5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
5FA3B 5GZNC 4HUVB 1FRGH 1CICC 4AEIH 5E08L 4ZH1A 5FCUH 4RQQA 2JIXD 1EZVY 3N1PC 1Z9LA 4AMKH 1TNNA 3EDJA 2OR8A 4F7PB 3HZYA 1R3KA 5DQJA 5T1LA 4R0LB 2FBJL 5DO2D 2J88H 3WLWC 4KHTL 3VGAC 4AIOA 5T3ZE 3HRPA 1JVKA 1F4WL 1EO5A 4HZLB 4G6KL 1LK2B 4KXZH 1HXMB 3W11D 4YUEL 3NACH 1CDBA 4QTIL 3F7YB 2BHUA 1ZLWK 5JDJA 3HFML 3LRSA 1BHGA 4TSBL 4Y0GA 2DTSA 5DJCB 3CDYA 1LILA 4I9WE 4NO3B 1K4DB 4RFEB 5GS0D 3WHXA 3IS0X 5FCUL 4BFGA 4F7TA 1KCLA 1G6RH 4HS3B 5DURB 3RTQB 4S1RH 1P4LB 5DDHB 4PGDB 3LKQB 1RAMA 5HVWA 1ROWA 1F11B 3RJDA 2LTQC 1I3GH 3PV6A 1QA9A 1X6LA 1QSZA 3QCUL 1G0XA 1I1YA 4LSVH 2OBGA 4DVBA 2NTFA 4J23A 3LV3A 4R4FH 3GDBA 4JKPH 5MP6L 2AI0H 5I1GH 4V1DB 2RBLA 1PQZB 2XY1A 1A7QL 3SJVA 2VAJA 5JXED 1DLHA 1TQCC 3PGCA 5DUBB 1TTUA 1JV5A 1JPGB 1OSZA 1TFHA 1MRCH 5CP7A 2FX8H 1MI5D 4DVRL 8FABA 3QRFM 4EDXB 1UKTA 3CDFA 4WV1C 3T1FB 3VFUB 3MJ9A 1DQDH 5DS8B 3TA3B 1CVRA 3GRWH 3KNBA 2JCCF 4J3OC 4ONOA 4EXPX 3O45B 4YGVB 3MFGB 3HMWH 3NZHL 3S34L 1WAAE 4ZFOB 1GGCL 1KELH 3EKCA 3OSKA 2XT1B 3UYRL 5MEND 5DJDB 5EIVA 3WNOA 5D70H 2Y25A 4QF1A 2VLLA 4HK3N 1MCOL 4S2SB 3N9GH 5IV2A 1J87A 2DIJA 1OSPH 5EC1B 3WBDA 1UH3A 4KPHH 4WUKH 4CU7A 1XFPA 3ARPA 1T1XB 4K94C 4LLUB 3FMGH 4PJDA 5T1DH 4XVSL 1OTTD 5HYQB 3RWEB 1FDLH 4ONGH 2C7UB 2PYFA 2F15A 5E8DH 5MEOA 1FG9C 5ANMA 2NY3D 3C6SA 1A9EA 3D0LA 3PXJA 3WE6A 3D0LB 3DMMC 3FHQA 3C5ZC 1GSMA 2ADGA 1NL4B 5GHWL 4QHKJ 2PO6C 3MRPA 3KLAA 4WTWA 2D7OA 2WUCL 1T04A 1U8JB 3SDYL 3QUXC 4N1EA 1JIBA 1XGYL 3QXDA 5C0IB 5CWSB 3H9YA 5EOCJ 5IJKA 4FTVB 1A47A 1RUQL 1WWCA 2A2QT 4LCUA 2BJML 3FFCB 4OGXL 4L4TE 3PQYE 3F12A 4I4WB 2Q87A 1M1SA 2FCBA 4PG2C 2IPKA 4ERSL 3TA3A 5F7UA 4BZYA 4HWNA 5FUOH 1X4YA 5EO0A 3ZKMD 2OP4L 1DSFH 3CSBA 1KTLB 3ILPA 5JNYA 2NR6D 1M6OB 3GSUA 5E8NB 1ZK9A 2EO1A 1F58L 3QWOB 1DLHB 4L9LB 1EGJL 1F00I 4ERSH 4WI7A 4N8VB 1DUZA 3S96B 1KTKE 4M1GL 1BQLH 3QG6A 4G8GE 3ZE0F 5FUOL 1X5GA 3JWDL 3LV3B 4BQ8A 1K5NB 1QBLH 3BD4A 4U1SA 4HHAA 5BQ7A 4XPGH 3WN5A 4ELMB 4HF5H 1IM9B 4KK5D 4MD0A 2A6KA 2DB8A 1N4XH 1T5XA 3KPPA 5AZ2H 5CIPB 1I75A 4M3JA 2Y06L 3UTTE 4AT6A 2WBWB 1CLYH 5EU3A 5DLMH 5EO9B 3VXSB 2HFTA 5CD3B 3JWDH 4R2GD 1ZVYA 5E94A 4U1KA 2DWDA 4U1HA 4OKVA 3AB0B 1UYWH 1D9KD 1HQ4B 2BNRB 1IEBB 4PJ5A 4FXGB 4ORZC 3KPSD 1LNUA 5DEFB 4LSPL 3WHXB 5KVFL 2E3VA 2CR3A 1YJDC 2H9GA 3QULA 4Q2ZB 4X9HA 5ACLA 4RFOH 4LSTH 5GIRB 3X3GL 4IDJL 3RUGF 4LLMA 2VMFA 3NAAL 1NMBH 4PJCE 1HXMA 4JY5L 1U93A 5D5MF 5FGBC 3SE3C 4GRLA 1C8PA 1DANT 1UJ3A 2A6JA 3QPQD 3T3MF 3U4BL 2EECA 5CLTA 2VIRB 2Q7NA 5DD3L 3B3IA 5DLML 4X6EB 4HAFA 3OKKB 1NL0H 5DTFA 3BZFB 1FVEA 4UBDC 3O6FB 1FV1A 5FOJA 1HHKA 3T08A 4RQQB 4KKCC 3BPNB 4YGAB 2HWZH 4YHOL 1A4JA 2BVOA 1ADQH 3LVEA 4NC1C 4MDJB 4HUVA 4L8DA 3T0EB 1WISA 5LGKA 3VG0H 5BS0A 1NFDA 1YEFL 1HE7A 5T1MA 4URTB 1OPGH 1AP2A 3Q3GB 4KGJA 4ZUUB 3HNSH 2VDPL 2HJKB 1AQDA 5GS3A 3I9GH 3OAZH 3B2UC 4DKDC 4ZS6D 1IT9L 3NCYP 1KB5H 3MLVH 4ONHB 2R0ZH 5CINH 1HI6B 2EDEA 5K9KB 4ODUB 4MU9A 1B0RA 5K9JH 3MX0A 4TULH 4WI8A 5DJ8A 5F97E 2B1AL 1ADQL 1KCSH 2R56L 1HZHH 3LPFA 1YY9C 3U0TB 3HUJF 2DD8L 3G5VB 4PJ5D 3DTXA 3FZUD 1HYSC 2PTUA 3OKYA 5L2JB 2LU3A 4N8CL 1DQTA 4M61B 1MLCB 5EG6C 1SA4B 2VO5A 1W0VB 2C5DC 3OKLB 4HBQA 4WO4A 4RISL 4LLVA 4MAYA 4Y2DA 1AD0B 3NFNB 3SOBH 5JHDD 4YXHH 2R1WA 2YMXL 6FABH 3D6GA 2CXKA 3BHBA 4DCQA 1YMHB 1YEGL 3ROOB 5GHWH 4OB5H 3QUZD 2WWMC 4FQLL 1MEXH 4M7LL 4WEMB 1KG0B 4PJHB 4M1DH 3F65A 2VRAA 5D7LB 1BOGB 3AREA 4PRID 4D0CA 1JHTA 2J7LA 3QR2A 2QSTA 4PJ8C 4D3CL 5C0RH 3AMKA 4OD2B 3KYKH 2XNAB 4FG6C 5C71A 2Y07H 5EOQH 1YN6A 3O11B 5BCAA 1F4HA 1OAXH 1RUML 3MGOB 3ZDXE 4QXTA 5GJSH 2J8OA 4AL8H 4J3SA 1W72H 3QUYC 1PJ9A 1MCOH 4HV8A 4PJEA 2DI7A 2OMBA 3MRIB 4N0FB 3LQZB 2CLZB 3C08L 4Y1AA 3S7GA 4ODSL 2QL1A 2P44B 2XZCH 3L3DA 4I0PB 4EUPG 5GRYA 5E2UH 3IB4A 4YXLH 3KYKL 4HIXH 5AZEL 1TVBB 4JFEB 12E8H 1AQKL 2DQCH 3VXNA 3MRHB 4M6OL 1JZ5A 2BXYA 2HLFD 4AG4L 1FN4A 5DMKA 4M3KB 2H6PA 1XGRB 5D6DA 1HHGA 3ARFD 4I0CC 4OZFA 1TPXB 2ZCLL 3RWJA 3UO1L 5MI0B 3UDWA 1YY8A 3D25B 5I1JH 1T0MB 3ZLQC 1JGUH 2HVKB 4AIXA 2ZSWB 5H35A 4ZO7A 1RFDH 1MJ7L 4WCYL 2WIIA 4E41A 1P7HL 4P2QB 2P47B 4IMKC 1NCCH 1AR2A 5B4MC 1Z6JT 1N4PB 3QIWB 4Z7WA 3HAEG 4APQC 3MCKB 2QJDA 2HVJA 4ZAKC 2Q76A 2BJMH 3I6KB 1GIGH 1TNUB 4Z9KB 2VDRL 1T1ZA 4JDVB 3S5LB 4JFFD 4RDQF 1CG9B 4QCIB 1JTTA 2VLRA 1LE9A 5D71L 4NQSB 3LEVH 3CFCL 2R0LL 1F3JA 4PJDF 1NGQH 4JVPA 1SM3L 3RJQB 3QDMA 1CDIA 2MMXA 2AP2A 4M5ZH 3Q5YA 5JIKA 3MJGX 5A43C 1FIGL 3AU1A 4MA7L 4EJ1C 4R8WL 1NANH 2I9TB 5I1AB 1N9AB 1VCAA 4U6HB 4R4ND 1GGIH 1XR9B 5I30L 1JGLH 2VKXA 1X5FA 3IJSA 5CJOH 1ZT7A 5LWYH 3RL1B 3CJJA 3EYFA 2YRZA 1M7DA 4J3XA 2Y36H 1A4KB 3FONB 4PLJD 4OZHA 4LSUH 2GYSA 3V0AC 4QYOB 4Z7UB 3TT1L 1KJSA 4HWZA 4GFTB 3VD9A 4NKDA 3W5MA 3DRTB 3UJIL 3NCYS 4NNYB 1EHLH 2WBKA 3CPLB 1OAQL 1ACYH 5DSCB 3ECBB 4WWID 3MYJA 5EZJB 3BPNC 1ZHKB 5FF6B 4MNQA 4ALAH 4BH7B 5C0EA 3R8QA 4PGCB 3KS0J 3Q48A 4XPHH 2Z8VC 5EBLA 4X6CF 1IT9H 4Y4FD 3D1MC 4G43A 1HSBA 5GGTA 3P4NB 4H1LH 1S5IH 3W9DB 4HK3J 1DP0A 1JCRB 4MSWA 1VKXA 1PX4A 2N1KA 5T5NF 1UMPA 3MCKA 