A; 1IOM A; 4JAD A; 3TQG A; 2P2W A; 1VGP A; 5CTS A; 4JAF A; 3ENJ A; 1CSI A; 4JAE A; 1VGM A; 1NXG A; 1CSR A; 5CSC A; 1IXE A; 1AMZ A; 1CSS A; 2IBP A; 2IFC A; 4XGH A; 1OWB A; 4YBO A; 5CSC B; 1CSC A; 6CTS A; 2R9E A; 1AL6 A; 1AJ8 A; 4CTS A; 4TVM A; 6CSC A; 3MSU A; 3O8J A; 4JAG A; 2H12 A; 2CTS A; 2R26 A; 4G6B A; 2C6X A; 2CSC A; 1NXE A; 1CTS A; 1O7X A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...