5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
1BWWA 3RVTC 4DCQA 4WW2F 5FHAL 2VAJA 1DSFL 2GJ6B 5EZOH 3ECBA 5C7XH 2VDMH 3GSNB 5GGQH 2FLBT 3JVGA 4PJAA 4RMQA 1TJHL 3FQTA 3MLVL 4OM0H 2C9AA 2K1MA 5IUSA 4BQBA 4ZO9A 3EZ8A 3HI6L 4KDTA 4M93B 5IJKA 3RWEB 1IEBB 4PB9H 5DJCA 1FL3B 5CKAA 1MCQA 1AKJA 3M8OL 4BZ1H 3NFNA 2NW3B 2EIZA 2Y5TB 1MI5D 1RZKC 2NY5C 3TN0C 3BD5A 2A9NH 5DVMA 4OCXL 3C08L 1XGTA 2OTUA 3IJHA 3QQ4B 4ENED 2X89A 1P2CA 3QFDA 4S0SD 2KBGA 4K71C 1S9XB 2Z91A 1LP9E 1F13A 3U7YH 4KV5F 1Q9OA 5DJYA 1RURH 5DJAA 5F9JB 3GI8L 1JYVA 3RWDB 1UZ6E 3CNKA 5BW7C 5BQ7B 4M7ZC 2YBRB 1FGVH 3W11D 3W9DA 3TZVC 1BD2E 5EOQH 1SA5B 5CEZH 3T0BA 4ZFFA 3GO1L 4J3XA 1J8HE 4P2YA 1OCWH 4N0FB 1JFQH 3KVQA 1RJYA 3RUGB 3VFUA 1XGQB 3O2DH 3ES6A 1X6NA 4IHOA 2P1YA 1A6AB 3VG9C 4M7JH 3LEYL 1YDPB 2C1OB 4PFEA 3SFXB 1DQDH 1CLYL 1A7PL 4KK6C 2OR7A 2Q86B 3IF1B 4WI8A 4HGWA 3C60D 3GUTA 5C08E 4OCWL 4XI5D 4YDVA 4L8DA 1EEZB 1QHOA 4M5ZH 3SJVA 3WFHA 1EFXA 4I3RH 4YAQB 4GKNB 2XXCB 1ZHLB 2HN7B 4OJFL 1QFWH 1SEQH 3E1F1 3FN0H 5T1KA 1II4E 1MFEL 2VSDA 3P4OA 4G8IB 1M7DA 5I1CH 3R06A 2DMCA 3VFRA 1T2XA 5I1CL 1U8IA 4YE4H 5A16A 4KJQD 5C3TA 4AG4H 1MRFL 4ZUVA 3OBAA 3TZVD 5JQ6H 3S5LA 2FR4A 1J7VR 5L8KB 3O3AB 3SDAA 4TUKL 3FFCE 3VU2A 4C55A 4QRUA 4X4YA 1P7KA 3UYPA 1BZ7A 1CXIA 2OCFD 4X5XA 1U8QB 3I2CL 4OGXL 5I1AB 5E5MB 3VWKD 2VDNL 3FONA 3MCLL 3MXWL 4C1SA 5IVXB 3U4EA 3PQYE 4RMWA 3QQ3A 4WW1A 4ZRPA 2ZOKB 1IBGL 5KTEL 4OSUH 1R3IL 4PJ5B 1D6VL 1J86A 5I9QB 3MYJB 3QWOB 5SX5H 5D5ME 3DVGB 1YNTB 5CEZL 1A7PH 4MX7B 4Z5RB 2D3VA 3CVIL 4J8RA 5F6HI 2CQVA 4XC1L 1DEEA 5DMKA 1NCTA 1G9MC 3MRDB 2FECL 4G5ZL 3VXRD 3DGGB 4JN1H 4XBGB 5FKPA 4F8QA 3PWJB 4LSTL 1F3JA 3E3QC 4GAGH 4Y2DC 4UQ2A 3KYOA 1OTTD 2E8ZA 4DVBB 2F19L 1PG7X 1GC1C 3QUXD 2IC2A 1DQTA 3ALWA 5BRZA 2ZUXA 4P46D 2Q7NA 3B4NA 3D0VA 4U6HA 1WZ1L 4UDUB 5DUPH 5DD1L 4MD5A 4ZOCA 1I3VA 1I8LA 3OX8B 4F3FA 3G5VB 2UWEF 4JLRB 2M8XA 5D72L 4OZIE 4PJ8A 5I73C 1MRDL 1YYLH 3WN5C 4XCEA 2R4RL 2VLKB 2DBLL 4NQDA 4P4KC 4NCDA 7FABH 2BY1A 3H3PL 4KVNL 3ARXA 1CG9A 2EDJA 3EYVA 1PSKH 1SYSB 4PJCA 3VE0B 1J05A 5D6DC 3BMWA 3T0XA 2ZG2A 1GXEA 4F9LA 4OKVB 2KZWA 3P4MB 2OSLB 3WXVL 2EECA 3DGCR 3EIFA 5E9DD 5DEGB 1MCWW 1PZUB 3NCCB 4M9PA 3IU4L 4QRQB 5TE7L 4JZOB 2UVEA 4EIGB 1Z9SA 3OB0H 5ID1A 3WKML 1S7QA 3HLAB 5D1XD 3AC0A 3MLPA 2W0PA 2PXYB 4P9HC 3TBYA 2DTMH 1S78C 3RWHB 1JPGA 2VISB 3PUCA 3VXMD 4LGSB 1BFOB 3MJ7A 1Z9LA 5JHLH 1ZA3A 2JK5A 2ZCHH 3MRIB 4OCRH 3WSQH 5FYJU 4ZAKB 1YEJH 1CD1B 3FT2A 4L4TD 5SX4H 1MWAA 4LU5L 3U0TA 3F5WB 4R0LC 3NBNA 1QA9A 3T2PA 1MFBH 1D9KD 3NCYP 3LKPB 1FORH 3FJTA 1T66D 4OCYH 5FUOH 4ODTL 4P0DA 3RL2A 4LGRB 1ZT1B 4RZCB 3BZDA 4P57B 4V1DB 2HA1A 1J8HA 1T20A 3QEHA 1MHCA 3BIAX 1FT2B 2X4RB 1T5WB 3HFML 1YYLL 3FT4A 2Y23A 4XAWH 5E4EB 4G8EB 3VXRE 1KJVB 2BNQD 4LLYB 3UTSE 4Y4FA 4PJAB 1FL6B 4YBHA 2IG2H 1JZ2A 4JPWL 2J7LA 2FDBP 1GGBH 3LN5A 4PRIE 1XAUA 3EHBC 5C0DB 2D4DA 4HXAL 5DC0A 4Q0XH 1IGYA 2VDPL 5FV1L 2UYLB 4JFHD 5KW9H 3L3DB 4NQTA 4NOBA 1ETZB 3CMOH 3JTTB 4PG2C 2NW3A 1CE6A 5J56B 1YNKL 4R7NB 2BFVH 1U8OA 1EHLL 4K3DL 1JCKA 3RIFF 3QFDB 2ZOLB 1NGWA 3HNVL 3MLRH 5C0CE 1NKOA 2NX5B 1SBSH 3F7VA 4JHAH 4ODSH 5F7DA 1RFDL 4DOHB 1MWAL 5KSAD 2EH8L 2QQKL 4L3CA 3Q7AB 2HFFA 3I6GA 3MGTB 3L7EB 2IAMC 5FDWB 3W9DB 2PYFB 1LE9A 4JCLA 2ICES 4M6NL 5LBSL 3O2DL 4ZFFB 4XWOC 3DV4A 5CJQL 3NH7H 2AQ2A 4FQCH 5D93C 1KN2L 4AQ1B 2QKIB 3CCHB 2K7QA 2MQCA 4IHOB 4LNVA 5GGTH 5JOFB 1JWUB 3E8UL 1WCBB 1DSFH 2GAZB 4XX1E 1NDMB 3H3PH 5KSVB 2FGWH 2JJVA 5E9DB 2QSCH 4PBVC 5DS8B 4F80A 5BVPH 3S35X 4WTWA 1EFXB 1KYOK 2FX8H 2ZSWB 1JVKA 1ZHLA 2HN7A 4YWGL 3DBXB 1OP3H 3IDMB 1IFHL 3UO1L 2DQUH 2QSTA 1IM9D 3MV9D 4JPKL 4X99A 1LK3L 2P8PA 1OSPH 5F71A 5TDNA 3R06B 1T1YB 4Z7WA 2JJUA 4GRMB 1KFAL 2GITA 1W6KA 2CUIA 1RHFA 1J18A 3FTGB 2PYED 4MQ7A 4NZTL 1TZGH 3DX6A 3MPCA 2ZPKH 1TCRB 4JDZA 3TNMA 5EU6E 3DX7B 3S5LB 5DJ0A 1UWEL 4MNQE 1BQHA 4FQQA 2VLLA 1BFVH 3SPVB 3OF6A 4KMQA 1PEZA 3PJSB 5I1LA 5IVXA 5GZNC 2DI7A 2WUCL 2AI0H 3VMOA 2XG4A 4JFEB 5KVFL 1HZHL 1CGXA 1EGJA 2NNAB 4X7FC 4PRHD 1RHHA 3PHSA 2A6DA 4GS7C 4I9WD 1QLFB 1JNHA 2H8PA 1UEMA 3MYJA 5I1KH 3HRZB 3DUHA 3MRGB 1U3JA 4HLJA 3N85L 5CJBA 3U9PH 4U33A 3P73B 4UTBL 5FYLH 1T1ZA 4D0DB 1E6JL 2IGFH 1CICB 1C1EL 2V5TA 4J8RB 2VWEC 4GMTL 5A2FA 3SBWC 1DEEB 2IALA 1RK0B 2BY2A 2R1YA 3MCG1 1XR8B 2Q6WB 3QUZA 3H7BA 4U1IB 2YD8A 4F7MA 1KTLB 2Y07L 5BXFA 3VFSB 1DUYB 1HQ4B 1K4CA 4JG0H 1FCCA 1TQBB 3ESUF 3KPSD 4YBQC 4MJIE 4DVBA 4RWYH 1P9MC 3F7QA 1T3FB 3SKNB 1J1XL 4ELMA 1NCDH 2G75B 5AZEL 2A74B 1MHEB 4OIBA 5EFIA 5I18H 1HH6A 5FECB 2J2ZA 3BH9A 5KSUB 5DRNA 3MUHL 1QYGH 3VXUE 3FRPG 3O45A 5J8OA 2DBJA 1MCKA 3P40A 1T1XA 4MD5B 1H3XA 1YPZF 3EYOB 4TOYH 1UT9A 4Y2DB 4JLRA 5DSCA 2ICCA 1CFAA 1Q1JH 3RGVD 4PJ8B 1UXWA 5DHVA 3MXWH 2VLKA 3F12B 3JWDH 2LAGB 4QTHB 4TRPL 4ZTOH 4PBXA 1ZS8A 5C0EB 5EORL 3TJHD 1KIUA 1WBYA 2GFBA 4GRWF 3RTQC 3O3EB 1QEWB 2CLZB 3QCVL 1MCOL 4TPRH 4YHKH 5DQJA 4Z7UF 3PZ3B 5C0RH 3QDAA 4QRQA 1NUGA 2BC4B 2F15A 1JHTB 1N4XL 4JFYA 2O5ZH 3RWJB 1DCEB 4Q6YA 4QHMB 4GLRI 4PGEA 3MO1A 4ETQA 1F6AB 3WDHA 2Y36L 2H2SD 4O2EA 