1EHAA 2IAMA 5IB2A 5D5MA 1Z0MA 3L5HA 3O6MH 3ILQC 4R2GC 2VLJE 4PRHB 2ICWI 1R5WB 3FQUA 3FRUB 1ES0B 4X6CA 1JGDB 1WZLA 1I9IH 4IOIB 2PMVA 3R4DA 4PJIF 1V7NL 2FO1A 2J12B 2CRMA 1BQHB 1WZMA 3GMMA 3J7HA 1T0MA 2APXA 2WM0A 3RIFF 1ZLSL 4OFPA 1MFDL 2YD7A 4AJ0A 1T4KB 2JJTA 2YPKB 4HIJA 3ZKSD 2NX5D 1RZJH 3QISA 4Y5YA 3OAUH 4PJCA 2XFXA 4LSQH 4KJWD 1N3NA 4XB7A 1KCRH 1FN4B 1KN4H 3NA9L 3BRFA 5BW7C 2NOJA 4WHYH 2VLRD 2PW1A 1OPGL 4NP4H 2F19L 1VPOL 1TZIA 5BRZB 4FXLA 1DLFH 4YIQB 4PGBB 4OGYL 1D3CA 3IFOA 3TN0A 3VFSA 2WWKO 3WHE0 2AKRB 4PJBF 2HP4A 1R6VA 3QH3B 1K3ZA 4L8CA 5IK3A 4KI5D 5CJQL 5DJ2A 2WLYA 3VFRB 3ZZ1A 4NRYA 4XBGB 3VFMB 5CZXD 5GGVH 5ISZD 5EWIL 4LDLB 4ZTOL 1UB5A 4CNIA 2NY0D 4M9PA 3FB5A 1NGYA 3QUMA 3TO4A 1B4RA 3E33B 1KCSL 1MLBB 1OAKL 2IALA 4LPCA 2FR4B 3VRLF 2DQEH 1KIQA 1A6WL 1KG0A 4PJHA 3ARBA 1MFCL 5I8OH 1CF8L 1T80A 1UZ6F 5ETUA 2FEDD 2H6HB 3ETBF 1C5CL 1EAPA 5HGAB 1TNOB 3FQTB 1NBYB 3EFDH 3W11C 3NPZB 1INEL 4CVZB 1OGAA 4JJ5B 3GJFB 1YNKH 43CAB 4HXBH 4P4KB 1RIUL 2B1HH 3P0VH 4ELME 4F57H 4KKBD 1A6UH 4B53A 5L2JA 5IWLA 1MVUB 3NIGE 4K23H 5F1KC 4EKXA 3QPXL 5C0ND 5EZIH 5I1CL 5T3ZD 3DV6B 1VEOA 1KIPA 2X4UB 3L7EA 5EBGA 2APWA 3TV3H 5IQ9B 2ZG1A 3L3HB 1B0RB 1RUMH 3HR5B 4L3EA 3WNKA 4YHKL 3ARED 3NCJH 1Z9SA 3EO1B 1P84K 5DI8B 4KTEH 3O3BB 3MC0A 2IFGA 5EZIL 4QRUA 4X6CE 3THML 2H6FB 2VSCA 5BV7L 1ODAA 4LPXA 4JG0L 5DC9B 1VFMA 4PJEF 5DD5H 5FK9B 4IIQA 5IKCA 4TUOB 5TDOB 2UUDK 1HN1A 2EEBA 1JCKA 3JWOL 2BY1A 3V6ZB 1P5UA 2R4SL 1QKZH 1NBZB 5ESAB 3MRLB 1JI2A 2AJXL 5C0GB 3OKKA 3ZDYE 3GIZH 3TLRA 3OHXB 3I50L 3X13B 5JQ6H 3HG1D 2UZYB 4KPHL 1FGVL 5CS7A 3LKOB 1QYGH 4HGWA 1U93B 3UJIH 3PNWB 4Q9CA 1RVFL 3PWPD 4U1NB 3PZ3B 4KKAD 4XVTL 1JGVL 1EHNA 2NW2A 2AJXH 2BSSB 4CADB 2WV3A 4YDLC 1JI1A 4MMZC 3SGKA 1S8DB 3BXNB 2DJ4A 2O61A 1IC5L 5DK0A 4Z18A 4UQ2A 1LE5A 4E9LA 4Z6AT 1B88A 3DI2B 2R4SH 1Q9KA 1MFAL 5KVGL 4N9GA 5IB2B 5EO9A 3VXSA 1BP3B 5CEZE 3ULUF 1KB5B 2A6KB 2JIXA 1A7OH 1RJLB 2FL5A 3WJJC 5C0AE 3FL7A 2WNGA 2HJFB 3QDHA 5D2LE 5C09A 3TBSA 3MNWB 4OSUL 1N4SB 2APVA 4ZFZA 1MIEL 3I6GA 4KTDL 4Z7VA 2V8KA 4UIMB 4HSQA 1J86A 2DWEA 1WZKA 3MRFB 2LQRA 3AM8C 5E2VH 3MBED 3VXUB 3QXWA 3ZTNL 3D39D 3P73A 3D9AH 2VZ3A 2NY1D 3IKCA 1PKQB 2P48B 3LZFL 4LCIL 1FLRL 2IAMC 3NIFF 4FQ2L 4ONFH 4Z7UA 3QXTA 1JRHH 2X1WL 1V3KA 4JAMA 3IFPB 4XNUL 5ID1A 3DVGA 1JPFB 4EVNA 2OP4H 4D4AA 3TC9A 4J3UA 1DBMH 1MCBA 3KYMB 3ARDC 3S4SA 4FA8A 4XCEA 4IEFB 3RUGA 1ZT1B 4FQHA 5I0ZA 1INDL 3R06B 3QEQB 3UP1A 1AR1C 1XGUB 3OAZK 3RGVA 1U8HB 4X80L 3FTGB 5C0IA 2WMPA 4J2XA 2ZCKL 3C2AH 1F3JB 3GK8H 3AMLA 1OAYL 3QJFB 1KIRA 2LAAA 4JDZA 3IDNB 2B4CL 3QNZA 1DQJB 3CSPA 3NIDE 1A6WH 5DYOA 3KLAB 3MNVB 2ZCHH 1KLUB 1QSJA 5E99L 4PJEE 3UTSB 1BVLB 5IHZA 1WIOA 4H0HB 5IJVB 4UAOC 2BNUB 4QWWC 3VXMB 3E34B 4X8XA 4PJ9B 4XP1L 3I2CH 1P53A 3OXUA 2XQYG 5C0CD 1K2DB 2H2PD 5F8RC 3O2VL 2PO6D 1BLNA 4J8RA 4P2RD 1QSED 1U3ZA 3K7XA 1AKJD 3HXEB 4KKLC 4F7MA 3T09A 5E8PA 1CTOA 5AAWA 3VJ6A 2F19H 3PWNB 5JDSA 2AEQL 2V5TA 1G7PA 35C8L 3VDBA 1NUFA 4MHHI 2NY7L 4L29A 2AS5M 4JFDB 5JUEL 3RGVD 4XZUA 5DMKB 3DSVB 4QF1B 3SGJC 4ZPVA 2MNUA 1X5HA 2FX9H 2HT4D 2WINA 2ZUSA 3CDCA 4JPVH 2MKLC 3MRHA 4UZGA 1DL7H 4ZFOA 4WTZA 5D1XB 4Y4HB 5CBEA 4QT5A 3RHWF 5MI0C 1T03L 3MNZB 35C8H 5EO1B 2DM7A 4MS8D 2H2PC 1X5IA 1U92B 2PUQT 3LH2H 3BPOC 1U6AH 3FAXA 3HTLX 1N2RA 3JTTA 2EYRB 3LQZA 5DS8A 4EIGB 1GL4B 1U8LA 4LIQL 5TDPB 1A6AA 3QQ3B 2VXSL 5C2BH 4GTMB 5HTSA 4HQQH 3C60B 5D96C 4I0PC 1DBAH 4Z7UE 4TQEH 5IFHL 1NCBH 1A1NB 1XAUA 1YUHB 3FO0H 1RSFA 5KOVC 5C2UB 4V1DA 2E6JA 4G8EB 3LOWA 5DRXB 4XBEH 1FO0B 2BRRH 3P40A 5FM8A 4YJZL 2Q8AH 4BSVA 1M05B 2CDEB 1X5JA 5EZLB 3GBLA 4PTUB 3RL2B 4Z0XA 1QTYT 4HJJH 4LPVA 1IL1A 1F8TH 3NFPA 3TV3L 4KROD 3RU8H 1QSFD 5J57B 3UPRB 4L3CA 4N8CH 4WY7L 3LKQA 1BD2E 3OKLA 3S35H 3X12B 4S1SL 5LQBL 3BT2H 5GGRY 3V4PL 2FZ3B 4A6YH 2QADB 4GW5A 2A6DB 3RNKA 1WAAF 5I1LB 2YA2A 2IBGA 3VGGA 5E7BA 1DQML 5L8LB 1T5WB 2CK0L 2VITA 3SE8H 4K7PL 2XYCA 1J0HA 3S3PA 5IHBA 1M7IB 2Y4SA 2R9HC 4BZ2H 5BZWB 2DMKA 4U1JA 3E3QC 4QXGH 4NQEB 3PG2A 1FGNL 5ALBL 4JZNB 3SDDA 2DI8A 4MNHB 5K9QG 1W8NA 3RU8L 3P4OA 3NIDF 3PGFL 2FHBA 3Q3GA 4GBXB 4NQCB 4RAVA 2H3NA 5TGBA 1IFHL 1TTGA 1SA5B 1NJ9A 1RPQA 3MLRL 4IJ3B 3KJ6H 3FOLB 4JDTH 4LSSH 1J05A 1D6EB 2QTEA 4M6ML 5BMFL 2NTSP 3R1GH 4IMKA 1ITBB 2JK5A 2XZCL 4P57B 3HC3H 3MRKB 4M62L 1NGZA 3MLUL 5FKAA 1NUGA 3G04B 4P5TA 4Z7WE 1CFTB 5GRUH 4PB0L 4BM7A 2V2XA 1BJ1J 3RDTA 1FVEB 1MPAL 5CEYA 4NO5B 1BQHG 4J1UB 3WS6A 5D1QB 2WUCH 4R97B 5SWSA 3QQ4A 4X6DF 4NKMB 4GAFB 3REVA 4X7TA 3DXAB 4KV5F 1UJ3B 2A6JB 1VGKA 3MRQA 5BZWA 4HPYL 3K4ZA 1S9VA 4K3DL 5AUMA 3BQUB 4D0DB 3WYRA 2DQGL 4MCZA 2D7NA 4LLMB 5FB8B 4MGXA 4N9OB 2ESVD 3RKDC 2X4TB 4G8FB 3K81A 2FZ3A 5IP4A 4M48L 2VLKB 1JWSA 3ARTA 3QQ9D 4LCWE 1HH6B 1LDSA 2FATL 2FBOJ 1T66D 5C92A 3H9ZA 4WGVB 5H94A 4JZJB 3SGJA 3BUTA 1OQXA 4PJGE 1ZHNA 3P0GB 5DJYA 5FHAL 1MHHA 4NYLB 4IMLB 5JIPA 4GXUN 4JKLA 3S5LG 3QG6B 3NVQA 5IGXL 1XGQB 5JOPE 1A1NA 4N8VA 3A6CH 3C5SA 3DBXA 3EO9H 4YHYB 2YXMA 5D7JB 5ICXA 4K71C 5F6HI 1BZ9B 5BV7B 2ITCB 2EKSA 3H9SA 3FRPG 2GKIA 3Q1SH 5EO0B 4PY7A 1A14H 