5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
b'PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
4PRBB 1FZKB 1Q9LA 2VISB 3V6FB 4MXQC 7FABH 3FN9A 2MKWA 1NC2B 3A67L 3QEUA 4NCC2 2WIIB 4PJCF 3QNXA 2BY2A 5TJWK 5LJYH 3O3DB 2VISA 4PLJC 1NC2A 1NFKA 2WIIA 3TN0D 1Q1JL 2YPLE 3O4OC 4JM4L 1NPUA 3WKMH 2NY4B 3CMOL 1I9RH 1CICB 2PW1B 2M26A 3ALWA 4CMMA 3S88L 5HPMA 4XVSH 3ZHDA 2CO6B 2R69H 2CO7B 1MVUB 3MV11 5D6DC 2PW1A 3O11B 3PWLB 2HRLA 1RVFL 5FB8B 3NIFE 1T2XA 1WBYA 4D9QE 1BFVL 3L3DA 3RTQD 3KPOB 1H3PL 2E6PA 4JAMB 4P39A 4KTYA 2NYYC 3T04D 3EYSH 4MMXC 2IALB 2AJYL 1LO5B 4I3SH 1G7LB 1ZTXH 2BOBB 3KPOA 2ZCKL 2FLRT 3QBTB 1JTPA 2V7NB 4NKOB 4PRPE 1IMHC 1LO5A 3GHBL 1G7LA 3AU1B 2BOBA 3C5JA 4HCRL 2DM4A 3DMMB 2ZG1A 3UC0H 3TNMB 1U8KA 1NGXB 2V7NA 4NKOA 4X8JA 1A9EB 3MYJB 3IDXL 4GG6E 5CGYD 2YPLD 1YMMA 1I3GL 4HMCA 4WCYL 5GRVK 1N0LA 4FA8A 3HC4L 4B53A 1PSKH 1NGXA 5L0QB 3GSXB 2BVYA 4CDHA 4XCYA 5IHBA 1U3ZA 4KJQD 4DGYH 5K33A 1JWSB 2DQJL 3GSXA 3UXFA 3ARYA 4PJEE 5HYJE 3IAQA 2ESVE 2OP4L 4D9QD 3MV9B 3BIKB 2XKNA 4U1JB 1JGUH 3MA7B 1KT2B 2R0ZH 2XIDA 4BSJA 1JZ5A 1NLBL 2J8UB 2BB5A 5C07E 1AXSA 4J4PC 2BXZA 4PRPD 4U1JA 3BP4B 1NDMA 5TPWL 5T5NG 4M4RA 5F7UA 2B5IC 3UYOD 3QI9A 1HHKA 1P4IL 3GMQB 3ES6B 1AD9A 1ERNA 3BP4A 2WZPD 1RU9H 3B2UD 3BGAA 1MJ7L 1TNNA 5GGVY 4BH7B 5KZCB 3QIBB 3VWKA 3TC9A 1HKFA 2PR4H 3ES6A 1JCQB 3NBNA 2HT4C 4MJIB 4OZGA 5JA8B 4BH7A 3F65A 3IVKB 2FH6A 2BNQE 1M7IA 5AEAA 3MCKA 4CJ1A 4Y5VC 1M7XA 1SQ2N 2A6DB 4CN6A 4JPVH 1NBZA 4OZIF 2NLJB 4ODWB 3IVKA 4RMWA 4I3RL 1QSZA 1CD0A 5DFVD 1FYTA 2R4RL 4P2QA 2GI7A 2ESVD 1XGRB 3BZEB 2A6DA 1CFQA 3OL2A 2RJMA 4YDLC 1N6QH 1MCOH 1DQML 5CLWA 4ODWA 4GFTB 3QEGL 4M9OA 4BH8A 1FO0A 1O1TB 5EDXA 4DVBA 5E7BA 2JKXA 3O6KH 2FX8L 3V8CA 1XGRA 3BZEA 4GAJL 1GHFH 3T0EE 5L6YL 3DETC 2AAVA 5C07D 4QXTB 3D1MC 2H8PB 5CJOL 5BW7A 3T09A 1EAPB 3GZKA 3SE4C 1UZ6E 4QRQB 3DSFH 4QRRA 3KPQB 5IV2A 1HSAB 2L4OA 2ENYA 5LG1A 1XF2A 1EAPA 2YC1B 4M7LT 1YC7A 4QRQA 1FE8L 1PKQE 5DA4A 1SEQL 4E9LA 3G5YB 4HUWB 1H0DA 1WBXB 1DQLL 4LSDA 2YPVH 1XF1A 1QQFA 2YC1A 3TJHD 1TETL 1WBZB 3FONA 3J7HA 4KK8D 5GHWH 3W9DA 1P69B 1X6NA 2BNQD 2J8OA 3G5YA 4KRPB 4A6YH 4ZQKB 4YK4B 4XBGB 4XCFH 4ZFZB 3MRLB 1WBZA 4PLNC 5IVOA 3DO7A 3NZHH 2LABA 3MA9H 4ZQKA 1IEHA 3I02B 4XBGA 3QIWD 1MREL 3OPZL 3S7GA 4GW4A 2D03L 1CGWA 3SGKC 3OKDB 2OX5A 4MQ7B 2VR5A 2GSGB 2VLRB 4G8EB 5KOMC 1RFDL 5AYUL 3NACL 4Z0XB 3LD8B 1GOHA 4LPCA 1QFWM 4MQ7A 5BV7C 2Y6SC 2FECI 2GSGA 2VLRA 2Y4SA 1MUJA 1KIRB 3C5ZD 4Z0XA 5IROA 3ZE2F 4ELKA 3T4AB 2NW2A 5F1NB 1V7NL 3V52L 2BVQA 1D6VH 1FDLL 2BNRB 4QTIL 4GLRH 4Q9CA 3Q5TA 1HWHB 5F1NA 1MQKL 2BVPB 2JLLA 2VZ1A 1INDH 3KHQA 2BNRA 1HZHL 4YWGL 4FZ8L 4GQ9L 1IAKA 4G7YL 1YEGH 4Z8FH 4QRTB 2VDQH 3L1OH 1VKXB 4IOSD 3IKKA 4N0UA 4UDTB 5I1CL 5E00A 1BQSA 4MDJB 4OD2A 4ODHH 1TCRA 5D1XD 4OLEA 4QRTA 2R2HA 1P6FA 4DQOH 5KTEL 4F3FB 3MGTA 1LILA 1VKXA 4UDTA 3X12B 4ZTPH 5F88B 1TZHB 2Y06L 3U1SH 1FL5B 4MDJA 2VZOA 2VXSH 2VL5B 3NCYS 5C0RL 1JFQH 2QV2A 4XWGH 3AFLA 1NEZB 4PUBH 5DO2D 3PWPB 3S4SG 3X12A 3KWWB 5F88A 4CDGC 1FL5A 1B4JH 1QBLL 2HFGL 3BE1H 5T3XE 3PL6B 5AYQA 4YHOH 5TF1H 4EN3D 5A2KH 4Q2ZB 1OLLA 1WUNT 3BGFC 4EUPG 1QFWH 4YXLL 2BRRH 2W0PA 2Q76A 1WF5A 5DWUL 3PL6A 2VLLA 4WI2A 1AQDA 3GNML 1HQ4B 4H20L 4OV6F 2G75B 3QUYB 1SVZA 1YJDL 2DN7A 2AP2A 2V2TA 4G9DB 3SDDD 1ZEAL 4F7PB 3FZUD 3RZWA 1T7ZA 1BQLH 2GQHA 2VDRH 4HIJB 2YD5A 4WI8A 4NHCL 2G75A 3QUYA 4PRAA 1U3HA 3T65B 4DKFH 4F7PA 1CL7I 3HZKB 4WWKD 5GSVB 4XAKE 4O58H 3T65A 5F9OH 4XPHH 3LKPB 3RVXD 1G0DA 3WSQL 4QXGH 3V7MA 3VH8B 1M4KA 5DEGB 4N8VB 1FHGA 3BYTA 3K4AA 4UT6H 4DKDC 1FBIL 5D7LA 5KN5B 4E5XB 3CJJA 3ZO0A 1HK6A 1JYNA 4N8VA 4P2OC 2ZIRB 1GGYA 2IG2L 5T3XD 1Z5LB 5CEXA 4K8RL 5KN5A 3O2VH 4E5XA 3QWQB 2Z92B 1INEH 1RD6A 3NFSH 4IJ3C 1Z5LA 3BYYA 3V5HB 1QSFE 3W11D 2AJUL 4R0LC 5MP6H 4CNIB 4PRDB 2Z92A 4JFFB 5I1LB 2C9AA 3MACH 4JVUA 3RWJB 2G60H 4P57B 4QHNA 4YGAB 1O1SB 3HE7C 4MHHI 4XPTH 1ED3B 5CILH 3BO8B 5J3HD 3RWGB 3RWJA 4XAKD 1J1XL 1CK0L 4QO1A 1ED3A 3VG0H 1U6AL 5FAAA 1NGPL 3TGXA 3EFDL 5GRJH 25C8L 3ARDA 3RWCB 2UY7A 3O2DL 4MXWH 3WKNA 3CX5J 2R29H 3I9GH 2QJDA 1F3JB 3CD4A 4HAGA 5DZOA 2UYLB 4Q58C 5CMAB 4B7IA 1T1WB 3HB3C 1N5YL 3MC0A 3RWCA 2P8MB 2ICWI 2QSVA 5IMOB 4H1LG 1F3JA 4HBQA 4TPRH 2UYLA 5HHNB 2NNAA 4K2UL 1D6EB 2Q3AA 5LGHL 1T1WA 1QSFD 3EOTL 2C5DC 2P8MA 3G6JB 3CCHA 4XCEB 5I30H 5DQ9B 5IMOA 1AFVH 4MNGB 3IRPX 1D6EA 3TYGH 5IFAL 