2XXMB 1QO3B 4OZHE 3U4BL 2VE6B 3KPSE 5I71C 4Q9RL 4KQ4H 4GTQB 4MDJB 3WO4B 2V7NB 4I3GA 3MRIA 3A6OA 5E8OB 4ZTPH 3LS5L 5IFAL 1IGCL 3U0TB 1KJ3H 1G6RA 2GEEA 5EO9B 5F1IA 1A1OB 2R1WA 4LKCB 1NCDL 4LLVA 3DIFA 1MCNA 2BNRD 4MCYB 4ODWA 4PLKC 2FSEA 4NJAH 5EU4B 4Y7MA 2FBJL 1JHKH 1HH9A 1MRDH 1ZT1A 4O2FA 3MBXL 1R3IH 4LCWD 4EXPX 3DO3A 4NQCB 1R3KA 3W11C 3QEHB 5ANME 3GHEH 4F7TA 2WAHA 5FO9A 2FEEL 4ODHL 1A6WL 1AR2A 4ONTA 4JN2A 1CDHA 2FLRT 1RZ7H 3WLBB 1KJVA 4LAQL 4LLYA 1NCUA 1KLUB 1NGQH 1S78D 1X9QA 4KI5F 1C3DA 1OD9A 3U7WH 4WI3A 4PV8A 1NLDL 5FCUL 4XI5C 3G6JE 4Z7UA 5FK9B 2D03H 1EFQA 4M7ZB 3ULVD 2D9CA 3UBXB 2JIXB 2VL5B 3KPOB 2DQFB 4X4ME 2Z93A 5EZLA 1C16A 4PJ5D 3D25A 4PJXA 5SWQB 2VXQL 4JHWH 4HS8L 1NGWB 4GUPB 1I7ZB 3CFCL 5ANMA 1G7PB 1GZPB 2WV3A 3P30H 3V7AG 2IH3B 1N0XL 3O6KH 4KHTH 1CICC 3BESR 1C7SA 3BKCH 4JPVL 3LZFL 1JPTL 4G9DB 5DJ2A 32C2B 1AFVL 4KZDL 5D2NE 5ICYA 4GS7B 1BBJA 4PJFE 1F3DH 4XVSL 3VXSB 2ATPB 1I1AA 4KK9C 3BZFA 3UYOD 4Q9QH 1N6VA 5JOFA 1G6RL 2VMFA 2A2QT 1NUDA 3BZEB 2BRRL 3D0LA 3VCLA 5IBLC 4ZTOL 3LRSA 4GMSH 4OZIB 2GUOB 4Y1AE 4LMQI 4GSDH 5F7WC 4MD0A 3AB0B 3LQAL 3WLWC 2APWA 4EUPB 1F58L 4G9FA 3VRLF 5GGTA 3U7AA 3BW9A 3I75B 4GRLD 1MCPH 3ZE0F 1T7WA 3QP3A 1R3HA 3Q79B 3UTSA 3BGFC 1JYWA 4JFOB 3T09A 4ONGH 5TDNB 4PJBB 2VDQL 1QSFA 3DRTB 5DMIL 5A2LH 1NC2A 4P3AA 1OM3L 1HIML 4PD4K 1N8ZB 43C9A 3FQNB 3SN6N 5SV3A 2J1KA 5CILL 3TNMB 1HIMH 1I1YB 3BPNC 5DUBB 1LEGB 2CKBB 3TA3B 3MRHB 2X4QA 3JZ7A 2ITDA 4IS6B 1A7RH 1GZQB 3RY5A 3AVEA 2AJXH 1JNNL 4MAYB 3DWTA 1FDLH 3ARFB 5JOEA 3H7LA 5AWNL 2DL9A 1DBAL 1QFHA 2HRLA 5AZ2H 1TITA 3V5KB 2A6DB 1QLFA 3V4VL 1FN4A 1N6QH 2UY7A 3CSYA 1NGXB 3KR3H 4J3OC 2W59A 1NMBL 2GQHA 2BP3A 4LDLB 5GGVY 4YGVB 1DQLL 3LKSB 1AC6A 1WBXB 3CFBA 5C9JB 4JGMA 2EDYA 1CF8L 2ADJB 4WFHE 1DVFC 4K55A 3RWIA 2P5EA 1GXMA 3OL2A 1T7XA 2WZPD 1KTLA 2DQEH 3HE6C 5AZEH 1I9IH 1BLNA 1SJEB 2ZPKL 1UFUA 4JRYE 1YN7B 3GSQA 3IDYB 1NGPL 1S8DB 4JO1H 2BSSA 2EYSA 4L4VB 4CMMB 5SWSD 1HH6B 1Q9WB 3UAJC 1Z0MA 2YUXA 5FECA 3KJ4B 3GJFB 4OZ4B 5GSRA 1MOEA 4LGPB 3H42H 3AFLA 3CZFA 3W2DH 2KPNA 2M26A 1YEKL 3K2UH 1T1XB 3OKOA 3EYOA 2HAZA 1FLRL 1RZJC 4ZXBD 5I75B 1YECL 5JHLL 4QOKA 3L3IA 5DWUL 4RRPG 4Y4KC 1FZOA 1C12B 2YKLH 5T1LB 3TT1H 3UYRL 3MCKA 3VFTA 4JRXE 1A1NB 4HF5L 1ZHNB 1KACB 1O1TB 3RY4A 2R56L 5EU7C 2GFBB 5AGDA 4JAMB 1KTRL 4CBPA 1RIHH 5CGYC 2FX7L 1X5FA 3BGFB 1XGUA 2FO4A 1IRAY 3N06B 1CTOA 3RWJA 4DN3H 3I3EA 5FIEA 4XPGL 5I1JH 2QTEA 4CDHA 5D1QB 2PO6C 1G9NH 1T22B 2FB4H 3CH1B 4HK3J 2XPGA 1BGXL 3MV7B 4MAUH 3FT3A 3Q6GL 3BMVA 2O5YL 1QP1A 3G6JA 5HYSB 1UADC 5JO5A 2VE6A 3L1OL 5HI3C 1R0AL 2SEBB 4F15B 4HC1A 4P2RA 1FFNA 4MCZB 5B8CB 4ISVA 1TZGL 4P39A 4M93C 3MODH 5E8OA 4LSRH 2D7NA 5IQ7H 1MCIA 4F57L 3PDDA 4ZS6C 5HSFA 4OF8A 1MY7A 4RDQF 5DGQA 5T3ZD 3MV8E 5F1IB 5JR1L 2BOCB 5KS9A 3WHE0 5E8DL 3W39A 4U7MA 3F7YA 3LQAC 1JI1A 1PBYA 4GTMB 4M8QA 2HT2C 1J8KA 3L9RA 4OI9A 4DVRH 3O2DA 4PJ7E 3MLWL 1HH9B 3HR5A 2GSIB 1S64B 5C0AB 2F53B 3V79C 1G7JB 1A4KB 1X4XA 3CX5K 5EOTB 4UTAL 4ODHH 4E9LA 1F45A 5F70A 4NNXB 4DN4H 4DK3A 3TIDA 4F7TB 3G6JF 4WI6A 5FYKE 3TO4A 4IOFC 4X80H 1C5DA 3BQUC 4QRTB 2AEPH 3WLBA 3O6LH 4UMGA 3VXRB 4XMKH 5H35B 5IF0B 3Q73B 5T5NF 5D2LB 2K7PA 4Z7UB 3O2VH 4FNLH 5K9JH 4HIXH 1PFCA 2P45B 2HVKA 5JIPA 3MZTA 1EVUA 2O5YH 2VL5A 1XGRA 2HWZL 2PKDA 3X13A 2DQFA 2Z93B 3CSBA 1B90A 3I02A 4TUKH 1URLA 1IC4L 1U0QA 5LCVH 1NCWH 1GZPA 3DXAE 3OPZH 5GRYA 3IRPX 5SWZB 4JPKH 5CP7B 1SQCA 5BCAA 2ZUYA 2NY5L 5E4IA 5HDQL 5TQ0H 3RAJH 4K3EL 4AM0B 1JF6A 4XP9L 4HH8A 1KELL 2F58H 3CLEH 4XVSH 4U6XB 5DJ2B 2VDLL 4LDOB 3DO7B 1PG7W 3QI9B 3D39A 3VWJA 1AR1D 2VLRD 1JWMA 1UH4A 4P2QE 3RX8A 1UM4H 5FO7B 1DBJH 1QLRB 1S7XB 3E37B 2AXHA 2OQJB 1K6QH 2WBKA 2G9HB 3UTTE 2I9LB 2E9WA 5F9DC 1YJDC 3TYFB 5JW3H 3OB8A 1CFTA 3L3OA 2G5BB 5I1KL 5CJQH 5F7LB 2ARJQ 2ERJC 3RWCA 1XGPB 3P9MA 1BOGA 5I0DA 5GRWA 1F90H 2K3TA 3BW9B 3I75A 4LP5A 3JUZA 3UTSB 1CZ8H 1YC8A 4FN0A 1HINL 4HAFA 1BF8A 1OM3H 4XZUB 5F9WC 2N4IA 1U91A 5ACZA 1X5ZA 2IBZY 4MJ5A 3BT2H 3M17B 3MNWB 4L5FL 2QQNH 4Z95L 2DQJL 4JY5H 5AUMB 4JFPB 2VC2H 4M1GL 1OARL 3TJEL 3VXTA 4P2OD 3UO1H 3E32B 3ILPA 5I17B 3NZHL 1I8MA 4HWUA 1G0DA 4N68A 2CJUH 3V5HA 3OKLB 4S1DC 2NXZB 1LEGA 4OB5L 2DOCA 4QWWD 4V1SA 4D8PA 2X9YA 2X4QB 3ARED 3HS0A 4YUEH 4XPHH 1SHMA 4PP2B 3HXEB 5HHOB 1WC7A 4ZG1A 2R0LL 3AREA 3OJVC 5GS1B 3QIUC 1LNUB 3VFPB 4PB0L 1MFAH 4UAOC 3W9EB 3DVNB 4HUWB 1CGSH 4LOUD 2D7MA 3CSYB 4L8BB 3U6RB 5EU6A 3B2UD 4V1RA 1Q1JL 1W2KT 1G7QA 5IVZA 4YGVA 3GNMH 3BWAB 4B7LA 4JZJC 5I19H 5D7SL 4LCIH 2IPUK 1FYHB 3QUKA 3OJ2C 3OKEB 5I30L 3SDXA 4NZRL 3CVHB 1BVLB 3OAUL 2XACC 4JCMA 2VZUA 3OJMB 1Q9KA 2QSVA 4PJXF 2YPVH 1BLNB 1SJEA 2XTJB 4EOWH 2BFVL 2EKSB 4G8GA 2EDOA 3TVMC 5JPNB 4G7VH 2DQGL 2EEBA 3FRUB 4JRWA 2E9IA 4PJEB 4C83B 3HNVH 1DQQB 3NCYS 1N9AB 4LCWB 4X6DF 3IETB 1I4FA 4YC2B 3EDKA 4YHOL 3VWJD 2ZUUA 5LAXA 4D9LH 1B4JH 1U58B 1UKQA 2EDLA 5H37G 5F8RC 4WFED 2DWDA 3UPRA 4OLZH 4ZD3L 5FCSH 5HPMB 1FZOB 3G5ZB 4WJ5A 4NO0A 4MXQC 3EFDH 3LOWA 2P47B 1C12A 3ARGB 4PRHE 4C56A 1LEKB 5ID0B 4HWBH 4UDTA 1Y18A 1TNMA 2XICA 3I6KA 3DMMC 3FO0H 2IPUG 