4NO0A 4HC1L 1U8LB 2HAZA 1DL7L 5DA4A 4XNQB 4L9LC 4HIEA 4WB3A 3MTRA 4ODBD 1GXMA 5C0BD 4OLVH 1TJGH 2B4CH 4H8WL 5TQ2H 3ILQD 1AO7E 2YWYA 3RUGE 4PJ8D 3T2OA 4PJCF 2KZWA 4PJIB 4U1GB 4XPBH 3RX7A 3N0PB 2PYEE 4U1IA 1JRHI 3KPRD 5HYJE 1XR8A 2JB6A 1A7BA 1IE5A 4XP4H 4XPHL 2HKHL 1ACZA 3DMMA 1U8JA 1CGWA 2A77L 4PRNA 5IESL 3LDBB 4N0YH 3BGAA 4RFNC 1GRWA 1S7WA 3VGFA 3MXWH 4PJAE 2ZUTA 4M4PA 5DF0A 1LEGB 3GGWB 1BLNB 5B3NA 4FHBD 1AJ7H 4JJHA 1JK8B 2N7AA 1JK8A 2LVCA 2EE2A 3VXRB 3C6SB 1LEGA 3GGWA 3VXMA 2WBJA 5KJRH 3RVVC 5MEOB 5GGSB 3DHMA 4G6JL 1I9RL 4F7CA 2AXGA 5CMAA 3T3PE 3WNLA 4QHUB 3UJJH 4ZXBD 2X44D 1G7MA 3DMMB 3QJFA 4GKSA 2X4SB 4OAWB 4P46B 2IMNA 2O5ZL 3SDXF 3BX7C 1I8MB 1S7UB 5EC1A 5C9JA 2IQ9L 2W60B 3ZO0A 3CX5J 1GGYA 4CVWA 2R1YA 4LFHD 2I60H 1KTDA 1JP5A 4LCCB 3QI9B 1UA6H 4XXDA 3KYMA 1IGTA 3LPWA 3RDTD 2H8PA 3RZCA 5DRWA 1KPUB 5CZVH 2EDDA 4JQVA 2VXQL 1I3RA 4H5SA 1Z9OA 1Q94A 4XNMB 4JGUA 4AY0A 4PJ7B 1RU9H 4Y2DD 3TZVC 1PKQA 4J6RL 4B0MM 5J1AB 2K7PA 1U8PB 4TTDC 2EKSB 4PYGA 4XC1H 4TNWF 4NQDD 3TA3C 3U0WL 2GSIB 3GM0A 4P3CH 1H8NA 1YNTA 4RA3A 3ULSB 2NQCA 4OGXH 5BVJB 1EO7A 1BM3L 2DMBA 4Y4KB 4WU5A 2XPGB 4P2OA 1KOAA 5KSBA 3UTTD 3GSNA 3LHPH 1SYSB 3HNVH 5FYJU 4L8BB 1I1AD 2DKSA 2VZTA 5TE4L 1DEDA 5D2NC 2Q8BH 3WO4C 1O1RB 1P4IL 5FUZH 4NBZB 4HUUA 1F11A 3QNYA 3LQAH 1CD1B 4LMQE 3MYZA 3MV9D 1JWSB 2GAZB 4HKZB 4TPRL 2XWJA 4XX1E 1T22B 4QOKA 5GGVY 3LHPL 1YC8A 3RJ3A 3ZT7A 3EJYD 5JHLL 3DYMA 2LTQB 3WS6C 2OZ4A 2DLIA 4JR9L 2Y7QB 5AZ2L 3L3KA 3QIBA 3NCBB 1YMMA 2F74B 3W0WE 1WIUA 4HWEH 2B7DT 4M6MH 4HZLA 3KLSA 3NCMA 1PG7X 2HA1A 3FT3B 3O3AA 4KKNA 1ZEAH 3LKSB 5I19H 1B4JH 4WW2C 4A6YB 1R3KB 2W38A 5GXBB 4PRPB 4CN6A 1U3HB 3A6CL 3EO9L 4UBDD 1GZPA 3GSVA 3JUYA 2HJLA 2VE6A 3E32B 5L88L 4MLSA 1O6HA 2D7TH 1NGZB 4GKSB 5FKAB 3MA9H 4WHYG 4P57A 1Q9LA 4HPYH 3O81A 4LASL 2WK2A 3TYFB 3CSGA 3C6LC 4FFZH 3KPOB 2C4FT 5DGQA 3RWFB 1FORL 3RPKA 3M1BA 4FZEL 1LO2H 5TGBB 2QQQA 1XF1A 2X6MA 4Q6IC 3FT2B 3T0DA 3G5ZA 2PTTA 4KY1L 4JPWL 4PR5A 2Q1EA 5KVMC 2W0LA 3C6LA 2XKNB 4XMKL 3EO1A 4M48H 1X9QA 5DMJB 5I71C 3U7YH 2DM4A 1HWGB 1A5FH 3HR5A 4L3EB 1FORH 4MJ5B 3EOYG 3CSYA 4POUB 3NGBC 5LKNA 2W9LA 2X9XA 3ULVC 5E5MB 5JHDA 1E6OH 4MAYC 2BP3A 4OCYL 3RNKB 4K3GA 3ISWA 3STBA 4QXWA 1KFAH 1XR8B 5B8CA 4PP2B 3DVNA 4XHQA 1UZ8A 3TN0C 3VFOA 3V4VL 4PJFB 5CCKL 5I1KL 3OR7B 3SKUD 4GG6B 1A7NH 3PJSA 4OFKA 4GTSB 4YPGA 5IW1A 4HKBA 4J12A 1N5YH 1MCPH 1MHPL 5A2IH 1P7KA 3KYNA 3E8UL 4I48B 4M7ZB 4M8QA 2BVUA 5E5RB 1TN6B 4MXWL 4YUEH 4TRPH 1IAKB 3L3IA 5A16A 1L9MA 3SDDD 2UVEA 2WWMD 5CGYD 4HS8L 3L3JB 5HI4C 3UZEA 1ETZA 3KDMB 4PJXF 2VLJA 3H9SB 2ITCA 1NCUA 4U0RC 4OLZL 1BGXL 1MLBA 1JZ8A 2D4FA 1D9KC 4EXKA 1KCVH 5C0AA 4NNPH 1PY4A 1UB5B 3UYOD 3FB8B 4I2XA 3S9DB 1SBBA 4HG4K 4JN2A 4IRJB 3O4LA 1IBGH 3L5JA 2VISA 3G08A 4P3DA 1ZANL 3S37L 5J3HC 2OXHA 1T2JA 2FH6A 2V5MA 3D5RA 4BQBA 4MNQE 1U92A 4WB2A 3BH9A 2IG2H 3I9GL 4PGBA 3LRHA 1T7WA 2R29H 1TZIB 5BRZA 3TO2A 1QLFA 2BSRB 5DJ0A 4FG6D 3D39A 1QFUL 3QDME 1HDMB 3DURB 4I77L 4WWKD 5L7XH 3BW9B 3T77B 5JXAL 4FQQB 5EUOE 4WEBH 1E6JH 4PRBB 2EE9A 4ONTA 1RZJL 3RWCA 2BC4A 2A1WL 1GAFH 4P3CL 3IU4L 3SGEH 3UTZB 1NKOA 1JZ2A 4XNYH 2Y23A 3GB7B 3RZCC 3F5WB 5DR5H 5D1ZB 5GRVK 4YWGL 4OV5B 2O93L 1NCAH 4PRHA 3QIBD 3REVB 4PJBE 1MCHA 1KV3A 2BNUA 5ISZA 3W9DA 4PJ5E 3I02B 2NNAA 4IRZH 4QRRB 5I1HL 5CUSH 3QFDA 4MXVF 1R3IL 4PREB 2R1XB 4CN1A 2ZUUA 3SKOB 4P5TB 4LCWB 1JUFA 4PD4J 1F4XH 4JKMA 5DFTA 4O58L 1JWUA 1AGFA 1KXVC 1ULVA 3LQAC 4QHLB 1PZ5B 2V7HB 4L3EE 3OF6D 3C72B 3JXAA 3KR3H 1C5CH 4M43H 3WSQL 4RNRA 5F9JA 2H1PH 3P4OB 3LN4B 5EB9A 4WNQB 1A2YB 4ZUTB 4IHOB 5FOBA 3NPSC 3PL6D 4XNXL 4Y8DC 4E5XA 4ZFGL 4P2RA 3BIKA 5GISL 3B9AA 4F7EB 5A3IC 3QDJD 4L4VE 1PYWB 1J8HA 4MZ2A 4OCXH 1FIEA 1QFPA 1XF5A 1QSVA 3ALPA 1D5XA 3L3OA 1JGLL 2DQUL 2Z35B 4C57C 5ISZE 1G1YA 2DOCA 1JGVH 3GMNB 5I0DA 1LEIA 2Y06H 2OYPA 1J1XL 5L8KB 2MQ3A 2YR3A 4V1RA 1FPTL 3FQNB 4Z7VB 4ZOAA 3SO5A 5JW4R 1YECL 2PETA 2VUYA 1S7TB 4ZFZB 3R8BB 1TITA 1I9EA 1ZHLB 2Q20A 4F2MA 1TLKA 1RZFH 1J0YA 3TBSB 4KK8D 3G6JB 3FO2A 2HJFA 5C09B 3EOTL 4CN4A 4D9RE 1SY6A 5IVZB 3I3BA 4HX1A 4O2FB 3PWUA 4NT6A 3GJFK 1DBKH 3GSRA 3HC4L 5H2BA 4XP5H 4N9GB 2EDOA 4OQTL 5A40E 2R4RH 4F37K 4MNGB 3OXSB 3RY5A 5HVHB 4M1CC 3UXFA 3VH8B 4YE4L 1LE5B 3O6LL 4ZSOA 3V7AG 4WTXA 4GO6B 4JFEE 3JZ7A 1UEMA 3TJEL 3BD5A 3UC0H 3ZDYF 4NWUH 3AAZB 4K7PH 1MRDL 2JE8A 2A9NL 3S36L 3MGTB 5EIQA 5HDOA 3RGVC 3MUHL 2CDGA 3VRJA 3LKOA 4OLXL 3NABL 1ORSB 4ZUWB 5D1XA 3AS1A 3MOAL 3MODL 4LARH 5DJZA 3TJHD 3X13A 5C7XL 1IFHH 5FDYA 1PW3A 4HH9B 2IH3A 4OIAA 5FO8A 4O02H 3LS4H 3CX2A 1YYLH 4QRQA 1WV7T 2I07B 1G7PB 2IBZX 4Y7MA 3CLEL 3FCTA 4DQOL 1QLEL 1RHFA 1CXFA 4UINH 5EZOL 5TDNA 4PRHD 4XBPB 1X7QA 1G6VK 1KJVA 2QSCH 5BRZE 3ARBC 4JFFE 5LAXA 4TUOA 2VDNL 4LSTL 1XGPB 3MGOA 3ULUE 1RUPH 5IFJB 2GT9B 5T3XL 4OFVA 1EEYA 1WBYB 1RJZB 1NC4B 3C09C 1QFWM 2BCKA 4HWUA 2AVGA 1DLFL 1K2DA 1JHTB 3HLAA 4X9FA 5I74C 3BP5B 1EFXD 2DQFA 4GTQB 5F96H 3QWRA 3H3PL 4JZOA 1NH6A 3D85D 3U0PA 4P59L 1RUPL 2YD8A 1J0ZA 2CKBH 1AGEA 4XTRC 3QNZB 3GKWH 3EYOA 3RA7H 4MS8C 3O8XD 1DCEB 3MV8E 1GOFA 