4HWEH 4XCEA 3U2SB 4Z77B 2H3NA 1J5OH 5C0AB 4QHKJ 2NR6D 3IDNB 1ADQL 2NCMA 4MNGA 5JW3L 3NFNB 5ELIA 1IRAY 5I18H 1JHKL 4GRLB 4MMZC 1JMZA 1MH5B 4ZO8A 2X70B 5CSGA 1IGMH 3P77B 1HYRC 1X44A 2IAMB 3H0TB 4QNPE 3BGMA 1WWBX 4GRLA 4YHKH 4WFFE 1KEML 1E6JL 2B0SL 3VGAC 3P77A 5KSBA 3ZL4L 4FFVD 2V5RA 5IP4A 3WUWG 1JGLL 1TTFA 1JYWA 1HHHB 2EH7H 2A83B 1OVZA 3IDYB 3IYLW 1MCWM 1PVHA 2AV1B 2PW2B 5DURD 1IAIM 4LKCB 4AJ0A 1AKJD 4ENEC 2KDGA 5FYKU 1JRHL 1DEEB 1HHHA 4PGCB 1XIWD 1R3HA 3MRHA 1JTOA 3E30B 2AV1A 4LPTA 3CPLA 3QDME 3V5KA 2EDWA 3V6ZB 4PG9B 1R5WB 3SJVB 1DEEA 5ESAB 3PZ4B 4GXUN 3WJJC 1BVZA 1JL8A 5DSCB 3HN3A 1PD6A 2CRZA 1RULH 5I75B 1OT2A 5ESAA 5KSAC 3L3OB 2NY3B 4Y1AB 5C0DB 5JHDA 4Q74A 3SKNA 1UM6H 4WFFD 2X4OB 2OLDA 1UB5B 1LO0L 4KKCC 5C0DA 3F5WB 1WEJL 5E9DE 3HR6A 2HT2C 2EC8A 5DXWA 2R2BA 3LKSB 1P5UA 1UB5A 1U0QA 1U8PA 3JV6B 4NQEB 4WI3A 1LDSA 4AY0A 4JO3H 2H6IB 5TH2B 2XQBL 1AXIB 3JV6A 4M1DL 1X5GA 1I7UA 2ED9A 1IAIH 5BXFA 2DJSA 5LXGH 5TH2A 4KMTL 4LCWB 1QSED 4F7CB 4L4VE 3NN8B 4CW1B 3TWCL 3FQXA 1VFBA 1IGFL 4G8IA 5IHZB 1G1YA 1WFOA 4AEEA 4LGPB 4A6YB 5FO7B 2VDPL 1H3CA 2DMCA 1HINH 5A1AA 5D2LE 1MWAL 3TBSA 5AUMA 3QHZH 2WQRA 5CLTA 4YXHH 4FQ1L 5FO7A 2H6GB 4YHLH 4U1HB 2XZCH 2ZCHL 3RDTB 2BC4A 1A7OH 4I2XB 1X5ZA 4NBYB 1NGYA 1BIHA 4JEGB 1DBML 2OSLB 4AK1A 1FSKC 4OIIL 4U1HA 1HI6A 3PIQB 4MB5A 2VZVA 4I18B 2QHLA 3WXVL 2VDLH 4TYUA 5T3XH 2V5YA 3ZE0F 4J7RA 2H1PH 4NKIH 2J3SA 3CVHH 4FQXC 1BJMA 5FYLE 5CBEB 3WEXB 4U6HA 3VDAA 4RFOL 3JSSA 1JN6B 4ZO9A 3TV3L 3MLRH 4M6NL 1ZHKB 4LMQI 4JFZH 2DI7A 5CBEA 3WEXA 3T0DA 4NZUH 1JN6A 1RJLA 4KKJA 4TTDD 3B6SB 4X7TB 4IRJA 4JM2A 5JQ6H 4HFUL 5E1AB 3MCG1 3MLUL 3TN0A 1JGVH 4JO1H 4X7TA 3AREC 3B6SA 3PXHA 1C5CH 4MS8D 4N0FB 5E1AA 2F15A 1UXSA 3MLXL 1NCAH 3VRLF 1EIBA 2BBCA 4PJGE 4XNZB 4FQJL 1J8HA 2R1YB 3RTQB 4H8WC 4K3GA 3JZ7A 1PGRB 5MERA 2HYMA 1CBVH 4L3EE 1BEYH 1RUAL 3IFNH 4JPWH 4Z7WE 2OL3H 2QSCL 1NCBL 3NAAL 1XEDA 1CG9B 1FNEA 1YY8A 2R1YA 3RTQA 3IETB 3OJDB 5KS9A 4PRID 4YDIH 4RGMB 5DD3L 5FYKL 5FYLD 2GT9A 4XP5H 3F7YB 3TCLB 4HF5H 1PG7X 5TDNB 1IC4H 4PJ5D 5K93A 1VCAA 5FYJU 2E7BA 5I1KL 3VXME 4M5YL 1HYSC 1NBVH 2YPLB 3LEYH 4P23B 1FP5A 3MJ9H 4HHAA 1KCRL 3LQAH 1I8MB 1EEQA 4ODXB 3F7PC 2NZIA 4ERSH 2VDNL 4QHMB 2YPLA 3ULUD 1ZLUK 2EEAA 3GM8A 3OKNB 3ILQC 1I8MA 2ORBL 4ODXA 2CXKA 4D0BA 1Z9OA 2HLFC 2JK5B 4PTTB 4QHMA 5D5ME 2DBLH 3Q2CA 2CLVB 3OKNA 1TPXC 1YYLH 5FA4B 5GGSB 4RMQA 1VADB 1EVUA 4U1LB 4Q9RL 5DA0B 1U8OA 5BJTB 2JK5A 2HVKB 4L3ED 2R0KH 3TA3D 2CLVA 5F7LB 3HI6L 5HGDB 2DLIA 4J3XA 5FA4A 1BQHG 4K9EH 1VADA 4U1LA 2WW8A 5EN2B 1Q9OB 1BD2A 2HVKA 3V6OE 4YDEB 2R9HC 4PRPB 4P4RB 5HGDA 1FGNH 4OT1L 3PABB 4JDTH 3VXRE 2VQTA 1RAMA 5GGRB 4YQXH 4J3SA 4KJWD 1HNFA 4PRPA 2YD2A 4P4RA 3VXMD 5GIRA 4GG6B 1A6ZA 1BJ1J 3SE8L 3IXAB 2CRMA 1MFEH 2FDBP 3LKNB 3KVQA 5GGRA 1IFHL 4JFDD 4GBXC 4JRXE 4Y4HD 1IBGH 1P9MC 5EOTB 5D72L 3IF1A 2VAJA 3LKNA 3NIDE 4WW1B 4C1SA 4DGIH 1Y6KR 3FB5B 1EFQA 2Q86B 1QQDB 3LSOA 5INCA 1KCSH 4HGWA 4PJEB 5HYJB 3LPWA 4WFHE 4WW1A 5IQ7H 5E5UB 3S5LA 2ESVB 4D8PB 1I1CA 1U42A 2Q86A 3OZ9H 2NXZD 4UIKL 3I6GB 3UJTH 4GSDL 2WLZA 4PJEA 1T7XA 2NY0D 3S8WA 4D8PA 2R0LL 3BVNB 4GG8A 1H39A 5C07B 4X7FC 1O79A 3JBG7 1S9XB 1ZWIB 1LWRA 1LNUB 3VFUA 4M43L 4UMGA 5I76A 3BVNA 2J8UF 5IFHL 3VXRD 5C07A 1QBQB 3UYRH 1HKLH 1ZWIA 2NY4C 5KG9B 1LNUA 3DIFB 2FB4H 5I0ZA 1N4PB 5SWSE 4NQVB 5F6IB 1J0YA 4YR6B 5EULV 3MV01 4L5FH 3LRSB 4JRXD 3C09B 5HVHC 2NY2B 5DUMH 4NQVA 4OFDA 4HBCL 4YR6A 2BNQB 5FM5O 2R23A 1MFCH 3LRSA 3IU4L 4ORZC 1IAMA 5JLZB 2CK2A 3MOBL 5DMGD 1IILE 5JDSB 4NNPH 4WFHD 2BNQA 3NA9H 2AJZA 1NCCH 4QY8B 3P2TA 5JLZA 1VENA 1WC7A 3QIWB 1TQCB 3B5TA 5D4QA 1W6KA 3SDYH 1N6VA 4L3CB 2WAHA 3T0EB 1ZLSL 4K3DL 5AWNH 3RIAK 3CU7A 3BKMH 3QIWA 3MLVL 4KGLA 3P9WB 1QP1A 3CFIC 5GXBB 4L3CA 2PCPB 1FAIL 5F6HJ 3ARWA 2FEEL 4RDQG 3ARFD 4F9PC 4FNLL 3GSRB 4AENA 4M4PA 3C5ZB 3U36B 1IGIH 1KN4H 2YMXL 3UO1L 3ARUA 3I50L 1PKQB 3RU8L 4BQ9A 3VG9B 3TJEL 3GSRA 3C5ZA 4ZFGH 2ITDB 2YA0A 4NC1E 4L9PB 1PKQA 4UOW1 2FZ3B 4JJHA 4U0RB 4YC2B 2FX7L 2HH0L 5EO1B 3RNKB 3CIQA 5DVNA 4L8SB 2FZ3A 1K3IA 3QWOB 4X5WA 3OB8A 3GO1L 5D1XB 3UTZB 3ZDZF 3RNKA 3QI9C 4XNXL 2WINB 1JF5A 5CINL 5IBUG 4KTDH 1PKOA 4L8SA 2XQYK 4FZEL 4GMTH 4RBPK 5FO9A 5D1XA 5DDHA 3GSNA 3VWKC 5FCSH 4JB9L 3UTZA 5BV7L 4LU5H 1GXNA 5BCAA 3Q78B 1O7VA 4GLRI 4X6DE 4OLYL 4HS6B 3RGVD 4KROD 2O61B 2M8XA 5F7WC 4EN3B 5LVEA 3G9AB 3HPLB 3MODL 5FYLH 1Q72L 