3F8UB 2NY0C 1IT9L 4NUJB 1QLEH 1G7MA 2WW8A 5HGAB 1GJIA 1NFDA 4KI5E 5JOPE 4FFZL 3I2CH 3Q78B 2R69L 4Z7WE 1ZEAH 4G80B 5E2WL 4P4RB 4QRRB 1OAUH 3P4LA 3DRQA 3D2UB 3LPFA 2R0WL 4EVNB 1RUML 4MNGB 5D1QA 4U1NA 1RIVL 3BSZL 3SGKA 2VZSA 3WS3A 4PD4J 2FHBA 1ZLUH 1KPVB 2A6JB 4FQIH 4P2RB 4Y5YA 3GB7B 3AXLB 1CFQB 4PS4L 4X6BA 1YEJL 5I8OL 3MRFB 4HS3B 4Q9CA 3QNYB 3JBG7 3BWUC 2XY2A 2NZIA 5EA0H 3RZCD 1TPXB 3G5XA 3IDNA 3C60C 3QHFH 5F89B 2AEIT 5GISH 2GY5A 5B22A 4LSDA 3NN8A 1RIUL 3FFCB 1C5BH 1QUNA 3B83A 3HE6A 3V7MA 4JFDD 3IT8D 1P1ZA 4R96B 3HR5B 4ZDHB 1UM5L 3R8QA 5FYKU 3SDCC 3MGOB 2KZ1B 1NCBL 4P46C 4NNXA 5DR5L 1I7TB 5K33A 4PJDE 4WFGD 2DI9A 4FQXA 5F7EH 3BEWA 3D87B 3O6FD 1RAMA 1FZJA 2BSTB 4XCNB 5L2KE 3LKOB 2VXUH 1OGAA 4TVSa 3RTQB 4IMLA 2GTZB 4NN5C 3RA7L 4QRRE 5H35A 1KPUA 2IAND 5I1DA 3ZYIA 4ORGB 2P8LB 4FQ1H 3EAKA 1R5WB 3O6FC 4YHNB 5CD3B 4K7PH 3ARBD 4EI5B 3IFNL 1KIRA 3TP4A 3X13B 2DWEB 4FQ1L 5F7NC 5CGYD 5JR1H 1HHKB 3CIQA 4QTIL 4HPYH 4RMRA 4LSTH 5C3LD 5SWZA 3OR7A 1A3LL 4FQ2L 5C0CA 5CP7A 2X4PB 3SFYB 5ESVA 1FT1B 3ULVH 4I5BB 5A3ID 4XGZB 1BZ9B 1HXYA 2FBOJ 1J88A 3L3GB 4I48B 4LSSH 3BUTA 5JW4N 2A1WL 1INEL 3UZQA 4H25A 1HNFA 4TRPH 3RGVC 3OXRB 3TO4C 4LCCB 4NGHL 1NCAL 5FO7A 4QY8A 5CJ8A 3WIHH 5JPMB 1HZHH 1QLRA 1J5OL 3ZE2E 3LN4A 5A40E 4LQ1A 3K80A 1CE1L 2I9LA 1JPST 2P48B 4NT6A 5HHPB 5I8KL 4ZSOE 1WAAA 3L3OB 2XY1A 5GS2H 1H36A 2R4RH 3T3PE 5ABDE 1Q38A 1XGPA 1JYNA 2P49B 1AI1H 3QFJA 3QNXB 5BS0E 4XTRC 1GOGA 4HUMB 2Q1EA 3QNZA 4YHMH 5ERWB 5F3HB 5JIIA 1TQCC 3KXFE 4I2XB 4WFEE 4HCRA 2JB5L 4JREC 3X3GH 5ALCH 1MLBB 1T83A 4NHCH 3MV01 2JB6B 2VDPH 2D7OA 2YPLB 3MRMA 4JM2A 2V2TB 2VQ1B 1WWBX 4LSRL 4APQD 4KK8C 3H2WA 1IC1A 4I3SL 3OKLA 3EYQC 4ZFGL 1R0AH 3DETD 4OZGF 1U8HA 1BQUA 4GG6B 3K4ZA 4IRSB 4K7PX 4PP2A 5E6IA 3STLB 1U3HD 4BSVB 4U6YB 4UIKH 4GAYA 3LHPH 2R2HB 1AIFB 4AEHH 2YD7A 4UT7L 2VABB 4K3JH 1LNUA 5CFHA 3FB5B 5J3HD 5DDHA 4UOJA 2WSKA 1C5BL 1VFAB 1KCLA 4JFFB 1GC1L 4C4KT 4CVXA 1O5DT 1P4IH 4PJHF 1A64A 1G7QB 2C7UA 3BPCB 1S9YB 1ZHBB 4EQ2A 3QUKB 3TT1L 5K9OB 1FYTD 5AG9A 5T33L 3C5ZB 4W4NA 1KTKE 3SDXB 5JXED 4KKBC 4JKPH 4L5FH 5IBUG 4DUXA 3HAEA 4RGNC 3ROOB 1EX0A 1OSZA 1NJ9A 2BVEA 4ENEC 5C0JB 4I0KA 2W60A 4G8GB 2Z92A 2F19H 4JPWH 4QYOB 3FRUA 4PRIA 4C83A 1T89A 1DQQA 4PB9L 1AY1H 4LVOC 4DTGH 1M7XA 4MA1B 5J6GB 2V2WB 1E4KC 1DLFH 4ZUWB 4JDVA 1EO5A 3ULSB 4L1HA 2DJSA 5HYJA 2IPKA 1NPUA 1BFSA 4OD2B 1T0PB 12E8H 5HPMA 1T0MB 4ACPA 4U1MA 3LDBC 4YHPB 4YFEA 3GI9H 4H0HB 4XP9H 2FJFB 4MZ2A 1K6QL 4UDTB 1BJ1J 3JVGC 2DQCL 2EC9T 5FYLD 1EMTL 3GMNB 3WFDL 1OVZA 2FHFA 1QBLH 1QQDA 5EZIH 1NCAH 4GQPH 4OIAA 4R90H 1LEIA 4O5LL 4KWUA 2VDRH 2V3NA 2OI9C 2ESVE 1KCRL 1TMCB 3E6HB 3HRPA 4J3SA 4ZFZA 1BEYH 1WWCA 4MXQD 3D2UA 1PY4A 4JO2H 1XF2B 3DHJA 4HIJA 1E27A 1K3ZA 3RNKA 4FQIL 2D4FA 3C2SA 4M02A 4P46B 1Q0YL 3IDUA 4MJ6B 5GIRA 2YPKA 1KPVA 2A6JA 4G7VL 5ALCL 4YDOB 1AXIB 1CL7L 4JZJA 4QCIA 5JDJA 1J1PL 2QHRH 3FN0L 4MVBC 1H35A 3QNYA 5BVJA 2C1PB 4PJ9A 2MHAB 2VXTL 4OV5A 4M7LT 5FUCE 1MEXL 3PGDB 3QIWA 1P6AB 5D71L 3IYLW 4YBLC 5ACMA 4PJCE 5BZDA 2NY6C 5J4MA 1P4BL 2BMKB 4WCYL 3V6FB 1ZMYA 4WY7H 5B39G 4RMUA 12E8L 4PB0H 1ZANH 4R96A 2EZ0C 1D5BB 3MGOA 2F74B 1NC4B 3W5NA 2OK0H 5E1HB 5H2BA 3MR9A 2R69H 3HI1A 1QSVA 3DUSA 1MCFA 3OKYA 1BQHG 1D6VH 3UTOA 4GBXD 25C8H 1MFAL 3DTXA 3OZ9L 3HUJB 1S7SA 5TPWL 4K7PY 1EHAA 3SGJC 5MERA 1L6ZA 4XNQB 3ARBA 2HJKA 5DD3H 3VH8B 1ORQB 1GGIH 1UCTA 1F4WH 4BK5A 1E4WL 3LEXB 3K1DA 2Q76A 3WUZA 2PCPB 5KW9L 1CLOL 2IANA 1CDGA 3H9SA 3RU8H 1EJOH 1R5WA 1KENL 3ME0A 5DJDA 3H8NA 2WIIA 3ZSTA 1MHHA 3KSQB 3N1FC 3QCTL 3SDAC 3WFBL 1HHKA 3TBTB 3O11A 4FQXD 3O2VL 5T3XD 4M7LH 4RIRB 2BB5A 3GRWA 5KBNC 3U36A 3P9LB 1A4JB 1H39A 4KY1L 1CZ8L 5D7IE 2A6KB 4OZIF 2D9QB 2XZZA 3KDMA 1SEQL 4MWFA 4OGYH 1FAIL 4GW5B 2HT2D 5CMAA 1BZ9A 1HXYB 3T8XA 1OT2A 4KH2A 4I77L 5TF1H 1N4QB 1VGKB 5LGJB 3S9DB 4XCCH 4EUPG 1N6QL 3PWUB 1CIUA 3OXRA 3C9NA 2Y7QA 4HUUB 1YEHL 2BJMH 2ITCB 4QY8B 5AZ2L 4Q9QL 3S35L 3LN4B 5HHPA 3LKQA 1CFBA 4OD1L 4XBPA 5D6CA 4KHXH 1H8NA 3RHWK 1RUAL 2F54D 2GTWB 4R97C 4X4ZA 4PUBL 3GSVB 3QUZD 5TFSL 5KZCB 3ZDZF 3PWPB 2W07A 5EIVA 3BSZH 1F4YH 3EFFA 4YXKL 5FOBA 3FO1B 4LPXA 2VDQH 3A6CL 1P84K 1UYWL 1FFPB 4X98A 2D7PA 5DO2D 2PETA 3QO0A 1P7QA 1LO2H 1FL5B 2D7TH 5DVNA 3T2NH 5CCKH 3NIGF 4Y16D 4XP5L 3ZE2F 5F6IB 2X4NB 1JPFB 2X09A 4NP4H 1L0YA 2XN9A 2VXVL 4BSVA 1MHPL 4DKDC 4Z76A 1R3JA 3O6ML 4HKJA 3OKDB 1F6LL 4PRAB 1VFBB 3QQ9D 1DJSA 5CEYA 4F33B 1FJ1B 1AGBB 1W72H 4FP8H 5DHYA 3S35H 2YK1H 4TSAL 3BN3B 4FQJH 4H5SB 3ABZA 3BIKB 2C7UB 2AVGA 3KLAB 3CFEA 1JHKL 2Z35B 4K7FB 4IJ3B 4KZEH 2DM2A 5L0QB 1MCLA 4XVJL 4WWKC 2VH5H 1HYSD 4PJXE 4NO2B 5EPMB 5SV4A 5FUCC 4FFYH 5D1ZA 3GSNA 4Q97A 3BZ4B 3ALXA 4PJFB 3HAEB 3ROOA 1IGTB 1V3JA 2HG5B 1X5LA 5C0FA 3CXDH 4WGWB 2B5IC 2RCSH 1OF2A 3I85A 2W60B 5C07D 4F7EB 1F8TH 3MLYL 4L3ED 3F7PC 5I18L 3VGAB 4TSBL 3NFNB 1IVLA 4N8VG 2Y4SA 4NQVA 3QQ4A 4GLRH 1A6VH 2AJSH 5KVEH 5C2BH 4LPWA 4NWTH 2IPKB 3DARA 2YMXH 4TULL 1RQ5A 4PBWD 5F6IC 2WINB 4Y1AA 1J1OL 4ZH1A 1N3NB 1RIUH 4YHPA 5D7LB 4OZHB 1WIOA 3GO1H 4AQOA 5BZWA 1F4XH 1FBIH 4Y16B 4U1HA 