2DQHH 5IVOA 2DQEL 2QR0B 4LPTA 2UVFA 4TRPL 1MVUA 2YPLB 1MWAH 5A2LH 3U1SH 4XB8A 2XXMB 4ZDHB 4DN4H 3RUGB 4AH2A 3VGEA 3QZWG 3MFFB 1XF3A 4CVZA 1F4YL 3KPRE 5CEZD 5B8CC 1KB5L 3MLVL 1FJ1B 4JFOB 5MENB 2R8SH 3U9UB 3GI8L 4GLRI 4MZ3A 1BWWA 4G9FA 1TCRA 4OM0H 3D69B 2DTMH 2OL3A 2UY6A 1DBBL 4L8SA 4ZNEA 5CUSL 3IKCB 1JJUA 5ERWA 2HT3C 4OUUA 2IALB 4UTBH 3T8XB 1SJHB 3NA9H 2QQNH 3G5XB 1RJZA 2AV1B 1WZ1L 2BOBA 2YD1A 4IRSB 1BREA 5EBMB 3HS0A 4PV8A 1S9XB 3NCJL 5I9QB 4BJLA 1KJVB 2IFFH 1GGTA 2AKRA 3AREC 1MCLA 3FCTB 5IOPB 1WC7B 2QQKL 2UYLB 4TYUA 1HHKB 2RQ8A 1FV1B 2JIXB 4NHCH 4P2OC 4NHUA 1DVFC 4GOSA 1TETL 2VIRA 2Q8AL 2IPTL 1Q9KB 3AXLA 3RNQA 5KN5B 2Q86A 3OXRB 4OGAC 1XIWC 1KLGB 4BZ1H 4KRPD 4HIJB 5DO2C 3B9EA 3M8OL 1T4KA 4OCSL 2EC9T 4MJ6B 5D93C 2DJSA 3ARGD 5GIRA 5CZKA 1KNOA 2E27L 3V95A 1P6AB 4TTGA 1CFBA 3OKOA 4O2EB 4XH2A 3BT2L 2QEJA 3IAGC 3MRGA 4ZSOB 2D7MA 4LNRB 4FXGA 4X6CB 3BDYL 4U1HB 4KKBC 4NHCL 3OXSA 4NKOA 1RULH 1NC2D 4XI5D 4NT6B 1H9VA 3T2NH 4MSWB 4NHUB 1XIWD 3WSQH 4HX1B 1IM9A 1U2CA 3TBTA 4G8GB 4U3XA 3MV8A 2H32A 3UPAA 3DSWB 1MH5B 3HG1B 1NCBL 3IJHB 4WUUA 1GGCH 5L6YL 1NDMB 4M7JH 1NBQA 5MEPA 2IEJB 2DIBA 4W4NA 2HN7A 4UT9L 1JYXA 1EUUA 2AGJL 3PP4L 5HDQL 1MJJA 3DYPA 3ARVA 2W0FB 4U6YB 3PP3H 1HCFX 4NJ9H 3BUYA 3THMH 1CE1H 4HUMB 4Q9BA 1P7QD 3DX6B 4NKDB 2NY2B 3D69A 5KBNC 2CUIA 4HBCH 1J8HB 1R5VA 5DXWA 4FQXD 3D5OF 3VGHA 3MO1B 3RP1A 1BJ8A 3ZKNC 2QBWA 2Z31C 3NIGF 3IXTA 4XNZC 1OARH 1ZT7B 3H7LA 5K59F 1D5IL 2VR4A 3EOTH 1FVCA 2DQIL 3CCHB 5HGDB 5T3ZH 2QR0A 4O5LH 1SVCP 3QDMB 1YN7A 1EJOL 5F93C 1SEQH 1QEWB 5IF0A 4YDJA 4X9BA 3BWAB 3FQTA 3MBEB 1MJUH 2QSQA 5T1KD 5J9PA 2ATKB 2EDJA 5KVGH 4I2XE 2X1XR 1HEZB 1YPZB 5LJYH 3FOMB 5ETUB 5DD1H 1RJYB 5HI3D 4X8JB 5EPMA 3DETC 2FYYB 5HPMA 4TSAL 3IDXL 3QIWA 4G3YL 5JHDE 3EGSA 4NC1E 1C5DB 5ACZB 3DSSB 1NGYB 3QUMB 4NQDE 2OSLB 3VXME 4QNPE 4Z7OE 1RK1A 4PV9A 1GC1H 3EYSH 1KPRA 4L8CB 1R5IB 3GIVB 4Y19A 4X80H 5DJ6B 3UTZA 4X6DE 3OKMA 4EI5C 3BZDA 4HC1A 3IDJB 4KMQA 4TSAH 4V1DE 5I1DA 5EOTA 5JW4N 5ENWA 4GRWE 4LHUD 3QUYA 4NN5C 3DV4A 3CFEB 2IH3B 3HZMA 1XGTA 2P5EA 2X89A 4P46C 5CEZH 2DTML 1CVSC 4JFEA 4MBGB 3CFEA 2BVQB 4GG6E 1T89C 2BDNL 4P5MA 7FABH 4Y5YB 3ZMRA 5J89A 5FAAA 4I0PA 1FAIL 5D6CB 3WO3B 3LZFH 1GHFL 4LCIH 1WFOA 2Z92B 1CXKA 4PJEB 3MJ8A 1YEFH 2G5RA 3GIVA 5DJ6A 1FQ9C 1IKFH 2ED8A 2EZ0C 1D6VL 1DQLL 1EGJA 3ZTJG 5FYKD 1JV5B 3MRJB 4RFNB 1JCSB 5IVXE 3FQUB 2E8YA 4LSVL 3T0XA 4UDUB 2NY0C 2IAMB 4OQ1A 2BVEA 3QUXA 1IEHA 1ETZB 4JKPL 5MP6H 5C0NC 2NPLX 3L3JA 1A6UL 1QPPA 1AGCB 3SQBA 4I6OA 1CFVL 3BHBB 3MBEA 4ESKA 5HHVL 5HGHB 3MJ9H 5SWZD 5IBUB 1A6ZA 4PJXB 3GHEH 1DTUA 1UVQA 2VZVA 1ZHKA 3V4VH 5CCKH 1QR1B 3QHZL 5L8JB 4PG2A 3QIBC 4OF7A 3G5YB 4GG6A 3BKYH 1MUJA 3VFWA 3HQAA 3ECBA 3VXPB 4GUPB 1HILA 1MJ8H 4F7TB 5SWSE 4MJIE 3DRTA 1D5XB 5L2KB 2J8UE 1F8TL 5K59E 4KDWA 7CGTA 2YZ8A 3SCMC 4MVBC 3P30L 4QYOA 3VG0L 2ZSVA 3MO1A 4BFBD 1RUAH 5DZOA 5JR1H 5I73C 1X4XA 5E4EC 2J4WL 1XIWA 5F6HJ 3R0NA 1WVZA 2QV2A 4ONHA 3K74B 2NY7H 1TQBB 3L5WB 2G9HA 1XR9A 1JPTL 2GTWB 2HJKA 4EN3A 5T1LB 1QNZL 3A67L 4KVNH 2ZUXA 5CAYB 4XP9L 4F57L 4X83A 1VFOA 2IH1A 1DQMH 5C0CE 4OLUH 3O6FD 1NFDB 4QHLA 4ZO6A 1MCWW 2VUOA 3DUHA 3EDFA 3ZL4H 1UCBH 2UZXB 1TJHL 4YK4B 3FJTA 3B6SB 3S97C 2K3TA 4K94L 3WIIH 4QRRA 4YDOB 1EXUB 4LPYA 2XIDA 1IVLA 3KPQA 4M6OH 3T3PF 5J1SC 3UJJL 3H3KA 4NKOB 4G6AC 2X4NB 2CLRB 4P2CG 1KCUL 1T1YA 2YD3A 3O4LD 1C08B 1OLZA 4P2QA 2KKQA 3MCLL 5EN2B 3L5XL 4G6FD 1F3RB 3ZKQD 2L0DA 1E27A 4ZUSB 3ALWA 5IW3A 4GSDH 1G9NC 2Y7QA 1N6QL 3E0GA 5HYSA 1O0VA 4JY4A 5JA8B 3IXAA 4PJ5B 3WDIA 2APTA 3D2UD 5ADPH 1CDYA 2G75B 2JJTC 3DURA 1SBSH 3VXNB 2I26N 1GCFA 2X4RB 4IJ3C 3IKKA 1E4WH 4MQTB 4A6YL 4DGYL 4MD0B 3IRPX 2YPVL 3BH9B 3DX7A 4M8VA 3CFCH 3BP4B 4N0FA 1GHQA 4LEXL 3VWJC 1A3LH 2ZZUT 2GIYA 2A38A 3BRDA 4KZEH 1FLRH 2DQCL 3OMZA 1K4CA 4K3HA 3VFPA 3QUZB 1MHCB 2RFXB 1IQWH 2VQ1B 4ZS6C 2D7PA 4R3SA 5JW5A 3KJ6L 4LSSL 4L3AA 1RQ5A 1V3JA 2RGSA 1OARL 4JFHD 4HF5L 5LWYL 4FQJH 2XWTA 1N6UA 5ERWB 4F3FA 2V8JA 1A3LL 1M71B 3U46B 1XF4A 3C6LD 2XV6B 4PUBH 2BSTA 1JZ3A 3U9UA 2AK4B 2R1WB 4M6NH 3O6KL 3QIWC 1FC1A 5KVDH 3KVQA 2H8PB 4X5LA 5KVFH 4XAKD 4PRAA 5IW1B 2G5BA 1KJ3L 4DKAA 5I16B 3PJSB 2R0KH 1NCNA 4W6XB 5GGQH 3EOBB 2NCMA 2EC9U 4JLRA 3IU3A 1TN8B 3DVNB 4PUBL 4S10A 5DEGB 3ZDZF 4OI7A 2GUOA 1RZ8B 1OGAD 1OLLA 2YBRB 1IGYB 2X1QA 2X4SA 4OAWA 4P46A 3VFGH 3IVKB 1MIMH 5D7JC 3NACL 3DOSA 5DJ8B 1YEIH 4G5ZH 1NCWH 1G7MB 3WFCH 2ICCA 5LXGL 4K55A 5J13B 2NY6C 3RKDD 1FNGA 2ADJB 2YUXA 1TENA 1N5YL 4C56B 2AEQH 2D31A 1PSKL 1ZSDA 4D4BA 2IMMA 4AYFA 1Z3GL 4FFZL 4ZUUA 4CVXB 1IRAY 1WBYA 2DYPD 2FX7L 4N0YL 4RWHA 1H37A 1GH7A 1XGPA 2PR4L 5E9DE 3SDDC 3KPOA 3F7QA 3TYGL 4U1LB 4EN3C 3T0EA 3VXRE 5EU6B 5C0AD 1S5HB 4E0RB 4PG9B 3T1WA 3KPLB 2VN4A 1ZLWH 4PJHE 3EO0A 3DETD 1ACYL 4ZODA 3QQNA 2ZCHL 5FO8B 4FFVC 1JTPA 4HH9A 5E00B 1XMWA 1H0DA 1KEMH 5CJ8A 1JE6A 5F44A 4UT7L 3FO9A 3MQIA 1UH4A 2KQNA 4UTAL 4D9QD 4KUZH 2OTUA 3RI5F 2DD8H 2BXZA 3RHWK 1EK3A 3GO1L 3QSKB 3MUJA 2ICWA 3BPCB 5J12B 5KZCB 4JFYB 3ALXA 2KL6A 3AAZA 3RBGA 4ZD3H 3C5ZA 3BE1L 3VXTB 1HNFA 1JF1A 4X9GA 4R7NA 