5FA3A 3H3PL 4DKEL 4HS6A 5T1MB 2ITCA 4NM8L 2N1KA 2VDML 5ICYB 4EN3A 5JHLL 2AV7A 2CK0H 2HRPH 3MV7E 3HPLA 3KPNB 4OLVL 3SDDB 4JZNB 3D3VE 1X5LA 1TMCB 1CFVH 4GTTB 35C8L 3MRIA 4PRNB 5ICYA 4IMKA 3SY0B 3P4NA 5K59E 3SDDA 1E4XL 4JZNA 2R4SL 5J4MA 3RNQA 3VI4F 4WWKB 4PRNA 5BW7C 1S9VA 1X5HA 5EU7C 2HFEA 3GMMB 5I1JH 2UWEE 1UCBL 2HJLB 2ATKA 1NMCB 2P8PA 4TQEH 4MYWB 4WWKA 5C08E 1LO2L 4I0PD 3OAZH 4K7PX 4JPIB 3GMMA 2HJLA 1AGDA 1P53A 4IIQB 4ZS7H 1ZVSA 4ZPVA 4YHZH 3LIZL 1A9BA 3MBED 3QJFB 3RVUD 4JPIA 3O6FA 1LP9E 1JNHB 4Z0BL 5C6TL 2BXYA 2CJUL 3CVHB 5HHQB 3MRDB 3QJFA 3UJJH 1I3VA 5CUSH 5B3JE 1F4WL 4J3UA 2FATL 4ZD3L 4O2CB 4C4KT 5EORL 3FT4B 4GAYB 4NUGH 2N56A 3Q6FA 1XCQB 3GMLA 5HHQA 3FQRA 3MRDA 3MV7D 1OWRM 5JDJA 3UBXG 3OHXB 1I7RB 1EZVX 2WP3O 3D3VD 4O2CA 3BP7A 4M61B 2JIXD 4FXGB 3GBNL 1XCQA 4YDKL 4POUB 1KJ2L 1LQSR 5EO9B 4G9FE 4OJFL 1J12A 2G2RB 3B9VA 3OHXA 4Q6YA 3ARPA 3MUY1 3MRKA 3P9LB 1MFNA 1FGVH 1WIPA 1KSRA 2NTSP 2G2RA 5KSUB 3MX0A 4Z7NF 4IHOB 3SQOL 5C08D 5GS0C 3P9LA 1R76A 3VU2A 4NRYA 4PRHD 5IROC 3V79C 3O2WH 2OJZH 5EIQA 3RQ3A 4F80A 3HXEB 5C0IA 3FAWA 4A2MA 3BPLC 3QXDB 3OTTA 1AO7B 1NAML 3HUJF 4YAQA 1DLHB 1EVTC 2OL3B 2X9XA 5HHVL 3T4YA 3T3PF 4ONTA 2GTZA 4EI6A 1KENH 1RURL 3QQ3B 5ERWB 4JN1H 1YY9C 2B39A 4NFDA 5DGRA 4QHLB 4RFEB 1QSFB 1MRFH 4OCYH 1XGQA 2AABH 2AI0L 2JCCF 5ADPH 4KKBC 2OR9L 4M5ZL 3E34B 2DKSA 5FUOL 1FVEB 4RFEA 2NOJA 4AT6B 1N8ZB 5BRZE 4G9FD 4Y5YA 4XPAL 2V6HA 3OJVC 3RKDD 1DQJB 1AHWA 4EXPX 4GTOB 3I85A 3Q6GH 2Q8AL 3VXPB 4KKLC 4P3WA 5C2BH 4XNYH 4KJYB 4UIMB 4AT6A 3EO0B 4NQUA 1OSPL 4J8RB 1M6OA 1DQJA 2I07B 4GW5B 4HDIB 3BI9X 1UKTA 4KJYA 4UIMA 1A2YB 1G7JB 3PL6C 5E6ID 4QXUL 2I07A 3WXWL 3CFCH 4HDIA 5C9JB 3GMPB 1KFAL 3QULB 2GJ6A 4XNUH 1KTKE 3MLYH 1A2YA 2YD3A 4IRSB 5DHXB 1G7JA 5JXAH 5GJSH 5E0QA 4KK6D 4N1EA 1YEHL 5ISZE 2VLMD 5J9PB 3DTXB 3QUYC 1U3HC 1HOCA 2FO4A 5DURB 1XF5B 1H3VA 1S9YB 1KPVB 5DD1L 5IBLD 3MQIA 1AKJB 3WLWD 1UA6L 5A16B 2XI9A 4F7TA 2IQ9L 3GHEH 2V8IA 1XF5A 1S9YA 1KPVA 3MRQB 4WV1A 4MA7H 3OXSB 4WFGE 2D31B 4POYA 1U8LA 3G6JF 5A16A 5BRZD 3HLAA 1XIWA 2FJGA 1A21A 3MRQA 2Q7YA 3PDDA 3SQBA 3B9EA 3ULVE 2X9WA 2D31A 4X4XB 2EEBA 5FV2A 4PJBF 5GRUH 2AJVL 1KLUA 2ERJC 4D94A 3DRTB 4QGTA 4OIAA 1MNUL 2F5BH 1ZS8B 3TT1L 2WM0A 3BD5A 2YXMA 3DRTA 4QCIB 3TBWB 5E95B 3NZ8B 4I0KA 4KDVA 2GAZB 1QSVA 1CXHA 1URLA 4YDJA 3VXTA 5ISZD 3O6LL 3V4PL 3TBWA 2K1MA 1FFNB 1RUQL 5L9DH 2VXTH 3FKUS 5ESVB 4LSTH 2CQVA 2YD4A 4JFEE 5ANME 4TTGA 2CR6A 5CEYB 3OQ3B 2IC2A 3QDMB 4ODVH 4F8QA 5ESVA 5LCVL 4M48H 1TENA 4WFGD 2ADGA 4NC2B 2YUVA 4FFWC 4KAQL 3K8KA 4UT7H 3O45B 3BH9B 3T0BA 1TJHH 3ARDC 3ULVD 5AGDA 4N9GA 1JE6A 5JW4M 1QSEA 3W39A 5FKAB 1F6AB 1MCPH 3O45A 5TE7L 5IW6B 2BHZA 2EE6A 4XVUC 4M7JL 1JZ4A 1RJZB 3B9AA 5I8KH 1XZ0B 4YZFF 2VC2H 4HJ0C 1VA9A 4DVRH 3FN3A 5IW6A 4DW2L 1AR1D 2FR4B 5E9DB 5L8LB 2DMBA 1XZ0A 4UT9L 2MOVA 4HQQL 5I15H 1JI2A 3MOAL 2IPKB 2IEJB 3D9AH 1CU4H 1QKZH 5HJ3B 2FR4A 1MELA 2PF6A 5I1EH 3IDUA 3MRFB 3CK0H 4CVUA 1A7NL 2ID5A 2W07A 2IPKA 4OCMC 2Y23A 4I3GA 5HJ3A 1A1OB 3CLEL 2I25N 3MRFA 1ZT1B 3K0WA 2SQCA 4HS8L 3OAZK 1AQKH 2R1WB 4XP6H 3S97C 4KV5F 3HC3H 4L4VB 1A1OA 4GRLC 5D6CB 3B9KD 1TNOB 1J05B 1ZT1A 4XXDB 1IQWH 2O5ZL 2R1WA 1X4ZA 4R26H 3OSKA 1GAFH 1HIML 1OP3K 3O3AB 3FB8A 2ZP0T 4XMLL 5L88H 2A0LD 5D2LB 2FD6H 3QHTC 3TH2T 3QH3A 1T2QH 3ZT7A 4NWTH 4NBZB 3O3AA 4PGDA 4JY5H 1HQRB 3BJ91 4R4NC 1B2WH 3EFFA 1JMXA 2F74B 5D2LA 5ALBL 3I6KA 4PB0L 3IDYC 3CAFA 5DD0L 3H9SD 3PWJB 3QPQD 1NUGA 2H26B 1I1AC 2PO6D 2PTTB 4X7EC 2Z0BA 1D7FA 3EDKA 4J6RH 4NO5B 2E6JA 2H26A 4B41A 4G3YH 5F9DC 4OCRL 1CE1H 3ZZ1A 3C8KB 2IANE 2HMID 1EGJL 3WIFB 4IM8A 2ZSWB 4YUEL 1QFUL 1A3LL 4PRIA 4NKMA 1T03H 5HYQB 5I75C 3C8KA 3G6DL 1E28A 2AXFA 1NLDL 1XGPA 3QRGL 4NO2A 2D4FA 4PJ5A 3S4SA 5E2JA 5EH1A 2H6FB 5JA9A 3BPOC 1CI5A 5L7XH 3MUZ1 4JLRA 3MRPA 3EO1A 2N4IA 6CGTA 1L7TH 3OAYK 4D4BA 4EUPA 4NKDB 3QAZC 1S7WB 3IFLH 2DM2A 2HTLD 3TO4B 3GI8L 4H8WL 5B39B 2OJEB 4BZ2H 2VUYA 4NKDA 4PJGB 3NABL 1DBAL 5ITBH 1A6PA 1S7WA 4LEXH 1C8PA 3MREA 1DQDH 5DRZB 4L3EB 3TA3B 2OCFD 5EIIB 4Z7WB 5B39A 2OJEA 4NQSB 1MRCL 5DZLA 2HT3D 3QUML 4UTBH 1KCLA 4HGKC 4PJHE 3IAGC 5E8DH 4L3EA 3TA3A 5JPNB 4Z7WA 3DSSB 5EIIA 3LY6A 2IAND 4JJ5B 2IJ0C 4NQSA 2IFGA 1ZHLB 4P3BA 5M94B 1RUKH 1H8OA 4W4NA 3VXMB 4JJ5A 1G6VK 3HR5B 3INUH 2Q3ZA 4DZBA 1ZHLA 4YDOB 1Q94A 3PGCB 1T6VN 3WV0A 4BQ6A 4Y4HB 3VXMA 1OPGH 4UILL 5H37H 3CLFH 2QQNH 4P4KD 2W38A 2IBZX 