2FJFA 2BVYA 1YYML 5EA0L 3HE7D 4BQ9A 4DZ8A 2AEPL 1R3LA 4PRBB 1KCRH 1QQDB 1QD0A 2F54A 4U6VH 3VDAA 4N0FA 1G0YR 4P2OA 4CU8A 3G6DL 1UB6B 3PL6D 4UILH 3RBGA 4BH8B 4ZFZB 1Y0LB 2J8UB 1KCSH 5CSBA 2A77H 4NQCD 4U1GC 5HYSG 2AJVL 1H3CA 1YMHA 2E6PA 4WWKB 4HGWB 1IAMA 3VA2C 4O58L 2OJEB 2MSPA 3S37H 1EEZA 5HD8C 4YX2H 1VDGA 1M1SA 3QH3B 5E5UB 5GPRA 1PX3A 4FNLL 4GKNA 1EUTA 4MJ6A 5FYKL 5GIRB 4LBEA 1TETL 4Z6AT 3ZKNC 1F00I 3P4OB 4G8IA 1JHLH 3KS0H 2RCSL 4XNZC 2C1PA 4K94C 3ELAT 2DQIH 4WNQB 1NBYB 4WFFE 5B3JF 3PGDA 3RDTB 4ONGL 4LLAA 3D39D 1KEML 2NLJB 1JGLL 4O02L 4U1SA 4XNXH 5IGXL 3GSNH 2FR4B 4RQQA 3O3AA 4UT9L 1DBML 5LQBH 4K3EH 4X4YB 1A6PA 3UTQB 4W70A 3TWCL 2WBWB 5D7LD 1NC4A 4P59H 2C3GA 2J6EH 3SY0B 4DN4L 4YDLC 2EDDA 3IU3B 4FMFA 3LRGA 1D6EA 4JGUA 3WFDH 4WW1B 1GXNA 3S6CA 3BYTA 3QULB 3VMNA 2N56A 3IRZA 3VXMA 4F7CA 4JRYA 5HVGB 2EDBA 3CLFH 3K0WA 2IAMA 3VJ6B 1GGUA 4Z7NE 2DI8A 5IFHL 5ITBH 4WEUD 3RFZC 2YUVA 3KLDA 5D1XA 2BNRE 5JLZB 3U4BH 2C3HA 4D9QE 1GSZA 3H9SB 5DMKB 4KGJA 2C4FT 5LXGH 3OHXA 2P5WD 2X5PA 2XZAL 3STBA 1MSPA 3SGDH 2HP4A 3U2SA 1KPRA 1CVSC 4R2GB 1GL4B 2VXQH 3SE3A 3BO8B 2E7MA 3DX9B 3F6IA 4ZYKA 1A02N 1A6TB 1O6HA 4BQ8A 5DI8A 3S37X 2GHWB 1A21A 1UKSA 3EKCA 1RUQL 4PV9B 3RI5F 3QZWA 3QDMD 2X1XR 3O8XC 4LLUB 2P5WB 4HUKB 5HHME 2R2BA 3PWUA 4HMDA 1KF9B 4ZUTB 1I7UB 3FHAA 1T5XA 2PTVA 4U49A 5IG7A 5JW4R 1TXKA 3WMSA 4RAUB 1TFHA 2BOBA 3WNMA 4NRYA 1U6AL 5D6CB 3JV4A 3QUMH 1R6VA 1CFVL 3GHEL 1OTUD 5HDLA 1DVFB 1FZMB 1EMTH 1X5KA 5EWIH 1UWXH 3L5WB 4HW5A 2I9TA 2WWKT 5D96B 5MP6H 4G6MH 1HKLL 2J5LB 2HJLA 3P4MA 1FO0L 3P0YH 4WUUA 3TO2B 1HEZB 3TEUA 1YUHA 3HZYA 1MCSA 1QPPA 4M7LL 2MKLC 1ZLWK 4XPBL 4XPFL 4P5KA 3RPIA 3IDJB 3S37L 4NRXB 2BNQE 3PWPD 3V4PL 5FYKH 2P8MB 2HFGL 3QUYB 4XXDA 2PMVA 3W0WE 1JTOA 3J7HA 5E94A 4N5ED 4ZAKA 1U2HA 1E28B 2VSCA 2HT3D 5C6TL 1MWAB 3BPNB 1H3GA 5GGSY 3L6FA 1WVZA 1VEPA 5MI0B 5KANG 5TDPB 2R1XA 2R8SL 4X0KB 5IVXF 4BUGA 4IOSD 3LKPA 3TZVA 2CDFB 1AO7D 4FP8L 4HKJB 4YIQB 1HI6A 5JXEA 3PNWA 5CEYB 5EU3A 5IB5B 3RL2B 2I5YL 3PXHA 4M61B 4AJ0A 4I9WE 4N8PA 2Z8SA 3C6LD 1I7RA 4H5SA 2ADFL 2VLRE 5I8CB 1J8HB 2Z35A 1H5BA 3MYZA 3RNQA 4RGNB 1FH5L 1V3KA 2BSED 2GCYB 5EPMA 1FVCB 4NN6B 2CR3A 5DRWB 3TPUB 4OLYL 3BZ4A 3LEVL 3WDJA 1RZJL 3I6LD 5TF0A 4OGZA 4GFTB 4TTDC 4A6YL 1L9MA 4P23C 5MEQA 3MLYH 5DFWH 3OAZK 2FJHB 5E6ID 4Z7QF 2VERN 5C0DA 4IMKA 4LSPL 1CLOH 2UYLA 4KROC 4ZNEA 5C86A 3E33B 4YR6B 4M5YL 5BW7A 5GRJL 4N8CH 3MACL 1QPXA 2Q7YA 3JTTA 4E0RA 3KYNA 5C0RL 4HK3N 1CE6B 3ZDYE 5EBGA 3NIFE 4PS4H 4HV8B 4R7NA 1X81B 1U95B 3P11H 1RJZA 1G1YA 3RVWD 3B5GA 3SKJH 1YEGH 4M3KB 3MLXL 5IROA 2C5DC 4OZGE 1UJ3A 3DXAB 2EYTB 5H94B 4LHUG 1DE4B 2WLZA 4EDXB 2HFFB 5GGRB 2G02A 2EIEA 4CN4A 4U1JB 3UTPE 5D70H 5F7EL 4MQXC 1JL8A 3P0VL 4PRBA 4NM8H 3NCBB 5M95B 1KB9K 1U8JA 3NVQA 2E9BA 4JZNB 4ODVL 1Y0LA 1TQCB 1IAIH 4M4RA 3O3BB 1WCBA 2FBJH 1F8TL 5JW5A 1T2QH 4FHBD 1GSMA 1CWVA 3IDIB 4KTDH 4XNYL 4Q9BA 5EOCL 4DGYL 1OQOA 3GMPA 5GRUL 2EE3A 2YZ1A 3KHQA 1F58H 1NLDH 1GGIL 1LO0H 2ZP0T 4LCCC 1NI1B 1QG3A 3A6CH 4GRMA 5JIHA 4QTIH 1IEAA 1WAAE 2H6PB 2XNAA 4KI5D 4KJPD 5FKAB 3O0RH 4M4PA 4MLSA 3BVNB 4RGMC 2FL5A 4I4WB 4JB9H 4JQVA 5DJ6A 4Z7VF 4IDJL 4JN1L 2YRPA 4Q6IC 4EHMB 3DX6B 4EOWL 1TCRA 4JDZB 2JJTC 1BP3B 4S11A 4U1SB 2APVA 3NCFB 4MMXC 5KG9B 2EC8A 3NFSH 3VXQB 4AH2A 2VN7A 4U3HA 4FFWC 2EDRA 4XP1L 2VLLB 1YECH 1GPOL 3VDBA 3SY0A 1PYWB 1KEGL 4Y4HD 3EOAA 5JZ7C 1VENA 3LZFH 1MJJB 1FPTL 3O6MH 4PGBB 3O6FA 3VXMB 4FXLA 5I1EL 1TNOB 4OUOA 1A22B 3QG6A 4DUVA 5FUZH 4G43A 3KJ6L 1BREA 2BXZA 1A47A 1RVFL 5T3ZH 2I07A 1ND0B 4O4YH 3L5IA 2EIDA 4YX2L 2ARWA 2UWEE 3LQZB 1RZFH 3QUZB 5TFSH 2IBBA 2A6IB 1DUYA 1HQ4A 1K4CB 4HUVA 3DX9A 1QRNA 4ZYKB 1F3DJ 3EZJB 3X12A 1KENH 5C9KA 3O3UN 3UXFA 2XRAH 1FFRA 2A74A 4U1LB 5EFIB 3UBXG 5FYJL 4R4ND 1DBKL 4B50A 5B38A 4G6JL 1U2CA 4D2NA 4ZPTB 1JGLH 1CXHA 4XNXL 4X6EA 3IDXH 3MROB 2P5WA 1NQBA 4NFDA 1JWSA 5D1QD 2VAAA 2Z4QA 2FEEI 3L7FB 4LPVA 4OF6A 1DN0B 4TTDD 5DSCB 2B1HH 2DF3A 3WIHL 4O9HL 5DHVB 4M1CD 4OCSL 1I85C 5ADOH 4LVHC 1GGYA 4P3DB 4RAVB 4YHLH 5L0QC 3PL6B 1TVBB 2NTSP 2Y6SD 2CLRB 3CDCA 1KIQA 1SY6H 1AGFB 3RWGA 3WV0A 3VGHA 1GPOH 9CGTA 1TDQA 5JMRA 3NACH 4G6FD 1WBYB 2CKBL 1KZPB 3MOBL 4JQXA 3ULVF 4RCAA 1JK8B 1TTFA 2VXSH 2CLZA 3H3KA 5D9SB 1OP9A 5L2JB 4NRZB 1YUHB 2P5EE 4PJ7A 4QRSA 3X3FH 1CR9H 3SDDC 4JFYB 3MV11 4K8RL 2H32A 3CU7A 1YEDA 3DUUB 3MO1B 4ETQB 3JXAA 1NFKA 1LK3H 4OCXH 2X7LA 1OARH 3TJEH 3UCRA 1UZ8A 1YQVL 4GTOB 4JANB 4JG0L 5GRUH 5CUSL 2XV6B 5E08H 3QUYA 4LIQE 3BKJH 4OF3A 3LD8C 1C7TA 4Z78B 4ONFH 1SVZA 5E8EA 1DFBH 3MA9L 5HVHC 4EI6B 2PNDA 2E6JA 1A7QH 1XF1A 4YK4B 5EO9A 1G9EA 2E6QA 2VQTA 4XC3L 4K3JL 5ESQB 1IQDA 4LLVB 2FEDD 2X2YA 4WI7A 3V6ZA 5D7JA 1JFQL 3MBEC 1LGVA 1LWRA 1INEH 1JTTA 3QDME 4KKLC 3FB6A 4XP1H 1CICD 2DQCH 2VR9A 4NQCA 2VITB 4GBXC 1FFOA 5EU6D 4HDIA 4JJ5A 4Z9KB 4PIRF 5J3HC 4NC0B 5DVKA 5FO9B 1LTXB 4ODTH 3KPSA 3KPTA 4RAHA 4KMTH 1A0QL 3GBMH 2ATKA 5IOPA 3HE7A 3NABL 1C8PA 1OGTA 4M03A 4APQC 3RX5A 1VACB 2IQAA 3LV3B 4QHNB 2IBZX 4JY5L 1B4RA 1EO8L 3QJFB 3FOMA 1WEJH 1UC6A 4YK4C 1JZ3A 1UJTA 3VXSE 5FGBC 4TSCH 