1CXIA 5DD0H 3QFJB 1I3GL 4YHMH 2P8MB 3W39B 3HMWL 4PJGF 4QOKB 1WQVT 1ZTXH 5FYLE 3B5GA 3L95A 5BO1H 3KPSE 5CD3A 5C8JB 3GHEL 3X11B 1I3UA 4GW1B 4L4VD 1H3CA 4LMQI 5D7KE 1A7PL 2YRPA 3GSWB 3G6AA 4WI4A 4ONGL 1D8DB 2G60H 1QRND 1DVFA 3EFDL 4JN1L 4RGNC 5A2JH 3WN5B 1I1YB 3FFCD 4EZMA 1DDHA 1HZHL 4KDTA 5SV4A 1OAXL 3UBXA 4A2MA 2D0GA 4NQXA 4WU5B 4ZUVA 5FUCE 1EEZA 5I18H 3TFKD 1VFAA 1MFEL 5E2WH 4N0CC 1B0GB 5INDB 3CFIC 4X5WB 1PD6A 4W70A 4RBPH 5BO1L 1K4DA 4RFEA 5J1AA 1I1CA 3DECA 4OI9A 3TPUB 3LS5L 1QFUH 4I77H 1XF5B 3LRSB 2CQVA 1Q94B 1YEGH 4XNMA 4NQDB 1PYWA 1DJSA 1L9NA 1T7VA 1DBBH 2YUWA 4F7EA 1MEXL 5AD0A 4ZTPL 4F9LC 5BOZG 3EDDA 1BEYH 2OQJA 3DWTA 4ETQA 5FGSA 4ZPTA 5JZ7C 3DXAA 3OPZL 3IDIB 3FO9B 1C1EL 2R1YB 4YHPB 4YK4C 1LO5A 2MKWA 4F7PA 4WRLA 3MROB 1IQWL 5F7NC 4MCYA 2AQ3A 1VHPA 4UNVA 3WFDL 1DE4B 5AYUL 5E95B 2GK0A 4F9PA 3CH1A 3ZYJA 4E0RA 4RGOH 5B4PB 2CRYA 1T04B 5GJTL 4XMLH 5D9SA 1C1EH 5IMMA 4GKNB 3C60C 4M6AA 4ODTH 4OZGA 1Q38A 1RU9L 1AI1L 2GTZB 2OR9H 5IW6A 3I50H 5ISZB 1SY6L 1OT2A 2VDOH 4YFEA 5EOCH 1EX0A 2CUHA 4WFGD 1JFQL 1EGJH 1U8OA 2C3WA 2CR6A 3H7BA 5F7LB 3UO1H 1FNHA 2BNQA 1AQKH 3HC0B 3WKMH 2DLHA 3CVHA 1ZHBA 5GS1C 4M5YL 5DRNA 2FSEA 4U6XA 3KYOA 1WLHA 2VL5B 2WBJC 1K6QH 2YBRA 1CDCA 5CJ5A 1T7YA 4X4MA 3RVXC 1WT5C 5HGBA 5GRUL 3IGAB 4FQIL 1WBXB 4JQIH 2QHRH 2ZOKA 5GS1A 2JJSA 3U7YL 3T77A 5LVEA 2RJMA 4AENA 4IOSD 1RFDL 4WCYH 4FZ8H 2IWGA 4YBLC 1FG2B 1OL0A 3P0YH 1BD2B 4LVEA 1LEKA 2UWEB 5FECA 4JFXA 1UM5H 1A1OB 2XN9E 4Y1AD 2OJEB 3L9RB 1FYTD 3KXFA 3MLXH 3D0VA 3QEQD 4PJ9C 3D3VE 1S7QB 5DHXB 2BEDB 5DRXA 4IRJA 4ALAL 5C3TA 2ARJB 2M26A 2YZ1A 5C07E 2W91A 4XWGL 4HJGA 4ELKB 3DBXB 4YAQA 5ELIA 4DTGH 4GAYB 2EDHA 1ED3A 3HC4H 4NYLA 1K8IA 1IGFH 5A16B 5GZND 5E1AA 2HLAB 5DMIH 3WV0A 4HXAH 1MCSA 3QDJE 1PGRB 1Y0LB 1E28B 2HFFA 4XPTH 1T1WB 2OTWA 3EFFB 4RZCA 3F7RA 5DVKA 4FZEH 1FG2A 5CBEB 2AV7A 4C55A 1LP9B 2VLKA 4P4RA 1A02N 1TVDA 3VFNB 2J2ZA 3BH8B 2R2HA 5GGRA 1QO3B 1D5MB 2X4QB 4ODWB 5D5ME 2AEIT 4JY4B 4C83A 3JTSB 4L8SC 2P49B 2X5PA 5CINL 1N5AB 1T0NB 2HRLA 2V8IA 1R3JB 3BJLA 4L1HA 4NQUA 4X9IA 5DJCA 2VL5A 1MJUL 5KSBE 3UTQA 5ADOH 3HNTH 5IHUH 1CQYA 3GBNL 2O26U 3CSYB 4N5ED 3GBMH 4MJ5A 5E8PB 4OZGE 4YFLI 3BQUA 1E6OL 1C7TA 1I85C 3AGVA 5C08B 3V8OA 5CKAA 3H7BB 3VXUE 2NY4C 3Q6FB 2CLRA 4NKMA 5IQ7H 3HB3C 4EDWH 3O41A 1R0AH 3DLQR 4I0PD 1C5AA 3BPLC 3UTSA 3BKML 4NJAH 5HVFB 1A6TB 4OD1L 1RZIA 4UT7H 4JFED 4YQXL 2GCYA 4P39A 4WWKB 4NDMA 1T2QH 1TQCB 4U0QB 1Q9LB 5KTEH 3S37X 3E37B 4K9EL 5FA3A 1TQBC 4B41A 1J05B 1D6EA 1AH1A 1DE4A 3GSVB 1GZPB 3BIAX 4P2OD 2VJXA 4NPYB 3GBML 2VXQH 1F6FB 1H5BC 1D7FA 3SEPA 3HE6B 3NH7L 4UV7L 5IMKA 4MNHA 3WNMA 3MLYH 4DGIH 2VDKL 4ETQB 1NLDL 4U1MA 5T33H 1S7RB 4YXLL 4PJFE 4RMVA 3DVFA 5B38B 3BP7A 3DVGB 1I9RH 4G6JH 2F5AL 2RCSH 3L3KB 1ZA6A 3QIBB 3H9HA 2DN7A 3PIQA 2ADFH 4LGRB 5L2KA 4YH6A 1KT2B 3ARDD 4ORGA 4P9ML 2ICWJ 4AEEA 2YRLA 1X5YA 5DJAB 4X5WA 4GUPA 4N1HB 3KYAA 1H3PL 3CMOL 1KELL 2V7NB 3KXFD 4HDIA 5JMOC 5DFWH 3QNYB 2B0SH 5DQDH 3T2PA 3JUZA 3TZVA 3VFVB 3MLYL 4GXUM 4LDOB 5HGHA 1X44A 3LIZL 3ET9F 1RJLA 2FL5B 1CGYA 3PWLB 3VXQB 5T5FL 3BDXA 4MQXC 5TE7L 3QZWB 2X70A 1YNTB 3ULSA 1R76A 3QDJB 2Z31A 4JFQA 3L95B 3W2DL 4LBEA 2WY8A 2PO6B 1TZHB 2VLME 1U6AL 2KPNA 2O61B 1U58A 3QFJA 1EPFA 1AKJB 5HHMD 1IGCH 2KH2B 3C5ZB 3KQ4A 1A6VL 4DFIA 4MAUH 1FVDB 3K46A 2BOCB 5AEAA 2E9WA 3GMOA 3ROLB 1YECH 4FMFA 4D94A 3DXAD 1FGVH 3SDYH 3WFDH 2A83B 5C9KA 2FGZA 4HCRL 1HQRA 5ALBH 1XGYH 4ZO8A 5CP3H 1BBDH 3BVNA 1MWAA 2VABA 4ZFOL 4Z76A 3ULUH 2CMRL 1DCLA 5E00A 1ZGLA 3SBWC 3K1KC 5M7QA 2W60A 4Y4HD 4TSBH 2F8OA 4F8TA 4MQSB 2NXZD 2CKBA 4H0GA 5DURD 3Q6GL 4KQ3L 1E4XL 2VQTA 4U1LA 4OCNC 3D85A 1VACB 2WZPD 1T7ZA 1MCKA 2E6QA 3PQYA 3KPRA 4UNUA 5IIEA 3TCLB 4KMLB 4MXVE 3MBEC 1CN4A 4QRPB 4K2UL 4EI5A 3UBXG 5HY9B 1QBAA 2VZUA 5HPMB 2XZQL 2EDTA 2FYYA 2F54B 4N0UA 3CLEH 4PJDE 4I13B 4LSDA 5IM7A 4WHTB 4FQIH 5D7IA 1KLUA 5JXEA 3Q5OA 5F70A 1GGIL 2Y5EA 2EIZB 3WLBB 1KIRB 1G7QA 1KIPB 1QEWA 2X4UA 5IF0B 4PJBB 3NN8B 3FTGA 1IGIH 3LKRA 1RZ8A 2PW2B 4U1IB 4G6ML 1XGUA 1VFBB 3DROB 2O5YL 4PJIA 4WW1A 4CUCA 3SKNB 1MRDH 5JW3H 3MBXL 3HMXH 4PLOB 3LRGA 3MACL 4M62H 1A0QL 3BZEB 3O4LE 1IQDA 1KENL 1RD6A 1FFOA 4NN7C 1EHLL 3RVUD 1CD9B 4BSWB 3GSQB 1OTUD 1MPAH 1FL5B 4PJ8B 3SHSA 1G7JB 3RWHA 4PY7B 3KPMA 4OD1H 3V2AR 3UZVB 1DQQA 1CD8A 1IAIL 5GSVA 6CGTA 2GITB 4U6YA 4KTDH 3WD5L 5BVPH 3QUKB 1MJJB 2VXUL 1X5XA 4G8IA 3HE7B 5JZ7D 2DWEB 2GI7A 3DX8B 4UIMA 3O2DA 1ZOXA 1MZCB 3VFRA 1IAIM 2JB5L 2C3XA 4D9QE 2ITDA 4FFWC 3MV8B 1D8EB 2LFGA 3RY4A 4Q7DA 4PJIE 4D0BB 4QGYA 4YBHA 4HKXB 4MQ7A 2YPLE 5I8EA 3CH8A 2PW1B 2FATH 3ESUF 3Q5TA 5F88A 1Q0YH 3IFLH 3SCMA 1UWEH 1QACA 5D93B 1S7XA 2JF1A 1OAKH 4K8RL 4UQ2B 4EUPH 4I18A 1H3WM 4LNRA 1PFCA 3V4UH 4XI5C 1OAYH 2CKNA 4CU8A 1HK6A 3VU2A 3BQUD 3WFCL 3ABZA 1HIMH 4PRDB 3L7FB 4CMHC 4P59H 4L4JA 1FL3B 1L7TL 4N8PA 3MV11 1Q0YL 1OHQA 3IFLL 4GG6F 2YKLL 2XTJE 4JM2F 4QHNA 3MRQB 2NZ9C 1NFKA 1RIUH 2B1HL 1H15A 4GKZA 3QQ4B 2R0WL 1M7XA 2VDLL 3PABB 3GI8H 4LLDA 5B21A 4ZAKB 5IHLB 4HKXA 2DMCA 1NBZA 3P4NA 1GC1C 4I9WD 4OIIH 2YHGA 1W2KT 3EJYC 