1FZJB 4HAFA 1OY3B 4JFDA 2VWEE 1W2KT 2Z8SA 2BSRB 4Y4HA 4TSBH 3WNMA 2OZ4L 1B0GA 2VO5A 4XB7A 5D5MB 1UT9A 3UZVB 4KU1A 1OQOA 2HJKB 2WUBH 3U7WH 1FZJA 4ZFFB 1TN6B 3PV7A 4LVOB 1DBKL 1CDGA 4XI5C 3W81A 4KZDL 3ZSSA 4J3TA 3E33B 1U8IA 3W5MA 4M6ML 2YRPA 1KB5L 1HXYB 2HJKA 3KJ6H 4OZ4B 4ZFFA 4M7ZC 2NY0B 5HDLA 1ACZA 2FJHB 4D9RD 4XMKH 3EO9L 2BHYA 2DQHL 2A73B 4U0QB 5MEOB 1A7PH 4IRJC 1C1EH 2FL5A 1VEOA 4JM2C 4ODSH 1EXUA 4OZ4A 4HS3A 3WDIA 1KEGH 4Y2DD 3HA0A 5AAWA 1OAUH 2CMRL 3TN0C 4E0RB 3RVVD 3VXRB 5MEOA 2A73A 5C0EA 1FL3B 3V6OA 5GGTL 4ZODA 1HXMB 3V95A 4D2NA 1DFBH 4JO2H 5IG7A 4E0RA 4JY6B 3MLTB 1NCWH 2H45A 5D96C 1M7DA 4GG6F 5LQBH 3WD5H 1KN2L 4JY6A 3ULVH 3PP3H 4XBPB 3C87A 4D9LH 5IB3B 1IC7H 4H1LA 5AZEH 2B1HH 4JRXA 3DJ9A 4H88L 3ARZA 3T2NL 3FRUA 1YEFL 1DN2A 2QQKL 5IB3A 2BNUA 3O0RL 4WI9A 3EYOB 5CKGA 1ORSA 4KZEL 4XCCH 4KPHH 5C7XL 4RGMC 1N4XH 3UTOA 4AL8L 3EYOA 1L9MA 2GK0B 1JPFA 4OZHA 5KANG 1OARH 1UH3A 5HD8C 2HJFA 2ARWA 4NQXB 5CGYC 3ARFB 5E2VH 4UOW0 3BSZL 3HTLX 4HIXL 3KHOA 5JPMB 4Z95H 8CGTA 5SWSB 1A6TA 4HK3N 4NQXA 4B0MM 4YHIB 2HLAB 3ARFA 1C12B 3QNZB 4XMPL 4LAQH 4RMVA 3N1QC 2AS5M 4OM1L 2XZQH 4HG4J 1I8LA 1E4KA 4YHIA 2HLAA 5F1SA 1C12A 3WUWA 4EXKA 1J1PL 2KZWA 3QNYB 2BB6A 5D1QB 4OF5A 2YUZA 4D0DB 5EOCL 3MLZH 4OLZL 1TVDA 5LGJA 1PW3A 3QNYA 4E41E 4F58L 2BERA 5HHXH 3IAPA 5DHVH 1PFCA 2D7TL 4YHPB 4L1DA 5DJ2B 5L2JB 1Z6JT 4LNBB 4QWWC 3TVMD 1OAXL 5KVFH 4YHPA 5L2JA 5DJ2A 3ZDXF 4YXKL 3FQWB 5MEPB 1RJYB 4NGHH 4ONFH 3O8XB 4KROB 1FRGH 2F9BT 3ARXA 3CVIL 3K8MA 4K3EL 4OZIE 1XR9B 1FN4B 2B2XH 5CP3A 3CC5B 3RGVA 4FQ2H 3GRWA 2NY7H 2V17H 2X4TB 4YX2H 5JOEA 1XR9A 3DX8B 2BFVH 2JJUA 1FN4A 1HHGB 3CC5A 4WU7B 2DS4A 5DVKA 5J06A 1UJ3B 5DFVC 4LLMB 2X4TA 3HNTH 5B4PB 2MPAH 5IK3B 3DX8A 3BRFA 1MCDA 1HHGA 3U9PH 3H9YA 1KLGB 3C5SB 2ADIA 4WGVB 4E41D 4PJDF 1ZK9A 2XPGB 1P84K 4LCIL 5F89B 4M62H 3NH7H 5SX4I 1FPPB 4WUUE 1QNZL 1KLGA 3C5SA 3RY5A 1TZIB 2XPGA 3MJ8B 2VZTA 5F89A 4F7EB 2EYRB 4GH7B 4FQLH 5BVJB 3JTSB 4PV9B 3MBEB 3RX7A 4I0PA 4X6DB 1TZIA 4K23L 5HY9B 1JZ7A 3MJ8A 4U31A 3OKKB 3SKJH 3WYRA 3Q75B 5F6IC 5FUZH 2ICEA 3JTSA 3ARRA 3VDBA 3MBEA 4NFCA 1MPAL 5HY9A 2WUCH 3NFPB 3TJHC 3OKKA 1H36A 3C09C 1U2HA 4LHUG 1UC6A 4KK8C 5GS1B 2NY6D 1IQDB 3MV7B 1FO0L 4FG6C 4BQ8A 1U92A 3NFPA 3D3VB 2JIXB 3NA4A 4G6AD 4H0HB 5D1ZD 3SBWA 3UEZA 2FRGP 3VE0B 2C3WA 3MV7A 4TVSa 1FNGB 3D3VA 1F90L 4O4YH 2JIXA 3QIWC 1BF8A 1CDBA 3VCLA 3RIAF 4OCXH 1NAKL 3TIDA 3VE0A 2UWEB 3ECBA 1UB6B 4F15B 4WUUD 4NM4H 2DLGA 3ZE2E 4JKPH 5C08B 3KPSE 3IKCA 1S7TB 4OCLC 2CRYA 3F6IA 5FHAL 1OCWL 1N2RB 4JRYD 4XRCB 3C5ZC 2FJFB 5C08A 5DD6B 4G6FB 2E9IA 4OSUL 4PRHA 1S7TA 2UZIL 1LP9B 1T4KB 5AD0B 5TDPB 1N2RA 5IESL 4JFYA 4G6MH 2FJFA 2VAAB 5IBTL 4G80B 5DD6A 4R8WH 1WGOA 3VFGL 2FBJL 2GSIB 4YH6A 1QBML 1T4KA 2A2QT 2BVUA 1V8HA 1PG7H 2Z9TA 5HDQL 1I9EA 1EH9A 2OM5A 4KH2A 3EZJB 2F8XC 3NIGF 4G80A 1KXTB 1YN7B 5DJYB 3PQYE 3U0WL 4OF0A 1ZKAA 1KACB 4QF1B 1TZGH 1EHAA 1BVKA 4L8SC 4G9FB 5D1XC 2C1PB 5FUCC 3PWVB 4K07A 3SGEI 3I2CL 4LHQB 1L9NA 2GKIA 5DJYA 1CF8H 5GS0L 3GBMH 3C60A 4QF1A 1SY6H 1S3KL 4G9FA 1OAZL 4QOKA 2K7PA 3PWVA 3TBYB 3CXDH 2A1WL 5DZNA 3KPSD 3VMPA 2IMNA 1U91A 1DLFL 2WP3T 3HFMH 3QDGE 5E6IB 4EN3C 3TBYA 3DSUB 1PYWB 1MSPA 2BP3A 5I0DA 3Q5YA 1I75A 4CRPA 3KS0H 4NP4H 2APXA 2C3XA 3L3KB 3PGFH 3EDFA 1S7VA 1U58B 1JP5A 1TQBB 5BVPL 3CXHK 4P0DA 3PP3K 3IGAB 2WBWB 1O6QA 5E6IA 1LD7B 4IMKC 2W9DL 2AK1L 2YD7A 3G5VB 1EEYB 3GJEB 4NQDE 4OD3H 1YMHB 3L3KA 3SDDC 1U58A 7CGTA 1KPRA 1K6QH 1RZGB 4MXVE 1I9JH 2FHFA 2X42A 3IGAA 4R90L 3CMGA 5I1GL 4OCWL 5DI8B 3P4MB 4RAUB 1X81B 5KW9H 3GJEA 1QFOA 1XF3B 1YMHA 4TUJA 1A8JH 5GS3A 2DQFA 4TVPL 1T89A 3PQYD 4WWKC 5DI8A 4RAUA 5BRZB 2BVTA 2I5YL 3UTTE 1KTDB 1XF3A 3RVXC 5I9QC 3VD7A 1W0WB 2EYSB 2BSED 3F12B 3WIIL 1YEDB 4HULB 4XGZB 1RUPH 1F11B 1K4DA 3LS4H 5CEZL 3GKWL 1S7RB 5BRZA 1YEKH 1OLZA 5F3BB 3O6FC 2Q7NA 1A5FL 1KTDA 1MLBA 1Z3GL 2FX9H 2XA8L 3K8LA 2EYSA 2YD9A 3F12A 1YEDA 3V0AC 4RGOH 1F11A 1FG2B 4U1NB 2QR0B 3SDXF 2YKLH 1F00I 3QDGD 2QADB 1D9KD 3B8SA 5TE4L 3DPYB 3BDYH 2DI8A 1CQYA 3DX6B 4NZRH 4U1IB 5IHUH 1I4FA 3N9GL 3RY6A 1A7QL 3TPUB 4LPUA 4O00A 5ISZB 3SGJA 2R1XB 4NQDD 3HI5H 5EZJA 2CLZA 1MCKA 4M1GL 3EAKA 4LCYB 5DFTA 3DHMA 4JANA 4NYLB 2HKHH 5DUPH 5EOQL 5D71L 3VWJD 2E7LA 3DURA 4UB0L 5DTFB 3BN9D 4HWNA 4X0KA 3LN4B 3EW3B 3D69B 4LCYA 1I7ZB 4QGYA 1GGIH 4DAGL 1I8KB 5J3HC 5HGAA 2EEDA 3QXWA 5BZWB 1CCZA 3UTTD 3ZYIA 