The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
71
|
structure length |
71
|
Chain Sequence |
MLQKKIEEIAAKYKHSVVKKCCYDGASVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of a unique C5a semi-synthetic antagonist: implications in receptor binding.
pubmed rcsb |
| molecule keywords |
COMPLEMENT 5A SEMI-SYNTHETIC ANTAGONIST
|
| molecule tags |
Immune system/inhibitor
|
| source organism |
Homo sapiens
|
| total genus |
14
|
| structure length |
71
|
| sequence length |
71
|
| ec nomenclature | |
| pdb deposition date | 1996-09-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01821 | ANATO | Anaphylotoxin-like domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Influenza Virus Matrix Protein; Chain A, domain 1 | Anaphylotoxins (complement system) |
#chains in the Genus database with same CATH superfamily 4P3A A; 1KJS A; 4HW5 A; 3KLS A; 1CFA A; 3HQB A; 4UU9 C; 4FXK B; 4P3B A; 4HWJ A; 1C5A A; 3HQA A; 5JPN B; 2A73 B; 4I6O A; 2B39 A; 4P39 A; 4WB2 A; 4WB3 A; 3CU7 A; 5B4P B; #chains in the Genus database with same CATH topology 4P3A A; 3VDX A; 4PUS A; 1KJS A; 3MD2 A; 4HW5 A; 3KLS A; 1CFA A; 3HQB A; 4UU9 C; 4FXK B; 4P3B A; 4HWJ A; 1C5A A; 3HQA A; 5JPN B; 2A73 B; 4FXG B; 5CQE A; 4D9J A; 1AA7 A; 1EA3 A; 4I6O A; 2B39 A; 4ITV A; 4P39 A; 2Z16 A; 4WB2 A; 5JPM B; 4WB3 A; 4IQ4 A; 3CU7 A; 5B4P B; #chains in the Genus database with same CATH homology 4P3A A; 1KJS A; 4HW5 A; 3KLS A; 1CFA A; 3HQB A; 4UU9 C; 4FXK B; 4P3B A; 4HWJ A; 1C5A A; 3HQA A; 5JPN B; 2A73 B; 4I6O A; 2B39 A; 4P39 A; 4WB2 A; 4WB3 A; 3CU7 A; 5B4P B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...