3ARGC 5CGMA 4UAOB 3X17A 4NHCL 2Q7YB 3L3JB 1WEJL 4S1QH 1JRHH 1KJMA 3KPOA 3EO1B 2A9NL 4HV8A 5KSBB 1U95A 1QFOA 3HG1E 4NBYB 3HZKB 1PJ9A 4PRHA 4C56E 3D25B 4Q2ZA 3JWOC 5FF6A 1HILB 1MIMH 3MMEA 1C5CL 4J3WA 3OKMA 3AM8A 1TJGH 1EVTC 2IH3A 1A7BA 1MELA 5CLTA 4P5TB 2HJFA 5DQ9A 3I6LE 4I8DA 2EYTA 5H94A 4Q6IA 4EBQH 3P0VH 3BHBA 4DKFL 1TN8B 4NN7B 5KTEH 1G7LA 4WI5A 5IQ9B 4K2UH 2XTJC 5D1ZD 1JZ4A 3OEDA 1BD2A 3GI8H 1K5NB 3BQUD 4JFZL 1KBGL 3UTTD 5DRZB 4MXWL 4GG8A 3VXSA 1KCVL 1S7VA 2D7QA 1WBZA 3ULUH 4OSUL 3BZEA 1LDPH 3QUYC 1UM4L 2X6MA 5IK3A 1CQYA 3J8F7 2A73B 5K59E 3TM6A 1N64L 5JW5B 1UKTA 2BVQB 1FNGA 2Z8VC 3KYAA 2NY4D 3GMPB 1DQMH 4GQ9L 3VFNB 1YEFL 4PJ9C 4S2SB 4OAWB 3V52L 2P7TB 3FB7A 1IC5H 5DGRA 3Q1SL 4H26B 3QIWC 4HJGA 1H5BC 4QXUL 4NO5B 5F1OB 4OBRA 2J5LC 4KVCH 1E6JH 1QSFB 1UCBL 2IGFL 4R3SB 4HWNA 5JDSA 3D9AL 5DJ6B 1Q9LB 3I3DA 4OLVH 5TE6L 5BS0A 1QBMH 3EJZD 4M9OA 3BDXA 3H9HB 1AGCB 4NNYA 1A6UL 1G9MH 1VPOH 2AGJH 3MLSH 1K2DA 1ZANL 3ARYA 4GAFB 5DJZA 1H3TA 5BV7C 7FABL 4M6OH 2MCPH 3EOAB 3MFFB 5EUKA 5INDB 3FQWB 3U1SH 2ADFH 3O6FB 3QA3B 1R24B 5J1TC 5ESAA 5K9QG 3LHPL 3FFDB 2I5YH 5A1AA 2OR8A 2DN7A 1U8LA 3PHOB 3THML 3ZYZA 5L8LB 4OFDA 2UWEA 4BKLA 4LFHD 5I1HH 1ZGLB 1AGEB 4GRLC 3BQUB 4DUWA 2DTML 3QPXH 4Y19A 3OGCA 3FZUC 4Y4FD 4I13B 1DQML 4GQ9H 4JY6B 1CGUA 3NABH 4ESKA 2PW2A 2BVOB 1YN7A 2MPAL 1K8DB 4PP1C 2BSSB 1W0WA 2RHEA 2F53D 4ZOEA 5I1GH 1ZKAA 4I3RL 2P5WE 5HHMB 4FA8A 5FGSA 3CZFB 2NY7L 1K8IA 4K3HA 3NPSB 2VR4A 5ADOL 4ODXA 1UEYA 5L7XH 2GYSA 3L3IB 3FO9B 2OL3A 3MNVA 4D0CA 1OW0A 1TVBA 2ZZUT 1OAYL 5F9OL 3VFTB 4XMLL 3WEXB 3HMWL 2NX5D 3TT3L 2PO6B 1KELH 2OP4L 2XFXA 5D72H 3C09C 2NY3B 3KNBB 4JRXD 5D4QA 4GBXA 3QIUA 3SDDA 2WQRA 3QXTA 1SJHA 1E4XL 1H9VA 4R4BB 2DDQH 5IKCB 4PJ7B 3VRIB 2XQYG 1OAKH 2KQNA 3CPLB 1CXLA 3DUUA 4OTXL 1ZA6A 2JJSA 4DZBA 4XRCA 2P43B 3E30B 3WNOA 1H3BA 3HC3H 5I15L 1P5UA 1PZ5A 2F8VA 1PQZB 2C26A 2XQBL 5J57B 1FFNB 3OJDA 4JO1L 4ISVB 1SVCP 1YEIH 1HE7A 4NQDD 4DCQB 5TE4L 3I84A 1NGZB 3L5XL 4A6YB 5EIIB 4BSWB 1IAII 5KS9B 3FN9A 2LAAA 2P5ED 1Z3GL 2BB6A 1SY6L 5T1MA 2EKJA 4XNZB 1KEGH 3TBSB 3HMXA 3EUUA 5INCB 3V8CA 5BV7B 2CDEA 4MNGE 5BRZD 1G7JA 3HCVB 2WP3O 1R5VA 5FAAA 5E6ZA 2AJ3A 1KNOA 2X1WL 2R0LH 1XR9A 2EEAA 5IB1A 1XZ0B 4H8WH 5DD1H 3G08A 5GSVA 4L3AA 4JRXB 4QRTA 5T3XH 4XMPL 4XP6L 4YFLI 4TQEH 2H3NB 5IOPB 2APTA 3T0VA 4HGMA 4MA7L 4X6CF 2AQ1A 3CAFA 1YQVH 2W0KA 3VXRA 1E0OB 3RWDA 3LV3A 1UACL 2W92A 5BQ7A 2BCKB 2YBRA 5D2LA 1QHPA 3MRCB 5IMKB 1W0YT 1CDBA 3CJJA 5F7UA 2A38A 5BJTB 1KYOJ 3GMQB 4LPCA 1XGRB 4MHHG 5J6HA 1JCSB 4NKMB 3RUGA 3VFUB 1XGQA 5B38G 4CW1A 1UQSA 4Q2ZB 1HILA 4J3TA 4YDKL 4AEHL 2R0ZH 1JUFB 3OKMB 1KB5H 2X9WA 3GUTB 2XWBB 3UTSD 1FNHA 3M45A 3WFHB 3TH2T 1S7TA 4YAQA 1YA5A 2I60H 2YWYA 4U6XA 3IXAA 2B4CC 3UYRH 3QDJB 5F9WB 3QI9A 3K2MC 5ITFA 1K5NA 5D2LF 2UZYB 4OKDA 5DEFA 1FNEA 5E99L 4XPAH 2YS4A 3MJ9A 3QHFL 5CAYB 1S7XA 5ENWA 1OPGL 4LSVH 5SX5K 3WIHA 2OQJA 1YYMH 3H6JA 2DRUA 5TH2B 3ZDXE 2J88H 3BAEL 4X4XA 5A16B 3VRJB 3MRJA 5T1KD 1IGMH 1NLBL 3AS2A 3B2VL 4H1LB 3SDYH 3TNNB 1BOGB 1RVFH 1EFXD 4R7DA 5DZNA 1BZ7B 2P7TA 3FB7B 4TVPE 3OXSB 4UUJA 4O58H 1T2QL 4H26A 4HJGB 4UBDD 4Z95H 4XZUA 1KC5L 3HPLB 2JJWA 3ZT7A 1U91B 1DQLH 1RZKH 2ZOKA 5T3ZL 4I0PB 3RIFK 3IAGC 4DGYH 4HIEA 4K9EL 4PJ5A 4BZ2H 1AQKH 4NDMB 4JFPA 3VXTB 3Q6GH 2C3WA 1Q9LA 2VWEE 3PWVB 1XEDA 2VQUA 4I6OA 4FOMA 4YGAB 1AGCA 5L9DH 1YNTA 4JM2D 1B2WH 2G60L 1T03H 1FIGH 1IC7L 2GOXA 4ZPVB 2W9LA 1FGVL 1CXFA 4YQXH 3KPMA 2KL6A 2YRZA 5JHDE 3MJ6A 1OCWL 2DLHA 3AREB 1KT2B 4YQXL 3QWRD 2F58L 5GS1A 4UU9C 1DBKH 3EO0B 3V0WL 1DBMH 3QA3A 3QFJD 1M7IB 4WW2B 3DVNA 3DROB 4DVRL 5HVHB 5L6YH 4KDTC 3BN9C 1U8LB 3GSRA 5DRXB 2BDNL 2XN9E 3SQOH 4OFKA 4F37F 43CAB 4PLJD 1HINH 4U6HB 3OKEA 4BELD 2Y5EA 3D85B 2BNRA 2RB8A 3GMOA 4HIXL 4JY6A 5GRJH 3RZCB 4KQ4L 4D94A 3AU1B 1LHZA 5C7XL 4XHJD 3D5OF 4PJDF 2F53E 2X4TB 4NQDB 5IM7B 2BVOA 4ZTPL 5LXGL 5JPNA 3NOIA 2OR9L 3W0WD 2DICA 2CRMA 1JGVH 1F6FB 5GJSL 4KFZC 2D2OA 3RVWC 4G6FB 1MZCB 1OLZA 4N0YH 4P2CG 3IFLL 2ICWJ 2APFA 3VGEA 4OKVA 2OSLA 4WU5B 3FO2B 1IKFL 5DEGA 3D5SA 4HT1H 1O7SA 3KPPB 2F8XC 4FMKA 5B8CC 3UPRB 3BGMA 1I9RH 2C3VA 2QADB 3ZDXF 4EN3B 1MVFA 4NO0B 4EEEA 3S3PA 1F2XK 1SEBA 5CLWA 1KJ2B 4LPUA 2VISA 4HMEA 2PO6A 1VEOA 4RFNB 5LWYH 1RMFH 1VFOA 3CD4A 1BFOA 1YMMA 5DWUH 1G7IA 2AI0L 3KNBA 3GI9L 4LLQB 4P3WA 2EYRA 2NY6D 5HGAA 4NQUA 5GJTH 3QPQD 1QNZH 2YA2A 3HMXH 1RJLB 3G9AB 4TN9A 4ZFOB 5F88B 3P77A 5IMMA 5IFJA 4QRRA 1BX2A 3U0PB 1FE8H 5DUMH 1QSED 1U3YA 3MJ9L 5JA8B 3ARDB 3HE6D 2YN5A 5J9PA 4MHHI 4GTTB 5C8JA 4RZCA 1XCQA 1N4XH 4Q9RH 1PZ5B 3WFBH 1L4IA 2B2XL 5EZOL 3ZKXC 4DGVH 2FB4L 2M1KA 4MAUL 3BE1H 1ZE3C 1MJ7L 2DKMA 5GZOD 1N4PB 2UY6A 4Y5VC 4M76A 3U82B 2FZ3A 3D18B 5D70L 5M7QA 5SWZE 1N2RB 2VIRB 1FL6A 3NN8B 4Y4HB 3V0AC 1T4KA 3TBSA 2CSPA 4WTZA 8CGTA 2OK0L 2X10A 5INCA 1G0XA 1BQSA 1GGTA 3DYMA 2VJXA 4AENA 2BJML 1GYAA 4JFDE 1H0DA 2QEJA 3DMMD 1I7TA 4R26L 2B39A 2ADIA 3LKNA 3V4UL 4Z77B 1I8KB 4M7KH 5IBUB 2NW2B 3MRKA 3MV7E 3SBWA 4V2CB 2BSTA 1EAPA 4XCNA 2Z9TA 4GTRB 4JKKA 3MUZ1 2GTZA 5FYJE 2FX9L 4HPOH 4UQ3A 3P4NB 4JJHA 