3FQTB 1PX3A 3D69A 3SDAB 1I7ZA 1I8KA 3RX5A 1MEXL 2PXYA 3FTGA 1PEWA 1FZOB 2EIEA 3OKLB 2CH8A 3HAEH 3FQTA 2H6PA 1NMAL 1RZ8B 4D0CA 4QHUB 1MQ8A 7FABL 3OKLA 4N0YH 2XWJA 1GC1H 4MAYB 3RVWD 4QNPF 1RZ8A 1Z0NA 3S9DB 1TVHA 4OLWH 4XC1H 5HGHB 3WKML 4Y5YC 4G6JH 3SE9H 1I9RL 5KSVB 1AHWC 3HE6D 4JFEB 3OR6A 2NZ9C 4LDOB 5HGHA 5ANMB 3F58H 3WHXB 3KR3H 4XVSL 4HV8B 2R69L 3SOBH 2RCSH 5JR1H 2NR6C 2LV4A 3BQUD 1FC2D 5EU4A 3MNWA 4LLUB 4NBXB 3WHXA 1HH6B 2WK2A 1L0QA 3RL1B 3B9KB 1A3QA 5KVEH 5FM5M 2DICA 3T77A 4LLUA 2M1KA 4UAOB 3MUGA 4UUJB 3GFUA 1D5XA 3T3ME 3RL1A 3EYSL 2YZ1A 4RISL 5DJXB 2ZZUT 1ZTXL 4PIRF 1OB1B 3IXTB 5ECJE 1YEIL 4FFVC 4UUJA 2PTVA 4LNRB 5DHVB 3MCLH 2E5EA 1OB1A 1U8JB 4FTVE 3UC0L 3NPZB 4HJGB 4LNRA 4WV1C 3OXUA 5DHVA 4KUZH 4LEOB 5KVGH 4EKXA 1B4RA 4M8VA 1XIWC 4ODTH 4OZGF 2IQAB 1PSKL 3H9SA 1EAJA 3QEHB 1MCNA 4ZFOB 5TGBB 1AI1H 2PO6A 4DGYL 2DQUH 1ZSDA 4W6WB 4BKLB 3WO4B 3QEHA 1DVFD 4ZFOA 2C7UA 2XTJB 2ZOKB 3CDFA 5EA0H 3L5WB 1B0RB 4CVZB 2R0ZL 1RZJC 3THMH 5EZIL 3TNNA 3VRJB 2D9QB 5DJZB 3MGOB 4JG1L 3L5WA 2Q8BH 1C7SA 5K9KB 4CN4A 1UVQB 3QQ4A 3VRJA 5KVDH 5HI4D 5DJZA 4K7PH 5B8CA 5CAYB 2X4QA 5F1OB 3LN9A 3K1DA 1A6WH 4LPYA 1RU9L 2E9WA 4MJ6B 1IGYA 3S37L 4RSVA 3R0MA 1UVQA 2PR4L 1WJ3A 1YDPB 4L8BA 1FPTH 1MFDH 5A2LH 4OM0H 2QQQA 2VITB 2IANB 1VEPA 2VLJE 4HKXB 5I1HL 4JPVL 1VB9A 2AEQH 2VITA 4U1MB 4XPBL 4HZLB 3WS3B 3P30L 5B21A 1FL6B 4NZTH 4IOFC 1N6QL 2YRLA 3PGDB 3A6CL 4WTWA 5FF6B 4JFXB 2EE9A 1NMBH 3KYOB 1XFPA 4MNHA 4U1MA 2H2PC 5D9SB 4FQPA 4HZLA 3O6KL 5CHNB 4HD9A 1FL6A 4P4KB 1GHFL 3PGDA 4Y4KD 1OQXA 3DARA 5L2KA 1I3RB 3UBXB 3KYOA 3ZE0E 1T0MB 1A6UL 3JVGA 4X4ZA 1T04A 4P4KA 3DSFL 3BEVB 5D7IA 1WAAA 1I3RA 2Z91B 1IKFH 1SA5B 3UBXA 1F8TH 3G5ZA 3T1FB 2X89D 3ZT5A 3RAJH 4RAHA 3RJDA 2VSDA 4LBEA 4WI6A 4PJGF 4NRXB 4RNRB 3DUUB 2YPVL 2CGRH 4LLYB 3T1FA 1PX4A 4EDXB 4GRMA 3VGBA 5GHWL 3K4ZA 2DQDH 4Z7QF 3CMOH 4NRXA 4RNRA 4XBEH 1G84A 2EDFA 3DUUA 4TTDC 1YN6B 4PJHA 5CBAB 4EDXA 4M1CD 1ZHBA 4QRPE 5F9JA 1XGTA 3VRLE 1NEZG 3GK8L 4Y2DA 3NZHL 4ZG1A 4AIOA 1G9EA 4L9DA 2HVJA 1QD0A 4Q6IB 4X5LA 4MS8C 2Z8VC 3TF7C 2E3VA 4RWHA 1NGQH 5EUKB 1CR9H 1G9MC 1HH9A 5H94B 2I60H 4Q6IA 1H3PH 4Y0GA 4I13B 3RFZC 2XWTB 2IF7A 4HIIB 1IM9D 2ICWJ 5EUKA 1T21B 3OF6A 3EOBB 4BJLA 1BOYA 1LK3H 1SY6A 3NGBB 1IL1A 3GHBH 5D5MF 1T21A 4RA0C 3AAZA 4PJCA 3EOBA 3Q48A 1D6VL 4C59B 1VESA 4K7FA 4Z6AT 1JRHI 4TSCH 2WBJD 3CUPA 4GOSA 3SE3A 1INDL 3L5IA 5GS2D 2H2SD 3V5DB 4GTRB 3VH8G 1YEGL 2ZCLH 4RGNC 3DRQB 1G7MA 2VDQL 1GXEA 2P1YA 2R56H 4UTAH 4QRPD 3NPSB 1EX0A 5CJBA 3V5DA 1JZ8A 3KSLB 4ODHL 3ULUC 1UYWL 2Q87A 3H6JA 5SX5H 4DQOL 4L8CB 2BDNH 2DLEA 3U1SL 3TP4A 2VXSL 2X4UB 1JFQL 4XWGL 3DUSB 4PUBL 4UNUA 5ILTH 5E5MB 5HXMA 3TCXA 3GSQB 1B4JL 1FFPB 4P5TD 3TA3C 3BE1L 3ROOB 2X4UA 4XVTH 1AGEB 5TF1L 4YHOL 2CIIB 5E5MA 4FXKB 5TPWH 4QYOA 3GSQA 3WNLA 3V4UH 5A2JH 3G5XB 2VN4A 3TIEA 1H3TA 1AIFB 2CIIA 4KKAD 3TVMB 1R5IA 1J0HA 2V2XB 4FXKA 4PGEA 4JKWA 4PJ8D 4KJWC 1BQLL 2VDRL 3GB7B 2HFFB 2JB5H 4P59H 3TVMA 2V2XA 4DKFL 2VMFA 3JUYA 4L3AA 1WISA 2VXQH 3NTCH 4GO6B 5C09E 4Y4HC 3WFCL 2Y72A 1MOEA 4O58L 4R2GD 5F9OL 2LAAA 4NT6B 3PNWB 4XPHL 3CNKA 4B7LA 5CZXD 4C83B 4MD0A 5MENE 4X83A 5IWLA 3MUHL 4QXGL 5DVLA 1G6RH 2R4RH 4DJMA 4TULH 4JFHE 3OGOE 4NT6A 3PNWA 1CGTA 2F8OA 2N7BA 3EDEA 3QEGH 4C83A 1CXEA 1IEAA 1IZKA 4IOIB 4N8PA 2WY8A 5CJ8A 5JMRA 3HAEB 4L8DB 2NXZC 5L6YH 4E41B 3PHOB 4D4DA 3HMXH 1AJ7H 1JUFB 2NY0C 2OI9B 3MRNA 4H0IA 2W65B 5IIEB 3O2VL 4HWBA 1INEL 2AGJL 3V6OC 3NFSL 3M17B 4E41A 3PHOA 1JUFA 3LKQB 2W65A 5IIEA 5MP6L 1RMFL 4WO4B 3VFMB 1FE8H 3MACL 5TDOB 5J56B 1T22B 1SEQH 4GTQB 2A74B 4R4FH 4WW2F 2G60L 3LKQA 3VFMA 4XPTL 1Z0MA 5TDOA 4H5SB 1EPFA 5CILL 4OZIB 3UPCA 1A0QH 1WT5A 3EYUH 4HJJH 5C09D 4D3CH 2ADJA 3WNPA 4LIQE 2OQJA 2NY6B 5MEND 3FFCE 3MRBB 4OZIA 4NO0D 3FO2A 2FGWH 5DMYA 4JFHD 5DMGC 3CX5K 5D1ZB 5B4MC 3MRBA 4MXWL 1WV7T 2R29L 2AKRB 5J1AB 2WMPA 3PP4H 4X4ME 5CIPH 2JB6B 1XR8B 3IDGB 1GYAA 3X17A 4TPRL 1FCCA 3L3GB 4XX1G 4XC3L 4NJAL 2JB6A 3IDGA 3QR2A 4X99B 4XNMB 5I30L 3CFDA 3ARFC 1OGTA 1CXFA 3IU3A 4WUUA 1AFVL 3L3GA 2BHUA 2LTQB 4QTIH 1MIEH 4WUKL 3TYGL 1I8LC 4HWEL 2J1KA 4X99A 1E4KC 3OKOB 4JRYA 1WIOA 3BKJH 1C5DB 1J5OL 1MY7A 4L9LB 5ESQB 1CLZH 1HZHH 2FYYA 3HZVB 5I6XB 4YWGH 3LS5H 3ZTJG 4AG4L 5I18L 3BWAB 3G08B 4EOWH 3VD4A 4QXWA 4Y7MA 1C5DA 4OF7A 1IGML 3UBXI 5IVZB 4WB3A 3HZVA 4ORGB 1JF1B 3ZDZE 2C4XA 1BJ1H 3G08A 5F9AC 4YHKL 1TVBB 3SCMA 3PUCA 