1MHEA 1OGAE 1FNSH 2V3NA 5D72H 5IOPA 4NZRH 2UWEE 5CHNA 1I7RB 3T0WA 1RULL 1VENA 3QXAA 2NX5B 1EFQA 1UZ6E 5DVMA 1A6VH 4MWFB 4P23B 5E6ZA 5I8CA 5K9OB 3HE7A 1GGBL 2A6IB 2HTLD 3SE9L 15C8H 4YDEB 1SJHA 4EN3B 2GITA 3OV6A 3NTCH 4OUUB 3QCUH 4EOWL 3L5WA 4JO2H 1R24A 3TIEB 2SEBB 4R4FL 3CFBB 5F3HB 2AERT 2C1PA 5GJSL 1FL5A 1OY3B 4DZBB 5I1HH 3OZ9H 3S6CA 3TT3H 1WWAX 2CJUL 1G7LA 2HT2D 3ZYOA 2AQ2A 1Q0XH 3MLTA 2HFGH 5IUSA 5IEKA 4KAQL 2NLJA 5C0BB 4L4VA 2BNQE 4M7JL 5IROC 4LLQA 3GNMH 4PLKC 3SKNA 1BOYA 4U6HA 2W59A 5I1AA 3DROA 2E8ZA 4AG4H 2PW2A 4YXKH 1QR1A 1B2WH 3DVIA 3UPRA 4MB4A 3LEYH 5EU7E 4K9EC 3ULUD 1ZVSB 4M4RA 5J6HB 3CD4A 2DDQH 2ORBH 3MJ6A 5L0QB 1CG9A 5DUMH 4RGNE 3IDGA 4LHUA 1FO0A 1CWVA 4XHJC 5D1ZC 5KANI 1UFUA 3ARBB 3HZKB 3SKJL 2MCG1 1IEAA 1CL7L 2JJWA 3MV01 2OJZL 4KJQC 2DQUH 3MRJA 3SDAB 2WIIB 1RURH 4YDKH 4NRYB 1KYOJ 5D8JH 4NOFA 3RWIB 1NEZB 1CK0L 2EYRA 2Z92A 5J3HD 1E4KA 3L1OH 4OZFB 1SEBA 5L6YH 2OZ4H 1PEZA 1FYTE 1FSKB 4L3ED 5C70A 2FJGA 4W81A 5GGTL 4HMDA 3SKJH 1NGWB 3FFDA 1XGTB 1H3UA 3BAEH 1TVBA 4XZUB 1N3NB 3EIFA 3ZTNH 1IGMH 2XZZA 3P9WB 5ENWB 1KLFA 1WF5A 4BA8A 4R90L 4Y5YC 2V2WA 4FS0A 3MUGA 2CDGB 3MGTA 4PJ9D 3PGFH 3QRGH 1GC1L 3EYSL 1NEZA 4YO0B 5HVGB 4HV8B 5F96L 1INDH 1U2HA 1N26A 3FQRB 5B22A 4WO4C 4LHJB 1EEQA 3GJEB 1T89A 1U58B 3N1MC 1MI5A 1FBIL 1ND0B 4CMMA 5J11B 3O11A 4LQFL 5I15H 5H37H 1JN6A 1OCWL 5DZLA 4X7CC 5TPWH 1I1FA 2BRQA 2DLGA 4O51B 1N64L 2UWEF 3B5HA 4FFVD 4K7FA 4RFOL 3VD3A 4O2FA 4LHUB 2CUMA 4YDVB 4BYHA 2H6GB 5ESQA 2PYEA 3D87B 5TH2A 4JO1H 1E0OB 4YDJB 3NFNA 1DZBA 1I4FB 4MNQB 2P5WE 1U8HA 4LLVB 4Y4FC 2ZKHH 2JJUA 1SYVB 4UIKL 3JV0A 1MLCA 1URLA 3CCHA 5SWZE 5HJ3A 3NGBB 3BOVA 2CIKA 1ZT1A 2HLFC 3NPSB 2XRAH 1KJMB 3OKEB 2ICES 2YWZA 4LRIC 5JO5A 1L4IA 1P5VA 3QEQE 3PIQB 3IXTB 2COQA 1PG7H 1LK3H 4AK1A 5ID1B 3ZDZE 1CLOH 4PP1C 5FOBB 1G9NL 3RL1A 1LP9F 4HLJA 2E5EA 1YEEL 4LSQL 2JJVA 4ZYKA 3UTTA 1A9BB 3QT2A 2C26A 3RDTC 2HN7B 1CI5A 2NX5A 3QXAB 1TETH 3HFMH 4PB9L 4LNVA 1NDMA 4LAJH 1FHGA 1AC0A 1AGFB 2J88L 5ITBL 2PXYD 2J4WH 2PCPB 5GSRA 5I1CH 3CVHH 3QIWD 4HGMA 4LCWA 4UB0L 1MHEB 2P5WB 5FYKE 3S34H 5GRJH 1A14L 5DTFB 4ZAKA 3WFBL 3CZJA 3BWUC 3PABA 3TYGH 1DQLH 1ZGLM 3U30B 1RZJC 4KK6D 4JFFB 4YX2H 1FNEA 1C12B 1BVKA 3BGMB 4RGMC 3STLB 5D1ZA 5C08A 5E24E 4I8DA 3BJ91 4I5BB 4LKXB 4GRWF 3SY0B 4XP9H 5H35B 3LMJH 5E6IB 3VGDA 4U2YA 5EU5B 1J1OH 2XN9A 3UTQB 5T1LD 5F7EH 5F9OL 3HNSL 4G80A 4WFGE 3TNNA 4Y5XB 3RZCD 3PNWA 3UTSD 4Z7QF 1LNUB 3U6RB 1FC2D 5LCVL 4MA1B 1MRCL 1S7SB 4HJ0C 5GRJL 4P4RB 2IQAB 2E6PA 4MJID 3P30H 1YPZF 5KJRL 4S1SH 5JLZA 4O2CB 4XGZA 4F33A 1A7QH 5C0GA 4MQ7B 3JV6B 1E28A 5KANG 5ILTH 4GTOB 4LEOA 1H39A 2YK1H 1WC7A 1FO0L 2F0YB 4P5KA 4TQEL 4Z0BL 3TWCL 1V3LA 5HI3C 3O3UN 4QXTB 3DX8A 5D2LA 5C09E 5D8JL 5JIIA 1YYML 1WWBX 4XMPL 2EEAA 2C3HA 1DBJL 4YHNA 3EJJX 4D0CB 1P2CA 3BDBA 4YHLH 2VLJB 1RUKL 2ARWA 5DRZB 6FABL 3GSUB 4F58H 5HHXH 5I9QC 4CW1B 4OJFH 4QRTA 4PB0H 5DD5L 2XQBL 5E2WL 5DMYA 3QI9C 3ULVE 1G7JA 3T2NL 4Y8AA 1VGEH 3D48R 4OZIF 2XTLA 1F3DJ 3MLUH 1CFNB 1U42A 1BX2B 4XC1L 5EH1A 1F3DH 4AH2B 3C2SA 4WO4B 1WITA 1N8ZB 3GUTA 4EEEA 5A1AA 4PJFA 5F7FA 3WXVL 1JZ4A 5HGBB 1QLRA 5B8CB 5HXMA 4XMPH 4BH8A 1T66C 1INQA 1F58H 5HDLA 3NN8A 3MREA 2FJFB 4QXGL 3MLTB 3OJVC 1Q8MA 1YEJL 3KYOB 3ES6B 3C8HA 4DN3L 3NFSL 4NO0D 1EAPB 1MCEA 4MA7H 4YPJA 3I3EA 3MLWL 4Z95H 3C6LB 3TBWB 4DW2L 4L1DA 3X14A 4P3BA 2F8XC 1AQDB 3LDBC 2P8LA 2BHYA 1S9WA 3FT2A 2VDML 4Z7WF 4NN6C 3IT8D 2F9BT 1NCWL 1CLYL 1XH3B 1PY9A 1ONQB 1VACA 5D9SB 3RKPA 4X99A 5TQ0H 3ME0A 3O4OC 3MLSL 3TYFA 4DUVA 5C6PB 4TUKH 1S78C 4LLUA 1T1XA 4KV5E 5C6TH 4IOFC 2Z8WC 5ECJE 5EU4A 2HTKC 2VAAA 3BZFA 5C7XH 1LO5B 5FYJD 2I5YL 1IKFL 3B3IB 3T2QA 4WI9A 3UDWC 4Z76B 3O9WD 2E9BA 3PGDA 1AXSB 4H1LA 4OCRH 1ORSA 2ZISB 2GY7B 2WUBL 4MYWB 3O2VH 4Z7QE 4OGAD 1I9JL 1NMAH 1WCQA 1IJ9A 5IB1B 2ICEA 4P4KD 1N64H 2F74A 3VFUA 5JOEA 4PRDA 1FVDA 3B9KA 4FZ8L 5DHVB 1RK0B 1TNZB 2PO6A 1NSNH 3VH8A 4LAQH 3PF2A 2PTVA 2GAZA 4HKZA 5EORL 1YEIL 3LCYA 5D5MB 3RIFK 1C5BH 4LSUL 4PBXA 3GSRB 3RY6A 5GGQL 3V52H 5C3LD 5TF0A 1EEZB 4Y4KC 1VKXB 4NBXB 2V3PA 3UBXB 3VXQA 2MPAH 1OAZH 1EDQA 4LLWA 5I1EL 3G6JA 4K7PX 2WUBH 3STZB 1JNHB 4KK9C 4XWGH 1CICD 4F2MB 1SYSA 5B3JF 3ARGC 5HVHC 3OGCB 1DVFB 5AWNH 5TF1L 4C54A 1HH9B 4G7YH 3TZVB 1QFOA 1P7QA 1PLGL 1B0WA 3SE4C 3X11A 4NC2B 2V7NA 2R2BA 4JPIA 5CP3A 1JYVA 3I2CL 2K9UA 4YLQT 1T2QL 5DJAA 5MENE 1KFAL 5GSVB 3SOBL 2P5EE 4R7NB 1TJGL 4X7FC 1AO7B 2QSCL 1JNNL 3WJLA 1CZ8H 2APBA 2D7QA 2VERN 1N0LA 3REWA 1WSST 2MPAL 3M17A 4BSWA 4WEBL 4ZTOH 3MV9A 4R9HA 1EMTH 4E5XB 2X40A 1OF2A 4IHOA 1IGTB 5MERA 4CDHA 4V1DD 1JWMA 2GSGA 2YUZA 2BB6A 1MCDA 1MRFH 1KXQE 4MXQC 1FFQA 4AM0A 4BQCA 2EDRA 5GRVL 1F6LL 1H0DB 1PZUB 3ARGB 4LNBB 1OM3H 3QHZH 4OFDA 3U4EA 4D2NA 2AK4E 3BFOA 4E41D 4HPOH 2CKBL 3DXAE 5FM4A 4G9FE 1ZANH 3EO0B 3AY4C 2F5BH 2LE9A 1UA6L 3T04D 1BAFL 3HAEH 1T6VN 4G7VH 5J1TC 4Z77B 5EUKA 4B5EA 4NQSA 1LMKA 4KDVA 1NLBH 4XAKE 3MRMA 4YC2C 3D3VB 5E9DB 3I6LE 3S37H 2W9EH 5JXEC 4F8QA 3O41B 2HVJB 2F54A 4N0UB 3FB6A 2BMKA 4NBYB 5EU7C 3S3JA 1II4E 3WXWL 4R96A 1MRFL 1OWWA 2KUTA 4OV5A 