2XI9A 5MENA 3MJ9H 2EE2A 3I6GB 3MGTA 5IMKA 4N8VB 1F90L 4UNUA 2BBCA 5EWIL 5AAWA 2WM0A 4ZXBB 2BVTA 4Y2DD 3HMXL 2NY4C 2VUOA 4HFWA 2J12B 1PG7H 1Q94B 4OLUL 5GS2D 4NKMA 4LRIC 4LSUH 3ARFC 2KH2B 1G7HA 1EGJL 2HTKD 4J1UA 1NAMB 4MJIB 4P2RE 2GAZA 3GRWH 3MNZA 5T1LD 1NDMA 4KTYA 4ELKA 3RY6C 3QRGH 2E27H 3WD5L 3VGFA 1NKRA 3PP4H 2BNQB 4R2GD 3RHWF 1FSKC 2ZSWA 5M94B 3OAYK 1IARB 2V2XA 3T0EA 2E27L 4G7YL 4H25B 1TQBC 1N0XH 5F3BA 4NJ9H 4X99B 1N95B 3KQ4A 2LABA 2P8PB 4BFGA 4UZGA 3ROLB 1X4ZA 4L4TE 2LTQB 3DYPA 3MBXH 3L5HA 4WY7L 3VRJA 3PHQA 5D8JH 5A3IC 1NL0H 4IDLA 5J11B 2DKUA 3WBDA 4H1LA 1HOCA 1P69B 4M8VA 4YNYB 5DJ0B 4R7DB 4JY4B 5ERWA 3RKDC 4KROB 2NY2D 4MNQB 4HUXA 3QEQE 3QUMB 1CGWA 2V7HA 1V7MH 1W0VA 4JO4L 3HPLA 2W0FA 4PJAF 1NAML 5DUML 3JUYA 4RMSA 1KFAH 5E00A 1JF1A 3FQXA 3MRMB 2NYYD 3PWVA 1RZGA 3MRGA 4PREB 2I60L 4OZFG 4ALAL 4NC1C 4UT9H 3SKJL 1TJIL 1WQVT 1MHPH 2YEZA 4PJCF 3SKOA 5IJVB 4PJBE 4MAYD 5GS0C 4LVNB 4GAYB 3RGVB 1Z2KA 1XR8A 2Q6WA 4GRLB 5K9QI 4IRJA 1NUNB 4YH6A 2GY7B 5CS7A 1FBIL 3B9KA 3VFSA 5BXFB 5DDHB 1HYSC 1GC1H 3D85D 4I1NB 4WCYH 3HC0B 2W9DL 1AFVH 1D5IL 4KZDH 1JGEB 2J8UF 4CVXB 4QXTB 4NZUL 3LB6C 3NZ8A 4LDEB 2BSRB 3PWNA 3HUJF 4HJJH 4M6ML 3Q2CA 3MCLH 3VXOB 2OMBA 1A14H 1A2YB 4Y4KB 3D85A 4CJ1A 1JCQB 4EUPH 5CUSH 2CLVA 2OM5A 1UZ6F 1NJ9B 3P2TA 3QUXB 4POUB 1AH1A 1ZVHA 4ODUB 4L4TA 1IFHH 3ULUF 3O41B 2DL2A 2EIBA 1RI8A 2CIKA 4KAQH 2EXWD 4KU1A 5KVDL 1RIVH 4OFYA 5B4MD 1L7TL 4WU5A 2Q20A 4HGKC 4HHAA 3CVHH 4JQXC 2J6EL 2VO5A 2VOTA 1C5AA 1MCEA 1JHTA 5HI5C 4OD2A 1MREL 5CZVH 1WZKA 5JHDB 5HGDB 3KGRA 2C3VB 2EO1A 4EN3A 4PJAE 4NGHH 1F6AA 1PVHA 2GKIA 1LO5B 1YEKH 2XKNB 2B8OT 1QSZA 5D1ZC 1RFDH 4O2EB 4Z7QE 4QT5A 5IEHA 3AY4C 4RBPK 3S3SA 2WBJC 4NWUL 3TH4T 3RZWA 1MCWM 4J3VA 1ZGLP 4F7PA 2CIIB 4S1DD 2XKUA 1N59A 3E6HA 3KG5A 2NXYB 4NZJA 1RJLA 3ETBF 3VWKC 5K9KA 4P2QB 1G6RB 1ZVYA 3N9GH 3H0TB 4CNIA 2VR5A 3DIFB 4GH7B 2CGRH 4KQ3L 2XTJD 4LVEA 3X11B 1B9ZA 2Y36H 3TA3C 4XAKE 4U31A 4X9HA 5JIKA 4O2FB 4P46A 4TQEL 2EE9A 1TTGA 1RZFL 5F6HJ 1R3KB 2V5MA 1ES0A 2ENYA 3BKYL 2LE9A 4FXKA 4OIIH 3S7GA 2YXFA 4LRIA 3M8OH 4BZ1L 1I9RL 3MLUH 2MHAA 5FXCH 2DQDL 3TVMA 5TGBB 2FZ3B 1ITCA 3D18A 2YD6A 4AT6A 2IBGA 4OZGB 3GSNL 2X4UA 1I75A 3LQMA 2ED8A 4R8WH 4NNPL 3S4SA 4LSQL 1OWWA 4PTTB 5D2LE 3DSFL 4UU9B 5FK9A 3VRLE 3BP7A 5C08A 3EJYC 1D5BA 5EORH 3DSFH 4LCUB 4PTUA 4EKXA 1DZBA 3D69B 4MNQD 4LPYA 4N5UA 4M6NH 5LBSH 3K3QA 2YD1A 1BVKA 3MRKB 1QRNE 3WJLC 4FG6C 3DYOA 3DVIA 2R9HD 3MOQA 4JPIB 5MERB 4AY0A 5CEZE 1U36A 2HJKB 3QPXL 1IGML 1NLBH 3Q1SH 5C0AE 3JWOL 2PUQT 3HG1B 2CK0L 1GGCL 2D03L 3MV9E 4OLXH 3SDAD 2A83A 3DETC 5CSGA 4ZXBA 1EXUB 2NQCA 3RI5K 1HYRC 4LK4A 1RSFA 4CGTA 5HHNB 4AIZA 5ICYB 4Z0XB 5HYFA 5E03A 4Y5VA 1DP0A 1G7HB 3BZFB 5IW6A 4MVBD 2C3XA 1CR9L 1N5AB 2ZISB 3MRBA 2IH1B 3LRSB 2R2EA 1HSBA 1K9TA 3EYFA 1K4DA 2CRZA 1WWWX 3AAZA 5JUEH 4LEXH 1S7UA 4HZLA 2FCBA 3VGGA 3KDMB 2AJZA 4HW6A 4EUPA 3GHBL 4IOIA 5ETUB 3T8XB 1NBQA 1N4SB 4NPYA 4JREB 2V2XB 2VLJE 1R3HB 2AJSL 3TESA 3HTLX 4M6OL 4Z7WF 3TH3T 2W1NA 1Z5LB 4L8SC 2VN4A 1I3RA 3BP6A 1DBJL 1MPAL 3D3VA 3RL1A 3RJQB 3LKQB 1T1WB 1QNZL 3FQNA 3N1QC 3QUXC 2I27N 1ACYH 1CLZH 5FO8B 2PW1B 3GJEA 5E2JA 2WMPA 5EUOE 4DKEL 3VFWB 4Y8DC 1YMMD 2NZ9C 3SQOL 3GIVA 3KYMB 4OFPA 1OGAE 3UBXI 2WANA 4ZO8A 3IDGB 4L3EB 2BHUA 4KJYA 5IEKA 3MRRB 1IC5L 1S7WB 3ARFA 2V7HB 4CVUA 2ZUVA 3DI2B 5JTWA 5FOBB 3N9GL 1ONQA 4GAJH 4Q58C 3QDGB 2GW5A 3GBML 3SGDI 2VLJA 2ZCKH 1KTDB 4QKXB 1ZLVK 5C6WH 3GM0A 1KN4H 4ZS7H 4F9LC 1P7QB 2JB5H 4NQEA 2DLFH 3CXHK 4M48L 3GSUA 4PREA 4OJFH 5EUOB 2ORBL 2AXGB 1RPQA 5KJRH 1QSFD 4HLZH 3V6BR 2X4NA 1WBXA 3NMEA 3VFMA 3MRNA 2HYMA 1QBML 3P30L 3U83A 3BOVA 1X5HA 4Z76B 1R3JB 4CDGC 2GSGA 3E6FB 4GRLA 1FVEB 4RGMB 2FJGB 1FPTH 1MCHA 4DKFH 1KJ3L 1D5ZB 4I18B 4TOYL 4JFQA 2I24N 4KVNH 4LMQE 2VDNH 1OTUC 4FZEL 5J1SC 5IB3B 4PR5A 1TJGL 4PJDA 1G1CA 1NFDF 1S8DA 2ZUQB 4Z0BH 4L4VA 2OL3L 3U79A 3KLAA 1OTSD 4OZ4A 5GHWH 4F9PC 4PPTA 3GEWB 5TDOA 3QFJE 4TNWF 4E41E 1DL7L 3H3BC 4FZ8H 1NGYA 1KZOB 2L7UA 5C0FB 1MRCL 2JELL 3EJZC 3UP1A 4QRPD 1F4WL 2QL1A 3IFNH 4O5LH 1MCBA 3ARFD 5DD6A 4DFHA 4L4TB 1CGTA 3MCKB 4D3CH 1TVHB 5IR1B 4XPFH 1J0YA 3A67H 4X7DC 3WFEH 4NQVB 4R0LB 3FN3A 3DECA 3QEUB 1L6XA 3IJYB 5DJ8A 1AHWC 1MH5B 3ARTA 2FO4B 4MD4A 2X40A 1A9BB 4WGVB 4WUKL 3V6OC 5HGDA 4LEXL 1P4BH 1LO5A 3C6SA 4PGDB 4OLVL 5TE6H 3T3PF 3FT3B 4NM8L 5IEHB 3BD3A 4CU6A 3C72B 5IWLA 5GGUB 2GJZB 1UM5H 5J13B 1ZTXL 4O00A 4F7PB 2GJ6D 1NSNH 1MRFH 4NKIL 1J0HA 2CIIA 3SCMD 4P3CH 1IZKA 2H45A 4LCYB 1N59B 1IEBA 4JVPA 5F72S 4FQLH 4HC1H 1JMZA 3ZKMC 3OTTA 2WWMC 2Y5TA 4WHCA 3RA7H 4NN6C 1XGTB 3IJHB 3UJIL 4A6YH 1X6LA 4P4KB 2X1QA 4G8FA 5EOCH 5IIEB 4Q0XL 5DJYB 4NOFA 4OCWH 1MJUL 4X7EC 5BOPA 4U1GB 1S9WA 4WNQA 2QQLH 5FYJD 3TVMB 5F97E 3T0AA 3PWLB 6CGTA 2O5XH 4OLWL 4PJHA 2X4UB 3CVHL 3O3DB 4M48H 3AMLA 3QB7C 4POYA 3QEGL 4AEIL 5FA3A 3MLXH 2WBJA 4HSQA 5C0NC 4Y8AA 2X4OA 4AEFA 3Q5OA 2HVKB 2FIKA 2M2DA 2EXYD 4MGXA 2NY2B 3QCUH 4YDVB 3SKMB 4L8DB 3EFDL 2OZ4L 2I25N 4LEOA 1Q0XL 3RVVC 2X05A 2DIBA 4JM4H 3B3IA 3QG7L 4PJGF 3ZL4H 4G6KH 3I02B 4RISL 2PR4L 5KANI 1KB5A 