4JY4B 4OQTA 4ZUVA 1EJ6A 2CLRB 4MJ5B 4ORGA 1JF1A 4YE4H 1T1ZB 2J7LA 2E27L 4HPYH 3ARGD 3QO1A 2IPUK 1PZ5A 2O26U 2A6KB 4JY4A 4IBLT 2CLRA 4MJ5A 4POZD 5K59F 3AMKA 4PV8A 5FM8A 1QBLH 2V8JA 1T1ZA 5BS0A 3KPSB 4MVBD 4HK3J 4AEFA 3IT8D 3RGVC 3QYCA 4KROC 2R0WH 3AS3A 2X7LA 3KPSA 4ZMAT 4H20H 1SJXA 4EZMA 1NCNA 1ZEAH 4S1RL 2GY7B 1UZ8B 1KJVA 3GSOA 5GS2H 3DVNB 3VI4E 2L7JA 4NHCH 1HHIB 1N5AB 1Q0YH 2NXYD 1MJUH 4F7MB 5I8OH 3LDBC 2DMKA 1S5IH 1X5IA 3DVNA 4EIZC 3S3SA 1A1MA 3AXLB 1HHIA 1N5AA 3IFPA 5D7JD 2C4FT 1UM6L 3GSNL 3PQYB 3DXAE 3FT3B 2GOXA 3WSQH 1DBBH 1I85A 1F4AA 3MMEB 2AJ3B 4KQ4H 2DWEB 3PF2A 5CJ5A 2GCYB 1K4CA 3PQYA 4I0PC 3VFVA 3GUTB 2DWEA 1OWWA 1I1YA 3VFNA 2IG2H 2WANA 3QEQE 4BSVB 3P0VL 4JO3L 5EZOH 4X4YB 5ID1B 3GUTA 5FYKE 1N4SB 1ZVYA 5SWQB 4X9GA 5I1AB 3QDGB 3HS0B 5SX5K 3ZMRA 4IMLA 1RPQA 5LXGL 2V9QA 3QDGA 1RZIB 2P47B 5I1AA 1D9KA 3WIHH 4F33B 1FC1A 3SBWC 4JM2F 3MOQA 4A2LA 3KDMB 4NQDB 3SHSA 4HFWB 3FHAA 3QFJA 1YJDC 2VKWA 1CFBA 3K3QA 4JCLA 2I26N 4F33A 3VWJB 3FQNB 4NQDA 2W60B 1VACB 4Z7NE 3QXTA 2OMBA 1CK0H 1FAKT 1U8QA 3QHZL 3HCVB 4JHWH 3HXDB 3DXAD 2FBOJ 5EO0B 4YHLL 3VWJA 4S0SD 4YPJA 2W60A 2XZCL 3CFJB 3UTTB 5FGRA 4F8TA 5FHBL 4CU7A 3HUJE 4KJPD 2J6EH 5HHME 4F15C 3HCVA 5EO0A 3O2DH 2APTA 4U7MA 3CFJA 5C86A 4MXQD 1KIUA 3H2WA 3QEQD 2VDKL 5T3XL 1EDQA 5BMFH 2H1PL 4NKIL 1Q38A 3QFDB 5DF0A 2JCCE 1RIUH 2FEEI 3CGTA 2GJZB 2AEPL 2DD8L 3BEWB 2WIMA 3EOTH 4K8RC 4XB8A 4OFYD 1MFAH 3MLRL 3H3KA 3QZWG 3BMWA 4KRMB 1MHPH 2DDQL 4U7KA 4OAWA 2QTEA 3FO1B 4OKVB 2GJZA 5DJAA 4NZUL 3VRIA 5IQ9B 3GMRA 3BP5B 2NPLX 4PJ9B 4ZAKC 3REWB 3HE6B 1ONQB 3FO1A 4PS4L 5JW3H 4JO1L 5IQ9A 1NBQA 3C60C 1C5CL 5IB5B 1JBJA 1A6VH 1N9AB 3TFKD 5SV3A 4JFQB 3REWA 3RKDC 3S36L 3QQ9C 1MIMH 5F96H 1NCAL 5GRYA 4DTGH 2W9EH 3OKYA 3ZKSD 5IB5A 5I2IB 4WGWB 5F93C 5HHMD 4JFQA 1R3KB 3BQUA 2EDHA 4YDVB 2B0SH 3REVB 1FJ1B 2C3VB 5F1IA 1CBVL 1T5XA 1BEYL 3IFNL 3QCVL 4JPWL 5EC1A 5I2IA 3VFRA 1IC5H 1KGCE 5E6IC 4KMLB 1SYSB 4YDVA 1K9TA 5A2IH 3REVA 2ZJSL 2Q20A 1OAYL 2OTWB 4MWFB 2B8OT 3EHBC 4JVWA 4KK6C 1SYSA 4HF5L 4WI4A 1OSZA 1CS6A 1ND0A 3LZFH 5SV4A 3RUGF 3Q1SH 3R0NA 4HPOH 5F1KC 3G6JE 1NBVL 1T89C 1U9KA 2OS7A 3LEYL 4X6CF 5GGSY 2APWA 3UP1A 4PY7B 3LQAL 1R5VB 1U41A 2F0YB 1EMTL 4ERSL 1NC4A 1NJ9A 4PJBE 4NHUB 1DL7L 4LIQH 1QBAA 2YPKA 1R5VA 4GKNB 1XMWA 3O41A 1X4YA 2P4AB 3TO2B 1E4XI 1MFBH 1DVFB 4D4CA 4NHUA 1G6RB 1YYLL 5DLMH 2JE8A 5GGRY 3TO2A 3LHPH 1WWAX 4WHTA 4PJXA 1DVFA 2R0KL 4G42B 1G6RA 3RY6C 4YHYC 1E4JA 5T33L 4JKMA 4K9EL 1KGCD 3SGJC 3MXWH 1PY4A 5EBMB 3DUHA 1FGNL 1YEEL 4FTVB 5CZKA 4JDTL 2E7LC 3HMXA 4YQXL 5FYJE 2LU3A 1EERB 4ISVB 5EBMA 2EE3A 1QPXA 3ISWA 4KMTH 2Z35B 4HKZB 3FOLB 1J0IA 4E42B 3TWCH 1IBGL 2XA3A 1AXTH 4ISVA 4XX1E 4UI2A 2PXYC 2RBLA 2VIRB 4K3HA 3GMOA 4E42A 4I4WB 5C0JA 2I9TB 2ZSVB 4U6TA 1JCRB 1CWVA 1NFDE 4YZFE 1KCSL 3ABZA 3ULVC 4YEFA 4CAGA 1TJIH 1P1ZB 1NBYB 2VIRA 2IAMD 2LQRA 2IWGA 2I9LB 2I9TA 4I4WA 4WEUD 3BJLA 5I74C 3QG6A 1EGJA 1RZJL 4X7DC 1WWWX 3UJTL 1NBYA 3DX7A 2V5MA 3PZ2B 3U4EB 5KJRH 5A2FA 2I9LA 2P5EE 1PZUB 2BOCB 5I8EB 1AR1C 3FFDB 4Y4KB 5CIPB 1G7IB 3DSVB 1QACA 4ZNEA 4HX1A 5E8PB 3WXVH 1P7KA 4YJZL 4O2EA 1IGJB 4Y4FD 4Q9QL 4ZNCD 4Y4KA 3UYRL 2Y7QB 4HZAA 4OF6A 5FYJD 2FB4L 1YPZF 3CX2A 4KV5E 4RFOH 1WITA 1F02I 5J13B 4APQA 1W72H 1K5NA 1RHFA 2Y7QA 4LLWA 3FOMB 3P40A 1ZT4B 4L5FL 1ZHNB 1UENA 1A1NB 1IZJA 4NNYB 4PJFA 4ONOA 5DUML 3H7BB 2YK1H 2YR3A 5MI0B 1R0AH 1CDJA 1QVOB 4Z7UF 3IDJB 2VLJB 1LO4H 1MFCL 1T7VA 5F71A 3BOVA 4G43B 4NNYA 4UAOC 5F7DB 1J9CT 3M8OH 2VXVL 4NNPL 4EDWH 3NA9L 3IDJA 1MJJA 4CBPA 1SJVA 4LARL 1JPSH 2X4RB 3MLXH 4XCNB 3U48A 3U82B 1RIVH 2A0LC 3WN5B 4G43A 1DR9A 3QCTL 4Z78B 5F7KC 4F37K 5F7DA 3SDYL 1AE6H 4I1NB 1E4WL 2P5ED 2HTKD 2DTSA 5AWNL 1EJOH 2NQCA 1IM9B 1TFHA 1H9VA 1AC6A 3QPQC 4M93C 3UCRA 1JV5B 3DECA 4WWID 1ZGLA 2PO6C 5FYKH 1IGIL 1KN4L 1U95B 1JK8A 1JF6A 3ETBF 4P2YA 3OKMA 2OZ4A 1JV5A 1FLTX 2YHGA 1H35A 4KC3B 4ZFGL 2HMIC 4N1CA 1U95A 1OP9A 2D3VA 4JDZB 4N5EC 2AXJA 3U30C 2WBJB 3WO4C 2EE2A 1EHLH 4YNYA 4HXAL 1KXVC 2DWDA 4S0TD 2C1OB 5DGQA 2CD0A 5IM7A 4QRPB 4PP2B 2O5YL 5AZ2L 3U7YH 1NL0L 2VXUH 4FQCH 4ONGL 1HSBA 2C1OA 3VXOB 4P3DB 5I16B 5B8CC 3D0LA 3WS6A 5GGTA 5C0BE 4DZ8B 3RDTD 2HTLC 2ZKHH 3GSVB 2XICA 5D70H 4KY1H 5D93C 4YO0A 3MRCB 2O5XL 1JZ3A 4P5TB 3GSVA 3TEUA 5MEQB 3S34H 1ETZB 2XQYG 5FYLL 2HT3C 3MRCA 4XZUA 4ZXBA 3D5OF 4P5TA 5MEQA 1I9IL 2VTFA 1ETZA 4PRBA 1FZKA 5KANI 3V6FA 