4GMTH 4P5TC 1B6DA 3SDXE 1QHPA 4HIXL 4PJHF 3RIAK 5IIEB 1FZOB 2G0DA 3PQYB 4LF3B 1RUQH 2P4AB 2ZSWA 1YJDH 5HYQA 3D85B 4LPUA 5JXAH 4E42B 2OK0L 5TFSH 2EDLA 3N9GL 3KJ4B 2VDQH 1UCBL 3QYCA 3RPIB 3W9EB 4JQXA 3E6FA 2GUOB 1N0XL 1HHGB 3LSOA 3EYVB 3BH8A 4K94H 5KS9A 4DN3H 2VDLH 3NZ8A 1G7HA 5I16A 4M1DL 3BVNB 4LCYB 4OIIL 1WIPA 3V4PH 4WI2A 3KS0H 3TO2B 5FO9B 4WHCA 1F6AB 3QDGB 2FB4H 1QOKA 4HK0A 1YEDA 4O9HH 5KW9L 3I85A 4XNQA 1NANI 5C0CA 5I19L 2GHWB 5I8KH 3WUWB 4EDXA 1YJDL 2VZ1A 2VISB 1F2XK 4X5XA 5IB3B 4C1SA 1VB9A 1M71A 2F58H 4PBVC 2ZUQC 1UG9A 3QO1B 1N6QH 1G0DA 5M95B 3FB8A 2J1KA 5TQ0L 1JPGA 1OSZB 4JRXA 5EIIB 5ICXB 2P8PA 4MD5A 4LL9A 5F3BB 5IG7A 4JM4L 2Q6WA 4WFEE 3KLHC 1NMCB 2CLVB 4Z7VF 1CIUA 3SFXB 2ARJA 2RFXA 4LP5A 2FEDC 4IRJC 1HOCA 2E27H 5C0JB 5TE7H 3BIBX 1S7QA 1BPVA 3B8SA 4DVBB 4DCQB 1MJ7H 1QD0A 5C0CB 3W2DH 1KC5H 1FRGL 2JJSC 2H45A 1U8KA 1QQFA 1NUNB 3L3GB 3QDGA 3DRAB 2EEDA 1EFXA 1LEKB 1MFAH 1RMFL 1AIFA 4HIHA 1HH6A 1RZ7H 3KG5A 2I24N 1AGBB 1KN2L 1P4LA 2VDOL 4HEPG 4JEGB 3VFOB 2G2RB 4FFYH 1S9KC 3IGAA 5EOCL 1OD9A 2F53D 4HS3A 1JPST 1P69B 2CK2A 4NFBA 4LKCB 4Q97A 2IANE 1V7MH 4WHDA 4Y4KD 3UEZA 2CIIB 4EIZC 3G9AB 4NO3A 1A3QA 1OAQH 5E5MA 4G6KH 3H9SD 1U8MB 1A5FL 3PWPB 1HXYB 5DRNB 3F58H 3GIZL 1GIGL 4HKJA 1BQLL 4OFYD 4O02L 1W0WB 3GSOA 1NUDA 1S9VB 5IB5A 2J5LC 2WW8A 1XCQB 3V5HA 5FM5M 3GHBL 5B38G 3G5ZB 3FB6B 4TNVK 1RZ7L 1S5IL 5C0FB 1NC2B 1IKNA 3KPQB 3VWKD 2BY3A 5L9DH 1FP5A 5ABDE 3MRMB 3B6SA 1DBML 4LVNB 3G04A 1UYWL 3MRKA 1GXNA 4D9LL 1H3VA 2HKHH 4U3HA 1AXTL 3FOLA 2H6IB 3TH3T 4FQ1H 2X10A 2HTKD 3GMQB 3PDDA 1OGTA 3DRQA 2OLDA 3KLHD 3VE0B 3RAJH 3EZ8A 1P9MC 1QPXA 1IM3B 4OLZH 2GTWA 3LS4L 3SGEI 4EUPB 4JZNA 4AM0B 3V5HB 1BVZA 4EI6B 1K3IA 1UADC 4R90H 1XCQA 2AJVH 3SQOL 4HXAL 3SGKC 5MERB 4LAQL 5I75C 4KU1A 1M7IA 4DKEL 2YS4A 2NY2D 1U3HD 1L6ZA 5IROA 1FNFA 3LY6A 4FQ1L 4GS7B 4H20L 1ZS8B 3F7VB 3REWB 3FT4B 2W9DH 1HXYA 1UWEL 4GRWH 3HMXL 3F6IA 1DQDL 5FYKH 5DGRA 2H9GB 4P9HH 2IG2L 2B4CC 1OCWH 1MCPL 3AC0A 4Q6YA 4DOHE 1BWMA 1IEBA 2XWJB 2YMXH 3VFNA 1RIVL 2GW5A 5I17A 4KKIA 3VXSE 1AGBA 3HNTL 5IHUL 2MHAA 1LP9A 1CF8H 1CD1A 2AV7B 2W0PA 3RQ3A 1CGTA 2EE3A 2A9MH 1VFUA 5CIPA 3KPPB 4M7KH 1Y0LA 2HFFB 4PJXE 5J7CC 1BGXH 4I0KA 4UQ3A 4MJ2A 1AY1H 5E1AB 4P9MH 5EZLA 1EO8H 4XVUC 1A6PA 3STZA 3WD5H 5BVPL 5JPNB 3OJDA 1K8IB 5CIPH 4YHZL 4Z7VE 1H3PH 3O0RL 4EDWL 1H5BB 5EUOA 4Y88A 3BSZL 1HKLH 5CGYC 5BVJA 3LB6D 1W72L 4GW1A 5ESVB 4HGKC 5D7SH 2QLVB 1MJ8L 3GMLB 3BPOB 3VFTB 2GSIA 4HJGB 1UWXH 4JRXB 4NZRL 1RZGB 3QWOA 4FN0A 1JF1B 3P0VL 2ZNXA 4HT1L 3VXTA 4KKJA 2P45B 1EZVX 2XI9A 4LQ1A 4N5EC 1R3IH 1J10A 3ORJA 4HQQL 5D1QD 4OM0L 5HYEA 2AJUH 3D5SA 5TE6H 2VLMD 3SPVA 5DC4B 3UTPD 1M4KA 5E8OA 2C3GA 2VXVH 3GI9L 5FECB 1BFOB 4XXDB 1AFVL 3TIDB 4N8VG 1ZV5A 3U9PL 3ARXA 3VA2C 1OD7A 4QT5B 3PGDB 1GSZA 2R8SL 4WDIA 3F12B 3QHFL 4ZNCD 5BV7H 5KSBF 1MFCH 1G7HB 1HKLL 4WUUE 4ZFFA 3VMOA 4ZPVB 3FFCA 4OD3L 5KS9B 4OZGF 5D1XD 3L6FA 4GQ9H 1NEUA 1BQSA 4TVPL 3ZYIA 1OAUH 1WT5A 4JM4H 4XCNB 5MHSD 5C07D 5KSAD 2FSEB 1ZHBB 4HUXA 2FIRT 4PV9B 5GGSA 3HC0A 4M5YH 3RWDA 5J11C 4UUJA 3JWOH 3K1DA 4KHXH 4PYHA 3GI9H 4R96B 4GXVL 1TJIL 2CGRH 3X14B 4IS6B 3TN0D 4X8JA 5EPMB 1D5ZB 1GOGA 2ADJA 2B20A 3B5TA 1JNLH 4DZ8A 1FIGH 3OG4B 1XT5A 4Z7NE 3JBG7 1DQJA 4PJDB 2FEEL 3HNVL 4XCNA 1DANU 1GXEA 1X5LA 3R0MA 1IC5H 1UM5L 2FJFA 1FSKC 1YEKL 4NCC1 2R69H 2JB6B 1KZOB 1QNZH 1FFPB 4PJFF 4Z78B 1IGCL 3HZVB 4ODTL 5KAQG 3X17A 1N7ML 5HGDA 3V5DA 2VLLB 1U8QA 1MF2H 2P1YA 4RX4D 2C3VA 5F7YC 3FQXB 5C0DA 5B4MD 2R2LB 2OL3H 2E7BA 2XZQH 3U48A 4QRRD 5CJBA 3RI5K 1CYGA 4WW2B 3M17B 2GJ6D 3U30C 3MOAH 3MODH 2HFEB 4HLZG 4WI3A 3MOBH 1A64A 4ZS7L 4MQXD 2HMIC 1O79A 1NMBL 1XF4B 1UB6B 3PP4H 5HDQH 2IADA 4ZRQA 2X09A 3LPGA 4JQVC 3DARA 2VZOA 3QB7C 3D9AL 3B9KC 5INDA 1TDQA 4JHAH 4C4KO 2Z4QB 1LVEA 3SDCD 4LLYB 3WIFA 1QRNE 1XGQA 2VQ1A 4XVTH 1MHCA 5EUOB 5MEPB 3VFPB 1JYWA 5KVEL 2Z8SA 3B8YA 1I85A 3QAZB 1NPUA 1HSAA 3P0YL 5JPNA 4FP8L 1IAIH 1ZHNB 4PRIE 3TBTB 3LKNA 4HW6A 5H94B 4ODHL 3U7WL 4DKEH 3T4YA 1IKNC 5KOMC 2ZG3A 1FT2B 4JRYD 4LRIA 3GSWA 5E2JA 3H3PH 2V5YA 5JA9A 4ZXBB 4XAWH 1S7SA 3RWGA 4J4PD 2AJSL 1NGPH 1MFBL 3DX9A 2W1NA 2X4TA 4JVUA 2JLLA 2RAMA 3B43A 1CDHA 4UDTA 2FECL 1RIVH 2K7QA 5CEZL 1RHHB 2NY4B 4KC3B 5T3ZL 4U1NA 5EU5A 1GOHA 4GQPH 2A73B 3OJMB 4Y4FB 2ICEB 1QVOA 2NY5H 2Z0BA 3HE7D 1GPOL 5J6GA 4XCFL 3GSXA 1PSKH 3FB7A 4UMGA 1BIHA 4JRYE 4X7TB 3T0VA 4HS6A 2MQCA 1SQCA 4RIRA 3OHXA 5DFVD 3HZYB 5CSZB 3BQUC 4NUGL 2V2XB 3ARFC 5EWIH 2BVTA 1A0QH 4QOKD 4OF6A 4NZDA 1PBYA 1NLDH 3FQWB 1KJ3H 2MTPA 5INCB 3OBAA 3HS0B 4PV8B 4HAGA 3GMRB 5IKCB 1QBBA 4IIQB 3ARFA 4JANB 1NC2A 2C1OB 3KHQA 5TE6L 3UTTB 4HUNB 2P8LB 4QRUB 3B2UD 5FYKL 4UTBL 4XP4L 1MI5E 3IDYB 4H8WC 2DBLH 3WN5C 4OLEA 4GRLD 2VTFA 4ZO9A 4KMTL 5HDBE 4XP6H 1J5OL 3V6FB 4H25B 3UJTL 4OBRA 1JGEA 5JIHA 5FDWA 2VITB 1LD7B 1FJ1A 3HRZB 4QEGA 5FYJH 3V0WL 4P4KC 4U7KA 1CBVH 15C8L 3C08H 5JO5B 1MREH 1HKFA 4EOWH 2VSDA 4U6VL 3BYTA 1NCTA 4JLRB 1YZZA 2G2RA 1Y6MR 2XWBA 4LHUG 1FYTA 1GGBH 1N8ZA 4KXZI 4RGND 4P4KA 4XBEL 1RZKC 3QPQC 1WUNT 1LO3H 1LP9E 4HIIA 1EFXB 2BBCA 