2XWTB 4X7TB 4JQVC 3EGSB 3HXCB 3LKRA 1YZZA 5T3XE 1Y6MR 3V0VB 3HG1A 1AD9A 2LU4A 4TSCL 2W65A 2QQQA 1U8IB 1JHLL 4XNMB 3BISA 3X3GL 3DO7A 4Z0XA 3QDJD 2PYEB 5T5NG 4WV1C 1E6OH 3A6BH 3WKMH 4RFNC 4QRUB 1N5AA 2Q3AA 4EDWL 4YXLL 2FYYB 1U8QA 4NBZB 1NH6A 4P49A 3EYFB 5I1AA 5I75C 4UT6L 5TQ2H 2EDWA 1YEIL 3KPRB 4HCRL 4LHUD 2WLYA 2D0HA 5ETUA 4TVPL 2DLEA 2DIAA 4NPYB 2MNUA 1EV2E 4GKZA 4LNGB 5E24E 3FZUD 2VDLH 4Y4FC 1LO3L 3EDDA 2JTDA 4WWKD 1UB5A 3VW3L 3RBSA 4J6RH 1SBSL 4ODBD 5EOQL 1T5XB 3QEQA 1Z5LA 3GIZL 5ACZB 3CZJA 1ZHKB 1HZFA 4WHTA 4YDJA 3QSKB 2AKRB 1DR9A 1T1WA 3JWOH 5AUMA 3MRDA 3QXAA 3ILPB 5I17A 2DJ4A 3HXFB 1KOAA 1HK6A 2HTLD 1JN6B 5EU5B 3VFWA 4WO4A 3CSPA 3GIVB 3KYMA 1D5XB 4OD3L 1NMAL 3TT3H 3MBED 2XZAH 4WEBL 3HS0B 5BVPL 2HMIC 5IEKB 3PDGA 3BXNB 3IS0X 4M3JA 1HEZA 3V6OE 1MFDH 4OLEA 1FC1A 4KRPD 3QDGA 3GGWB 4L29A 2VLJB 1LP9F 1ZSDB 4QHUA 1EEUA 4S1RH 3VXME 1JZ6A 4HUWA 5EBWB 1RUMH 3PQYB 2NCMA 1O1RB 5HHQA 5HYEA 5DXWA 5EU6B 1MFNA 3GSOB 3TVMD 3HI5H 4JM2F 4IRZL 5IV2A 5E94B 2H32H 4X9IA 4XH2A 4XCEB 1CFSB 4FQPA 2NXYD 1DLFL 4NKOB 5DF0A 2PF6A 5GRXG 4ZUSB 5TDPA 2E7LC 3MLRL 1I1AC 4KAQL 1MREH 3E6FA 1D5MB 2HLFC 3NGBB 5DFTA 1Q9KB 1D5ZA 5ELIA 2XRAL 1HI6B 1WZLA 1I8IA 1DLHB 3PNWB 2EKSA 1A3LH 4FQ2H 3T65A 3TPKA 1NEZG 3TWCH 4PJEA 3C2AH 1ZVSB 4YPJA 1I7RB 5JHDD 2J8OA 1AE6H 5EULV 3RNQB 3HLAA 3PZ2B 3O4LB 2OTWA 4NM4H 5IBTL 1I9EA 1CLZL 3PQYD 4HPOL 4DW2L 4LIQH 5DZOA 2GCYA 5I73B 3RWHA 3AB0C 4NIKB 1W6JA 4XPBH 5FA4B 4PY7B 1NGYB 1DQJA 4NZUH 2V17L 3LH2L 2CUHA 4HK0B 5KSAA 4NCC2 1U92B 3TN0D 2VL4A 3DJ9A 1XFPA 3ARGA 2Q8BH 1TTUA 4IRSD 5E95B 4CVWA 5I1JL 3F5WA 1BZQK 5GGQL 1Y18B 4QEGA 1I1FA 3DVFA 3QXVA 4N0UB 4YC2C 4Z8FL 1QFUL 2HVJB 1HDMA 1SM3L 3IXTA 4XHJC 4OFYD 5BS0D 4ONHB 4RSVA 2KUTA 4P4RA 1ZK9A 4F37K 4DFIA 1DFBL 1UJ3B 1FGNH 1IAKB 3DXAA 3PL6C 5IW3A 1NCCH 3ZHKA 1T5WA 3OKKB 1DE4A 4YUEL 4EDXA 5D7LE 5E8DH 4AEEA 1UA6L 1AO7B 3FT4B 1QR4A 3T0ED 1RU9L 5GGUA 4G8EA 3CUPA 5HDQH 3MLWH 4Y5YB 5B21A 1YMME 3IAQA 2O61B 4X6BB 2VDOL 1HHGB 1MQKH 1J8HD 5KN5A 4PRNA 2B5IB 3UX9B 4MSWA 35C8L 1DUZA 3D5RA 4KMTL 4NKQB 3OB0K 1PG7L 2NY1B 4ZMAT 2H6GB 4DK6A 1AXSB 1LE5B 4IRJD 1FZKB 1BIHA 3QDGD 2FEDC 3IKCA 2ZOLA 2BDNH 2VB5A 1IILE 4XAKD 5FCUH 5F7DB 1EEQA 3RVXC 3LMJH 3KJ4C 4HWJA 3H9ZA 4HUNB 4MLIA 3REVA 2Y06L 2MCG1 1EPFA 1S9WB 1IEAB 2H6PA 2WNGA 5GRVL 2OYPA 3MQIA 4Z7VA 3DHMA 2NXZD 1I3GH 5AEAA 4P23D 3GSWB 5JUEL 4LQFL 3R0NA 1LO4L 1MAJA 1AC0A 1MUJA 3SQBA 2VZ1A 3SDCB 5I8EB 3MTRA 4LNRA 1LO4H 5I71B 5DK2A 2MWCA 2WIMA 1PYWA 5E9DA 1RZIB 2XOTA 3SKMA 4LEOB 5CP3A 1TVDA 5HYQA 2NTFA 3OKNB 5DD0H 1ODAA 4U0RC 5ADPH 3PZ1B 1OAQL 4WV1B 4GW4A 4BOKA 1KB5B 2XWTA 3VI3E 5EC1A 4Y4KD 3D48R 3W82A 4BA8A 4EJ1C 3L3KB 3LKRB 4U4BA 5ESVB 1XF3B 3IFOA 1CFNB 1MPAH 2EH7L 5FV2A 1CFVH 3FTGA 5JW4Q 4PGCA 4OM1H 4OTXH 5FEBA 1I9IL 3WE6A 3DX7A 3EDEA 3OSKA 4U3CA 5JPMA 2DLIA 4QRRD 5I66B 3HG1D 3SPVA 3BI9X 4L8SB 4R4NC 5LG1A 3VXPA 1VCAA 3PJSA 3T2QA 5CJ5A 1RUKH 3FMGH 2HKHH 3DSNA 4PJGE 5D7IA 3QUYD 3S5LG 5B38B 3QNXA 1FLRH 3QNZB 5F3HA 5AWNH 1A9EA 1FFQA 1VADA 4GKZB 4KKBD 3FRPA 2X1PA 1QR1B 3KPQB 1IE5A 2Z4QB 1MLBA 2R23B 1UB5B 1QSEB 5CSZA 5EBMA 3TFKC 3QEQB 1SYVB 1VERA 6FABH 4C54A 1ZHKA 4WHTB 1KCKA 1NFIA 4YDJB 2WBJD 4RAVA 2DIJA 4WO4C 2H2PC 2VQ1A 3LS5H 1OT1A 4X7CC 3WL9A 3I50H 1E4KA 1RK0A 4UB0L 3S88L 3UAJD 3H7BB 1U8HB 5DVLA 3VD3A 1JK8A 3S88H 4YO0B 5DYOB 4KTDL 4ZO7A 3VWKA 1T3FA 4ELMB 1SMAA 3SDXF 1J0JA 2R2HA 1MHEA 5D7KE 5IB4B 4QHUB 3G6AB 3U7WL 1YNKH 1UG9A 1VFAA 5I74B 1UZ8B 1FVDA 4JFFA 4JANA 3E0GA 4X4MA 4L9LA 5DK0B 1O5MB 5IV2B 2BK8A 4X5WA 4CADA 1XIWB 2PTTA 1CFSA 5ICZB 5K9OA 4HD9A 5FM5M 1FO0A 4NKOA 3GRWL 3FB8B 3MX0A 2GJ6A 3B8YA 3UJTL 1D3CA 1MF2H 5C0EA 3RGHA 2F5AH 2FH8A 5L8JB 1YPZE 5ESQA 3T4AA 3O4OC 1PX4A 1D5MA 5F7FA 3SJVD 3DURA 4BOJA 2IANE 3O3EA 3V6ZB 3C5ZD 3P11L 1KN2H 2LU3A 2O93L 5DQJB 3WNNA 3T65B 1Z3GH 3RWEA 3NIDF 1FL3A 1AKJB 4NSKB 4XXCA 4YHZH 5DMJB 2IMMA 4FS0A 4HEPG 4HDIB 2EIZB 2L7JA 4WFGE 5DLML 4X83A 3ZDZE 1A14L 4L8CA 4JDVB 1S3KL 3ZYJA 2V17H 4O2CB 1P2CB 1GH7A 5FA4A 5HYJB 5BMFL 1S9XA 2Z91B 4R9HA 3O4LE 1KC5H 5HDBE 4YHYB 5EZJB 5CEXA 5IMLB 4HK0A 5KSAB 1RULL 2A9ML 3VFOB 3K1KC 2DQEL 4AMKL 4H0IA 2C4FU 3SHSA 1ZT7B 4LP4A 1I1FB 4H20L 4TUOB 1MVUA 1HDMB 1DVFD 3AY4A 4OGAD 2ERJB 4DKAA 1GOHA 4ODWB 2VKWA 1RJYB 5EU4A 2COQA 1A6AA 4ZOAA 3U0WL 2LVCA 3IF1A 1XF2A 4Q7DA 1LO3H 3ULUE 4J23A 3QI9D 4Q6IB 4K2UL 3SJVB 3KPNA 3LSOA 5KSBE 2VZTA 5T1DH 3CUPB 4UT7H 5C0IA 2AJUL 5EO1B 3PP3K 4GXVL 1TZHA 3ZTNL 3O6KL 3NH7L 4FQCL 2EXYC 2P24A 3C60B 1HHGA 4QCIB 2DB8A 5ALBH 3S8WA 3VFRB 5HGBB 3W5MA 1WBZB 4PJ9B 4MSWB 4OBSA 5KSAC 1S3KH 5GZOC 1D8EB 5BZDB 2R4SL 3DSXB 5EZLB 3V6FA 4Z7OE 1YEFH 4MA7H 1NEUA 4XPGH 4OD3H 4PJXB 1QRKA 3IKCB 2JJTA 2YK1L 3V9FA 1P7KB 3VFNA 1G7PA 1UACH 2OJZH 3DV6A 3S97C 3KR3L 2QSCL 3FQUA 3MJ8A 2DQUL 4QGYA 2A0LC 1FNSL 4U2YA 4R3SA 3WHXA 1B0RA 1CBVH 3SOBH 3ZLQC 1MLCA 1JGDA 1S5HB 4HKXA 3MOAH 5JDSB 4G9DA 4MNHB 4ZQKA 1V05A 3FAWA 3Q48A 1GGBL 4TUJA 4W4OC 1EERB 2NY0B 5C0BA 5A2IH 2QJDA 4L4VE 3NIFF 4HKZB 5CEZD 5KSBF 1KV3A 2Q76B 2CRIA 1MUJB 4GRWH 3D3VD 3RKDD 5LQBL 