2A9MH 2AXHA 4PJ8B 1CFVL 1GZPB 1IFHH 3U9UB 2EH8H 2CDEB 5IJVB 1R3JB 3O3DA 1F4HA 1QA9B 3KLSA 1KBGL 3WIHA 2ARJB 3ULUL 1KTLB 4PJ8A 1BX2B 5K9JL 2CDEA 5I1JL 3JVGC 3H8NA 4R2GB 4P4KC 1CICA 4BFEA 1KTLA 4TQEL 2MCG1 2VABB 1BX2A 2L0DA 5C0BD 1CFSB 2EDKA 2D7MA 4KVNH 1MVUA 4ALAL 1EUUA 4UIKH 3O11A 3PWLA 4ZS7L 5EU3B 2C3GA 1RK1B 2EDTA 2VABA 5FB8A 2R0LH 3GM0A 5DQJB 1KG0B 1P7QB 3QISA 3U4BH 1RZ7L 4ELMF 3O81A 1F4YH 4GTPB 1BJ8A 1B3JA 2EDDA 1RK1A 4OTXH 3UJJL 5CUSL 4EI5D 4JAMA 1S78D 1KG0A 5JQHC 2IALA 4DOHE 3RZCD 1J11A 2HP4A 4GXUM 3MLSL 1BGXH 5A3ID 4Y2DC 1NKOA 2CRIA 1D5IH 2G0DA 1TJGL 4KK9D 1X7QB 3RVVC 4UV7H 3DWTA 4QKXB 2IGFH 3QIUB 1RI8A 3AU1A 4P23D 3ZTNL 5IR1B 3DMMA 3RRQA 1X7QA 3TNMA 4Q6IC 1A9EA 3MYJA 4HBCH 5C09B 1FGVL 1B88A 3WFDH 1F3DH 3IU4H 1ZXQA 3MOBH 5ACZB 5MENB 4HC1H 2VWEC 1BP3B 4NO0B 4H0GA 4NN6C 5C09A 3MPCA 2XZAL 2PETA 2X40A 3SPVB 3O2WL 2OJZL 1JWSA 4Z76B 5MENA 2GYSA 5IVXF 4NO0A 3SGDI 4WJ5B 3HG1E 3RL2B 1ZLSH 3SO5A 3KQ4A 4K3DH 2DQTH 3SPVA 2J5LB 3AB0B 3MLVH 4M3JA 3SE3C 5I1IH 4OBSA 3MV9A 3BIKA 3FMGH 1KENL 4MQXC 4XPFL 4WJ5A 3RJQB 1P2CB 4JN1L 2Q6WB 3MA7A 3WNOA 1KT2A 4IS6B 1ZANH 4R3SB 1UH4A 5KVMC 3KLAB 2V3NA 1EK3A 5FOJA 4HLJA 2J8UA 4OCYL 2AABL 5FYJH 5ADPL 1OAKH 3I50H 1BFOB 1P2CA 3T0XA 2Q6WA 4IS6A 1EO5A 3D0VB 3QT2A 2GITB 3NPSC 1MZCB 3GMQA 5DJ0B 4GS7C 5F9WB 3DROB 3Q6GL 1EEUA 3D0VA 3QIBA 2GITA 5C2BL 4XNYL 1V3KA 3MBXH 2YN3A 1QUNA 3TYFB 5DJ0A 2YUWA 2HH0H 4MJIA 3FFCB 3VXQB 3GO1H 4MD5B 5FIEA 5HYJD 1BZ7B 3KLDA 1P4LB 2NLJA 5CINH 3ZTJH 3CFCL 4OF3A 2YOCA 4FZEH 3HG1D 3WNNA 2DIBA 2XG5A 3ARGB 3ZDXE 3LV3B 4OIBA 1P4LA 3DVGB 4LOUD 5GJSL 4OCNC 4G8GE 4OLYH 5C71A 3D5SA 1JWUB 3TVMC 4O2FB 4X4MA 3ARGA 3JWDH 4GT7A 2G02A 2ZISB 3O3BB 3DSXB 2EZ0C 3MODH 2X1QA 1Q72H 3H3PH 2XYCA 4QXTA 4KI1A 3GHEL 2H8PA 4NM8H 3O3BA 4MA7L 5IWLC 3R06B 3KPQA 3ZKXC 2XRAH 3LKOB 1HSAA 5LBSH 3KYKH 3CFBB 3CZJA 3MO1B 5DD5L 2NY2D 3BRGC 2EC9T 4KI5F 4XP9H 3R06A 2NXYB 4HUWA 4PJDE 5GRUL 3X11B 3WFHB 2R4SH 1WBXA 4N1HB 1OP5K 3EJYC 4Q0XH 5D7JB 4OF8A 1UCBH 4X80H 3QRFM 4KKIA 3X11A 3WFHA 1NDGB 4TNWK 2OI9C 4ZFZA 3MRLA 1JZ2A 5D7JA 4KXZH 5DS8B 1SHMA 3S37X 1NDGA 3T0ED 4LCCB 2KL6A 3I02A 5HI5D 3V0WH 4G8GD 4M02A 3M1BB 3OKDA 5DS8A 1XCTB 3GRWL 5C6TH 2HG5B 2VXTL 5CJXA 2YSSB 1WT5C 5EBGA 2NY1B 4G8EA 3P9MB 1ES0B 1T5WB 2FATH 3K2MC 3RY4A 4LVHB 4GW1B 3MRMB 1YZZA 5JO5B 4ODVL 3BISA 4M48L 4ZH1A 2YSSA 1K3ZA 1W72B 3P9MA 1KIRA 1T5WA 1CGXA 1QLEH 2YA1A 4JGUA 5CWSB 4W68A 4GW1A 3MRMA 5JO5A 2Y5EA 3GBNH 1TJHL 3T4AA 3TZVD 1BREA 4LSVL 2EDQA 1GRWA 3SKMB 3VXNB 5DJ6B 1MCPL 3I75B 3DYOA 4G6AC 5CWSA 2BVPA 3MFGB 2EXYD 1P7HL 3SKMA 5I8KL 1CLYH 2H6HB 5DJ6A 3DXAB 4P3CH 4C4KO 3E6FB 2NX5E 1MHEB 1CDHA 5F21B 1FIEA 3P0YL 3O4LE 1B6UA 5I15L 3QUXD 3CH1B 4TNVK 1HZFA 1PG7W 1CU4L 1QKZL 3I3DA 1MHEA 4FQXD 4PYGA 4F3FA 5I1EL 4KTEH 1TZHA 3QEQB 1BMGA 1DUYB 3CH1A 3KPRE 2LTQC 2DQGH 2VL5A 4HWJA 1DANU 1NEZA 1T1YB 4NQCB 1Y0LB 5JXED 2D4DA 3PWPA 4NO3B 3KWWA 2DYPD 3NIGE 1A3RH 5CS7A 1DUYA 2AI0H 3KPLB 5I6XC 1AH1A 1T1YA 3OXRB 3QPXH 4Q2ZA 3TESA 4PD4K 1LE9B 3SCMC 2DLFH 1NANI 2YD8A 4M7KH 5IMMB 1J88A 1TTUA 4OFYA 4R26L 5B38G 1GAFL 4ZSOE 3DI2B 4AEHL 4LSQH 3OXRA 1HQ4A 3L3HB 5B39G 1VFOA 1N59B 3IFOB 4G9DA 1C5BH 2FD6L 5IB2B 1T2QL 2PUQT 3BN3B 4HWZB 4HIJA 4MXVF 4NWTL 1BZQK 3L3HA 2DM7A 4JY5L 1N59A 3IFOA 1KJMB 3EYVB 3HZKA 3HUJB 1EEZB 5HHMB 5GSVA 4HWZA 3O4LD 2LAGB 1FLRL 4LFHD 4GMSL 3WXWH 3LKPA 1KJMA 3GI9H 4ETQB 1RZFH 4R4BB 1AO7E 3HUJA 1EEZA 3VH8A 5DEGA 3KPRD 2I24N 5E6YA 3W2DL 3WNKA 3Q73B 5C8JB 4ETQA 3RI5K 1P4BL 2JCCB 1S9KC 1A4KB 1WVZA 3TBTB 1HYSD 1BBDH 1UA6H 1T03L 1VPOL 3SO3B 5DC4B 1A4KA 4JG0H 1I85C 3QO0B 3TBTA 4QEGA 3GJFK 4GUPB 1PJ9A 2YWYA 3V5HA 3E2HB 4Z18A 4CNIA 5L7XL 1Y18B 4HSQA 4PRDA 3DSTB 4JFFA 3QO0A 3X3GL 4ZUUB 5I1LA 1Q0XH 1L7TL 3HPJB 4GUPA 1YQVH 1QHPA 1IC1A 5IMLB 2EDBA 4P57A 4ESKA 3SDXE 1Y18A 1MNUH 3FO9B 3EJZD 2XY2A 3WFEH 3HPJA 3BO8A 4XP4H 5ITBL 3RWGA 4LLDB 3I84A 4PGZA 3NCCB 1DQDL 2CDFB 1BFTA 3K46A 4MB4A 3PE9A 1DQQB 2BY1A 1AO7D 4LLDA 1XGYL 2AXGB 1D9KC 4UTBL 4P46D 1FNSH 2CDFA 3V4PH 4RFNC 1DQQA 1RUQH 1ZLUH 2AXGA 3Q7FB 4V1DE 2EDXA 2V7HB 5CMAA 4JREC 4KRNA 4NC0B 3INUL 3VWJC 1DN0B 5HHNA 3IJYB 5E08H 3BN9C 4G7VH 4X6BB 4Y5VB 3G6JA 4PJ7F 4X6FB 4PJBB 5J11C 5DQ9A 3BDXA 1QYGH 3CLFL 1CE6B 5T1KD 3DVIA 4HKJB 4X6BA 3VA2C 1O6RA 4TSBL 1ZVHA 3BH8B 1JPTH 4M7JH 4X6FA 3U2SA 4FABL 3N1FC 4Z77A 1CE6A 3PG2A 2WUBL 5C0AA 3IDNA 4MDIB 3NFNA 