2DBLL 2ZG2A 4OF8A 3SFYB 3HE7C 4MJIA 4APQB 4V1SA 2QKIB 5FIEA 3ZT6A 4EN3D 4YDVA 2IQ9H 2JCCA 3HCVA 1A7RH 3U46A 3TT3L 2AEPL 5T1KA 2FO4A 2FR4A 5DUPL 1P2CB 2HFGL 5F1NA 3HA0A 2XN9D 2YN5A 5L0QC 1Q72H 1O1SB 2J6EH 2P8PB 1NC4A 1F97A 2V6HA 1ND0A 5DQ9A 4KZDL 4PJGB 1FDLL 4JQXC 2XOTA 5DJ2B 4K71B 1T2XA 5HHOE 3E30B 4KK5C 4UT6L 4X7SL 2PXYC 1FZJA 4QGTA 3ZHKA 3T0BA 4TVPH 2NY3C 4YIQA 1YEDB 1EH9A 2NXYD 4GAJH 4MAYD 5FO9A 5D96B 4OJFL 1CDGA 4Y4HA 3FFDB 4BFIB 5FYLH 1LD8B 2G75A 5K9QI 2LU7A 3KPNA 5BZDA 5F9OH 3QUYB 3U6RA 2YUVA 4GG8B 4L29B 4OQTA 4PJ7F 3QG7H 5T3XD 3TNNB 5HYSB 4YFDB 4XCCL 5JDSB 4UV4L 1YPZE 3GMMB 4ZUSA 3WXVH 4NKQB 2BNQD 1RK1B 4O5LL 5FYLD 2NXYC 3DGGB 5DK3A 3DSXB 2F8VA 4GAJL 4K3EL 3E6HB 5JHLH 5DWUH 3P2TA 4OZIA 3A6OA 4FTVE 3CMGA 4Y19E 2XG5A 3EBAA 1RIHH 4JY6A 1FNAA 1EXUA 1FPTH 1ADQA 2P5WA 3QWQB 1C16A 4NJ9L 3TNMB 5EUKB 3SO3C 5KSUB 5HPOA 1YN7B 4Y5VB 3KSLB 1E4XH 2XA8H 3ULVF 3BP6A 1JYNA 3U4EB 3MZTA 3QEQA 5DSCA 5A2FA 2OI9C 4ZYKB 1BMGA 4UOJA 2R4RL 1CK0H 4LVOC 2G9HB 1OP9A 4RA0C 1R3HA 5C6TL 1JWMB 2GSGB 3TM6A 3O6LH 4HWZB 3HI6H 2OXGA 1G7LB 1RZKL 2XICA 1KJ2A 2DAVA 3H42L 2EIEA 1AI1H 5DVNA 1F45A 2CRZA 1FCCA 3BIKB 5JPMB 3TFKC 3FAWA 3CFBA 3UTOA 4KY1H 4HMEA 2E7LC 1I1AC 1HINL 4OLXH 2CIKB 4G5ZL 5ICYB 2DQJH 3T0EC 1MUJB 3VFWB 3IDMB 5JORA 1RZKH 4JRYA 5K9OA 3DUSB 5DD1L 3NAAH 1S9YB 3I6GB 1A6ZB 5C08D 1WICA 3OGCA 3SKOA 4JDVA 2L4OA 2YD2A 2VB5A 3PL6A 4QNPF 5BS0E 2BVYA 3QXUA 4Y89A 5HYSG 1ZKAA 2VDNH 1CLOL 4WI6A 2EC8A 1FBIH 4G9FD 3CFDB 4M6NL 4JFDE 1I1FB 4JB9L 3OKDB 3PDGA 3F5WA 3CVHL 5ID0B 4U6VH 3GB7A 3TP4A 3VFGL 1Z2KA 3NCFB 3S36X 3F58L 2HVKA 1NFDF 4L5FH 1CT8B 1I7ZB 1YY8B 1FYHB 4U7SA 3ULUC 3P11H 4HWBA 2PKDA 3CZFB 3RY6C 5IB1A 4POYA 4JFZH 4XT1C 5E08H 4GG8A 5D72L 1AJ7L 2BNRE 3DSUB 3QWRD 1J11A 4X4YB 3OXRA 2Q86B 3WNNA 5IFAL 3DPYB 3PDOA 4GTRB 3V7AE 1S7XB 2EE6A 4DGVL 3KPNB 4F9PC 4Z5RB 5BZDB 4YDLB 1IGJA 3DO7A 2P5EB 1UWXK 3HZMB 2PR4H 1QSEB 4PS4L 4JHBA 4D0BA 1BD2D 3BPLB 4Y4HC 5E5UB 2H26B 1ZTXL 3MRBA 4Y1AB 1OP3K 5CBAB 2O5ZH 1F42A 5JOFA 2AW2A 5IVNA 4DVRH 3P77B 3LD8B 4ODVH 3A67H 3O4LB 3OKNA 1S9XA 4JN2B 1ONQA 5EBMA 4PJGA 5EFIA 2OSLA 3P11L 1TNMA 4YDIH 1WBZB 4OD2A 1MAJA 5B3JE 2AJVL 1BOGA 3TBWA 4TUJA 5C09D 3W5NA 1N6VA 4MA3B 1V7NH 2V5SA 2NZ9D 4U05A 2CD0A 3C87A 1ZLUH 3UYRH 2FECI 4L8SB 2JCCB 1HEZA 1YPZA 5GRWA 2P42B 1IAKA 1HYRC 3L3IB 4FQLH 2XG4A 1B2WL 3OL2A 3OWEA 3L3HA 3IETB 4I3SH 4KVCL 3DV6A 1AHWC 4XCYB 2D0FA 1UJTA 3MREB 4HKBB 3WIIL 4Q9RL 3VG9C 3OJ2C 5D7LD 1TMCB 3VWJB 4ZNEE 3EOAB 4ZD3L 1PDKA 4NQEE 5AG8A 3UMTA 3LN5A 5DQDL 5I6XB 4LLAA 3DTXB 3UAJD 4ODSH 3U0TA 1YQ2A 1QYGL 5HHOA 3VH8G 1IC4H 1FPPB 5AZEH 1NBYA 3NCCB 3SJVD 3TESA 1R5VB 4NQVA 4YNYB 4H25A 5K9KA 3V6FA 1I7TA 3MLRH 3BP5A 4QRTB 1F13A 3RVXD 4WGWB 1MCWM 4YZFE 5AYUH 4MA3A 4Q74A 3WS3B 1KIQB 3MUZ1 3TVMD 3HLAB 3NZHH 4D8PB 2W0FA 4EI5B 4CVUA 5FUZL 3TO4B 3MLPA 3MSPA 5CZVL 3ARFB 4H1LG 4GRLC 3ARWA 4XRCB 5LAXB 3CLFH 5IK3B 1DSFL 3K8MA 4YBLB 3UTPE 4P5TD 5E2TH 3WEXA 2D03H 1A4JB 5FHBL 4RAHA 1YDPA 2D2OA 2GK2A 5KS9E 2I9LA 4KJWC 3KHOA 2VR5A 2M2DA 3ULUL 4PRPA 4X6FB 4OLYH 4A6YA 1IGJB 1NFDE 3DO7B 1G6RA 3ZSTA 1J1PH 3RX8A 1TXKA 3C8DA 2B39A 1FAKT 4Z5RA 3D18A 2HH0L 4GBXD 4BQ9A 2XFXB 2EXWC 2UUDH 3TBVA 3ZTJH 4L4TB 3S88L 4Y5XA 1CIDA 2A73A 2M8XA 3OKOB 3GMOB 4O2EA 1NFIB 3KR3L 5E56A 3ROLA 1KNOB 1EEUA 3L7FA 1H3AA 4LU5H 5I2IA 4MJ6A 1LO2L 2R39A 3AS0A 2VC2L 4NM8L 5DEFA 1TZHA 1KPVB 3VCLA 2FD6L 4LASH 3STLA 1XF2A 3ARQA 3FRUA 2Z31B 4JFQB 1S63B 2BVPB 5EU6D 2R0KL 3SCMB 1I8IB 1B3JA 5H2BB 1MNUH 3QIUD 3CFDA 2A0LD 4QXUL 3PWUB 2XTJD 3PWLA 4FNLH 1HSBB 2BFVH 3K2UH 3FO2B 2ESVE 2VC2H 4U1SB 4XWOC 2DRUA 4OCYH 3SKMB 3MZGB 2V9RA 3LB6C 4JR9H 4W6WB 3LEXA 4CAGA 1W72A 1F90H 4Y4KA 5SX5H 5DD3H 1N7MH 4IRSA 3U79A 4L5FL 1IGFL 1LEIB 5JQ6L 1D6VH 4GLRH 4OZIE 3P4MA 3QCVL 1CTNA 4N0UE 3K2UL 1RV6X 4G3YH 1MHPH 1YEEH 3VMPA 1AXTH 1SJEA 4LRNL 3L3OB 3PL6C 2EDFA 3T4AA 4MXWH 2OL3B 1I7UA 1A7NL 3VRIA 1I3RB 2HFEA 4H5SB 3NA4A 5MENA 4FNLL 5B38A 1S78D 1I8LC 1UT9A 4R0LC 2EH7H 2NR6C 1S7RA 1M7DB 3AY4A 1VSCA 3CDGB 3EYFB 3QI9A 2VLRE 4POZD 1A21A 3LN4A 1CICB 3V5DB 1VFBA 4WW1B 4PGEA 4UIKH 3BP6B 3QEGH 4U3CA 4FTVA 4NPYA 4ODXB 2XTJC 5KSVA 2K1MA 5I6XC 1G9MH 1NSNL 2EIZA 3WLBA 3VA6A 4C58B 4R6UA 1AGEB 2GCYB 1AC6A 1R0AL 3BESR 5EORH 3CIQA 2EDWA 1XZ0A 5CZXC 1MQ8A 2A9ML 5JW3L 2HKFH 5F7EL 4OZIB 4MMXC 1IZJA 4HUWA 1E6JL 1XEDA 4OGYH 5HHPB 1S7VB 2NW3B 3MR9B 4DK3A 1LWRA 1JN6B 2CDFA 5BRZD 3KPRB 1CGUA 1NLBL 1BF2A 2GT9A 2P46B 5KS9F 2R2CA 5ADOL 1DUYA 4S11A 3JSSA 5FGCB 2CPCA 2L7JA 1X7QB 2H2SC 4OF3A 4EQ3A 4YO0A 2YKLH 2Y72A 1NAMA 1EAJA 3C5JB 1H8SA 2Y1VA 4B7LA 2HWZL 4YHOH 1LO4L 2HYMA 2B2XH 3O8XB 4ACPA 4C83B 2GFBB 5HHQA 1WCBA 1D5MA 2X4QA 3IU4H 4C56D 4HW5A 2FDBP 4ZFFB 5I1IL 3BW9A 3J8F7 3GZKA 4AL8L 3KLDA 5FEBA 2ADFL 1QLFB 3TCXA 1HQRB 2DYPB 3VRJB 2VR9A 1TPXC 3GK8L 2Y07L 5EOQL 4KQ4L 3L3DB 4O58H 5GS2H 2HLAA 3SPVB 2CLZA 5A3ID 4YR6B 3IAQA 1AGDA 1OWRM 1DN0B 4IRZL 5L7XL 1BF8A 4XNZB 2G60L 1WAAA 2XKUA 4JM2D 4YAQB 1LO4H 4HH8A 2NY6B 2NY3B 1BEYL 3EU5B 3VDCA 4ELKA 4LBEB 3INUH 4MNGA 4KMTH 1J5OH 3LIZH 1G7IA 4NUJA