4MA8L 2AV1A 2IANB 4OQTL 4EBQL 4NJAL 1A1MB 1IGIH 1N6UA 5LGHH 2GUOA 5DJDB 3PWJA 3UZVB 4B5EA 4C59B 4LSSL 2WIIB 2HFEA 1AJ7L 4UQ2B 1EZVX 5HYQB 4CAGA 1BIIB 1A4JA 4YXHL 5L88L 2WWMD 3MV8D 2CKNA 3QAZC 3L3KA 4ZXBC 5EC2A 4JFOA 3PHOA 2ZCLH 2ZKHL 2E3VA 4MWFB 4YEEA 4QXGH 4GW5A 5CMAB 5F1NA 4PJBA 2O5ZL 5MP6L 5E2TH 2AXFB 1KCSL 3ARPA 4JKPL 1NC2B 1ZWIA 4UDUA 3SQCA 2YR3A 1VGKA 4YHKL 5IFHH 5ITBL 2ZUSA 4PJBF 3OGCB 2FHCA 2J88L 3WE6B 3IVKA 3U48A 4LKXB 1X44A 4IS6A 3TCLB 3K8LA 4J12A 4D4BA 4KC3B 2RJMA 1JJUA 2AQ3A 3ZSSA 4UINL 5B3JE 1QSFE 1I85A 3MBEB 5SX4I 4YHML 3ULVE 1XGYL 4H20H 4B0MM 3MXVH 3FAXA 3PWPA 4NBXB 2YPLE 2BVUA 4KHTL 4WHYG 4CVZA 4OCNC 4XCCL 3HQAA 3JSSA 1JGUH 1MJ8H 2J4WL 4KPHL 5CJOL 2R23A 5MENE 4JZOA 4ODXB 3EFFB 4JPVH 2AV7A 3FO1A 3GZKA 5C08D 4TVPH 4AYFA 3HHRB 1S7QB 3QZWG 4UIKL 5L9DL 3ZKXB 3WL9B 3Q7FB 1MCRA 3OR6B 4OGXH 4M00A 3WEXA 2VDKL 3ALPA 4LOUC 3RWIB 5FGCB 3NA9H 3D39E 2PYEE 4F2MA 3UC0H 2DAVA 5HPOA 1K3IA 1M6OA 2BNUB 2N7AA 4FTVA 4LHQB 4M7KL 3SDDB 2EDTA 1SJHB 1QKZH 2HRPH 3NIGE 1F4YL 2XN9B 4W4OA 5GS0L 4HG4J 1LDPL 3V2AR 1Q9WA 4U7KA 2CK0H 3JTSB 5GS0H 2DQGH 2L0DA 4OCMC 5CWSB 1ZA6B 5GSRB 3G6AA 1O7VA 3QCVH 1NBZA 2BERA 2ZWLT 3OKOB 3QDMA 1HSAB 5ICXB 2YPVL 3DI3B 4ERSH 5DK0A 4QOKB 4XX1G 4JKMA 4WU7A 4GAGL 2PTUA 2H6FB 4NFCA 4X5WB 4CADB 4FRWA 1QACA 4LF3A 2PTTB 1A7NL 4JVUA 2X4RA 2JCCE 2R0KH 2AK1H 4IJ3C 3NCJL 4NQSB 1FO0B 4EI5C 1RY7B 3O8XB 1CGYA 5EO0A 5EIIA 1A7RL 5ISZA 1ZHNA 1PEWA 5MEOB 1IGTA 3GHBH 3KYKL 2E7BA 3MZGB 3T4YA 1OF2B 3DURB 1JGUL 1MJ8L 4KPHH 5CJOH 2MCPL 4BH7B 3WIFA 4PJEF 2DBLH 1CDJA 2Q3ZA 4EN3D 5GGVL 4GKOA 4D4CA 1HCFX 2CDEB 3L3DA 2CRYA 4NSKA 1J9CT 4UB0H 1XZ0A 3RTQD 1U8OB 3DNKA 5DJXB 3QIUD 1ZGLM 4JRXA 5J89A 3RZCC 1O0VA 4KKLD 2GK2A 4FZ8L 2NX5A 1BQLH 3BP5B 3F7VB 4YXKH 5F7HA 1OAZH 4DAGH 2DLTA 2VDOH 5CEXB 5IMLA 3UDWC 4LIQL 4YZFF 3SO5A 4HBQA 1INDL 5D7LA 3CXHJ 5DVOA 4QHKI 3RU8L 5CIPB 5DD5H 4GKSB 5FDWA 3M1BA 3WXWL 4DZ8B 2X41A 2BOCA 4MJ2A 1KSRA 1MVUB 3GMQA 1RUKL 3F7YB 2HLAB 2QKIA 3CCHA 5D7KD 5T5FH 2RIKA 1OY3B 1TJHH 4RFOH 2J8UA 3B9DA 4YPGB 5DFVD 2F53A 3HC4L 2YMXL 4N0CC 4TULH 1YMHB 2GT9A 2VZVA 3VXSD 1CD9B 3TIDB 3C87A 3WFEL 1LVEA 4NP4L 4WRLA 2A1WH 3S98A 3KPNB 4O9HH 4ZO6A 4JHWL 1ZAGA 2ORBH 3TF7C 2DMBA 1FAIH 2B0SL 3DBXA 5EO1A 1G9NC 1BF2A 4HQQH 1YPZA 1TZHB 3MREB 4HG4K 3O9WB 5B39A 3RJ3A 5DEFB 1FNEB 1ED3B 4YE4L 5IF0A 1HQRA 5IHZA 4UIMB 1T1YA 2JCCF 1CLCA 1VHPA 4Z7WB 1U3HC 5MEPB 2GITB 4RDQG 2UZIL 1NBYA 2A77L 4NUGL 4RBPH 5F8QC 3RDTA 3B2VH 4X4XB 4NKIH 4P23B 2OXHA 1H15A 3MRPB 4RQQB 1XT5A 2IMNA 5AYUH 4KRPB 3VG0H 2FX8L 1KCUH 4XAWL 4RGNE 1E4WH 3DV6B 5D1QC 5GGSA 1D7FA 3S36X 5A2KH 3DLQR 4MQTB 4JO2L 4OF7A 5I6XB 1B0RB 4AM0A 3LEVH 3HZVB 4CU7A 4F7CB 3LPWA 4HKXB 4NDMA 4Y16C 4A2LA 3QHZL 2AEQH 4MNHA 1JNHB 2H8PB 4ZQKB 4UV7L 3D39B 4R8WL 3K8KA 4U3XA 2XIDA 5C0BB 4HWZB 4ZODA 2IF7A 5C09D 4PJEE 3ZTJG 2R0ZL 3QO1A 1T1ZB 4UOW1 4D0DA 3NFSL 4ZPVA 1CICA 3WIIH 3VXUA 3WJJA 4WI9A 2EDNA 1CN4A 2AABH 5C07A 1A1MA 3UJJL 4XWOD 3ZHDA 4OCYL 2HFEB 4XBEL 4WI4A 4ZD3H 4F7MB 1M71A 3S96B 3U30C 4HKBA 2AK4A 4PJIF 2APBA 4XP4H 1T0NA 5I76A 3BKML 3SKNA 4P5TD 5LVEA 1NMCC 5DRXA 3ZTJH 5F1NB 3NA4A 3ZL4L 1GGCH 3M17A 3MNWA 4GW1B 5DRNB 2NPLX 3UTTA 3O45B 1C08A 1P4LB 1KGCD 2WY8A 4RFEA 4PP1D 2E8YA 4QOKE 1XF5B 2VLMD 1HHIA 1I7UA 5D6DA 1O79A 3GMOB 4Y2DA 5DT1H 1T04B 5IG7B 3IVKB 5E1AB 2EDHA 4D8PB 2ZUWA 4KJWC 4RMTA 1EA9C 5TE7H 3TCLA 2BOBB 1CGVA 1BGXH 2IQ9L 2F8OA 2JF1A 2FRGP 1J0ZA 4L4JA 1T21A 1MIML 4XC3H 4IRZH 1WF5A 4HEME 2CUMA 1P7QD 2AERT 1HWGB 2MPAH 3IDXL 3FO2A 1NMCB 3S36H 5KVMC 4AZ8A 1CIDA 4NZDA 3T1WA 2H1PL 1JMXA 3CFIC 2F5AL 4PJ8C 3RWFB 4QHMA 5D2NC 2AW2A 3QIBA 3RPIB 4PYHA 3ARWA 4KUZL 4NRXA 3OR6A 4FFVC 1KJ2A 1YY8B 4BK4A 1FORL 3CVHA 3KPRE 2IFFH 4XCFH 2P8MA 4KGLA 1GAFH 2AXJA 15C8H 1M6OB 2BNUA 3PDOB 1CXEA 4XB7A 2EYRB 2FO1A 2R4SH 4D0BB 1E28A 4KTEL 3B9KC 1CD0A 3ARDC 1PKQB 3WS6A 1JE6A 4GTVB 4OQTA 1JCRB 4HJJL 4M6MH 3P77B 5IMMB 5IFJB 2R1XB 5BMFH 3ORJA 3NACL 2PN5A 4PRDB 1A1OA 5CJXC 1WUNT 3IGAA 1DDHB 4YIQA 4J4PA 5CWSA 4XMKL 5DC4B 1P5VA 4KKAC 5EU3B 1U58A 3QDMB 1HSAA 2IG2L 2EXWC 5HXMA 3ET9F 4ZNCD 1ZLSL 5C09E 3DSTB 3F58H 4LF3B 3VI3F 4NQSA 4C56B 3MLTB 3I3BA 1LEKA 3CMGA 4MA8H 5ISZB 5MEOA 4RX4A 1EZVY 2PO6D 4N9OB 4Y4HA 2FJHA 5AD0B 1T4KB 3BEVA 1REIA 1CVRA 1D8DB 3WIFB 4PV8B 3H9SD 4P59L 2QR0A 1PDKA 1QBAA 4G80A 3WSQL 3AS3A 3CU1A 2DYPB 4AENB 3MLZH 4OT1L 4E0RB 2F54E 4E41D 1DBBL 3NTCH 3UBXA 1V8HA 1H0DB 2JIXA 3MUGB 4U1NB 2AJXL 2V9RA 5J11C 5DJXA 3NTCL 3Q0HA 1OAZL 2OLDA 4DAGL 2ZSVA 1I8KA 5SWQA 3CDYA 3AMKA 3WN5B 3VWJC 1H3VA 1WZMA 4NHUB 1D5IH 4M6AA 3RIAK 3AXLA 1CFQA 2OX5A 1UH3A 5C70A 5CBEB 4BUHA 1QFWL 3AS1A 1OAXH 5GGRA 4GKSA 1J5OH 1YY9C 3G5XB 4M5ZL 4HJ0C 2H41A 3HI6H 2LVEA 1Q94A 2NY1D 1BECA 3AS0A 1FRGH 3HNTL 4N5EC 3WKNA 4JZNA 2EICA 2ATPA 3MLVH 3KYKH 1A3RH 3MXVL 5E2VH 1CBVL 4J1UB 1NAMA 4MJIA 4PJ9D 4TTGA 4HX1B 4WUKH 2GJJA 1UENA 3D0LB 3ARRA 3TIEA 1KULA 4NQCE 4MD0B 1QRND 3IJSB 3RQ3A 4QNPE 3K81A 1WZ1H 4PLKD 4G9FB 4QRPE 3JWNC 3HB3D 1U8MA 4HPYL 4LFHG 3U0WH 1XH3A 1A7QL 1OGAB 2R2LB 1YPZB 3MREA 4J4PC 5C71A 2OBGA