4HKJA 4GAGH 2VUOA 3BH8A 1WZ1H 1MH5A 1YMME 3KJ6L 2X70A 4HC1A 4HQQH 2IAMA 3H0TA 4JHAH 4MDIA 4OFIA 2GHWB 3MOAH 4XNQB 4XMKL 1SM3H 4YFEA 1A7PL 1JNLH 3BZ4B 4IRSD 1C1EL 3ZLQC 3T3MF 4KMQA 1U93B 4Y4FB 1OAUL 1J0ZA 4QLRA 4V1DD 1KYOK 2ADFH 2ZPKH 1CTOA 3TT3L 1DFBL 4Y4FA 4KQ3H 4JO2L 5JORB 2A83A 2DJUA 3BMVA 4P5MB 4U1KB 2PW2A 4LKCA 1NCWL 2W9LA 3BQUC 5LQBL 1JHTB 5CKAA 4PGCA 5JORA 3WD5L 2O5ZH 3TH3T 4P5MA 5D2NE 3RHWK 1HCFX 4PLKD 4U1KA 4LPXA 3ULVL 4GKZB 4D9LL 3UZQA 3V6ZA 5AZEL 4PG9A 2B1HL 5ITFB 1R5WA 15C8L 1NFDB 3SJVA 3JWOC 1JHTA 4F57H 3R1GH 1I7TB 1T1XB 5TF0A 3CZFB 3VW3H 5DSCA 5TQ2L 3VD9A 4NN7C 3OKEB 4KPHL 1XF4B 1A14H 1YMMD 3C08L 1I7TA 2XG4A 3L3OA 5ALBH 1T1XA 3CZFA 2SEBB 4PB0H 4Y1AA 1N4XL 1YNLL 2P5EB 4U6YB 1BWWA 3UZEA 5HGGS 4OZGE 4ZUTB 2X4OA 3IJHB 2G5BB 2DL2A 2SEBA 1K8IB 2B20A 3F5WA 1M1SA 4U6YA 4V1RA 5E2VL 4MLSA 1HE7A 4ZUTA 5I8CB 1EBPA 2AJSL 3LKSA 3IJHA 1FYTE 4Z95L 4P2QE 4L4TE 4NQEA 2FSEB 1QFUH 5EG6C 4JHZA 3QDMD 5IF0B 2YWZA 4HG4K 3P73B 5I8CA 3N85H 3QRGH 1ITCA 2XZQL 2C4FU 5GSRB 2FSEA 1DVFC 4UINH 1LHZA 1WFUA 3P73A 3TBVB 3H3BC 2H9GB 2D0GA 5EU7E 3MLZL 4LCWA 4F7CA 5GSRA 4QRRE 3NN8A 4CW1A 4RIRB 3QI9D 4L29B 3KNBB 3TBVA 2H9GA 3W82A 5IHZA 1A7RL 4A6YA 1C16B 1S7XB 4WTZA 3CFKB 3NABH 4L29A 1RUML 5DRWB 4BA8A 1F2XK 4M7LH 4JFOB 5E9DD 3QDHA 4UBDD 5HI4C 5KAQG 1C16A 1S7XA 1KJSA 2QSTA 2Z8WC 4MQSB 4NGHL 4WRLA 3QUMH 4JFOA 5DRWA 5EBWB 4ONFL 3RDTA 1H3AA 1G7QB 4I2XA 1FRGL 1JGDB 2OSLA 5B3NA 4WNQB 4ZFOL 3U7AA 3PIQA 4L4TD 4LP4A 2B2XL 4I18A 4FQ2L 2NY7L 4MA3B 2V17L 5A40E 4MX7B 4YX2L 5E5RB 2BFVL 2P43B 1PBYA 2HKFH 2GJJA 4L4VD 3FAXA 4RBPH 3NCBB 3HNTL 2MPAL 3UPRB 3T08A 1ZHKA 2E7CA 2V5TA 1KZPB 3U9PL 4QRRD 4X7SH 4ZOBA 4NCC1 1C3DA 4HGMA 4M62L 3UPRA 3NH7L 3FQUB 4Y4KC 4OUOA 4V2BA 2YD6A 4DK6A 5C0BB 2MKLC 5I19L 4KZDH 4R97C 5EFIB 4N0FA 4FQLL 3FQUA 4M6MH 2JJVA 2Q1EA 4APQC 2F5AL 3UTQB 5C0BA 5DJCB 5HPOA 3SKJL 2DQHH 5EFIA 5J13C 3IJSB 2BJML 4WVRA 2EO1A 5FUZL 4IJ3B 4Z7QE 5K9OB 3HXCB 4N0UE 1H15B 4EI5B 3UTQA 5DJCA 2XWBB 2WUCL 2CMRH 5BO1L 3RZCB 5K9OA 1CG9A 5MI0C 1AP2B 3IETA 3OJDA 1H15A 4EI5A 2XWBA 4YGVB 1FVCB 3JTTB 3RZCA 2MQCA 3F7YA 3DBXB 4M1CC 1ZLWK 3TCLA 1AP2A 5TDNA 4NSKB 4F37F 1QRKA 4CU6A 4YGVA 4WHDA 3JTTA 4X7CC 3DBXA 3FO0H 5ALCH 3RWIB 1TNZB 3QZWB 2NW3B 4OCXL 2QL1A 3K7XA 3OX8B 4P23A 5CEZE 1E27B 3J8F7 3DO3A 5E94B 2QQKH 5JMOC 3QG7L 3O0RH 3RWIA 3QZWA 3TO4D 2NW3A 4OCSL 3D5RA 1NUDA 3D39E 3PWUB 5C7XH 5E94A 1W8OA 2P8LB 3BIBX 4PTTA 5EZLB 1NUNB 3A6BH 5IJKC 3DOSA 2QLVB 5DC0A 4NIKB 1YY9D 5GGSA 4O9HH 1QSJA 4G6ML 4XHJD 3PWUA 5C9KA 5BJTA 2P8LA 4J1UB 5EZLA 4AEIH 3V4VL 4R8WL 4JO4H 4KKBD 4DOHB 3LVEA 3BXNB 1PG7L 4Q7DA 4YFLF 5H37G 5EN2A 1Q9OA 2DTML 2XFXB 4RMRA 4NRZB 3S36X 2EIZB 1G9NH 2R2EB 4OI8A 3ZYZA 2BY3A 3GSWB 5D7LE 2VDOH 3PABA 5FGSA 3WS6C 1TZGL 2XFXA 2X44D 3VJ6B 4FMKA 2X41A 4GG6A 3K2UL 3IXAA 1CL7H 3GSWA 1F3RB 1SY6L 4KKNA 1N7MH 1D5MB 1JTTA 3VJ6A 2MSPA 2IMMA 4JPKL 5IFJB 3CXDL 1F13A 5J6HB 5EOTA 2XKSA 4ZXBC 4FP8H 3D39D 2J8HA 4P5TC 1CZ8H 3FB5A 5E8NB 3HFML 5IFJA 1YNKH 1FFOB 1QQDA 4YLQT 3HG1B 4OB5H 4NP4L 5HYJA 3PGFL 2ESVA 5E8NA 1QZ1A 2A6JB 5EUOF 4YHNB 3I6GA 4KKAC 3HG1A 3LH2H 1K6QL 3V0VB 3CVIH 4PJ8C 2A6JA 1UXWB 3ESUF 1DE4B 4YHNA 5KW9L 1S9XA 3KPPB 3H42L 4MJ4A 1CICC 1IGCL 3V0VA 5T1DH 2ZUVA 4IRZH 1DE4A 1AGFB 3FB6B 3R4DA 5JUEL 5KG9A 4MA8L 3DIFA 5T3ZE 2W0KA 1RUPL 4I9WE 5GQBA 2F53E 5L8KB 1YEKL 4TSAH 1NI1B 5CD3B 4P9ML 2FX9L 1J8KA 4ACPA 3KYMB 4N5UA 4LCIH 4HH8A 1CVRA 2D0HA 3LMJL 2X1OA 5CD3A 3X14B 3RIFK 1F97A 2YBRB 3KYMA 3QXAB 3WCYA 3BDYL 3DV6B 3GIZH 2W0FB 4QRUB 1E0OB 3QUKB 5JDSA 5IHUL 4PFEA 2D7OA 2F19L 2AQ2A 4QY8A 2YBRA 4G8GB 1O1RB 3DV6A 4K23H 5CZVH 3HI5L 3DMMC 2AW2A 4NUJB 1JPGB 2X1PA 3T0EA 1CYGA 5I1DB 4D4AA 3PHQB 2HKHL 2XACC 4NJ9H 5FK9B 4LSPH 2MCPH 4G8GA 5F8RC 5FDYA 4LKXB 4WEBH 4O5LH 4NUJA 5L0QC 1GGIL 2MTPA 2PCPA 5SWSD 3ARDD 3OEDA 3PHQA 5FK9A 1FO0H 5KSBE 5HGBB 3U36A 5C6WH 3QB7C 4ZO7A 1X9QA 2H41A 2PYEE 5T3ZD 5IGXH 2AJXH 4EQ3A 5JZ7D 4XVUD 3TZVB 4I9WD 2F53D 4RDQF 4PJDB 4HWBL 4R7NB 1F90H 2ITDA 5D1QD 2QHRH 1FORH 3OBAA 1OM3H 3TZVA 3TPKA 3VGFA 4PJDA 2BVEA 3E0GA 4R9HA 1GC1L 3AB0C 2DOCA 5EO1A 1MCQA 1FFQA 1RZKH 2R15A 3QWOA 3QUXB 1MLCB 4XC1L 1K2DB 1BQUA 1WZKA 2LU7A 1SJEB 4OSUH 5C6PB 4FQXB 2YD1A 3T8XB 2UZIH 4N0CC 5E99L 2WINA 1A6AB 3QUXA 5I17B 1MLCA 2F54E 3O8XD 1K2DA 1C08B 1N0XH 3QIBC 3F58L 5JHDE 3C8HA 3KR3L 1SJEA 3BFOA 2DYPB 1A4JB 2RCSL 3SOBL 3EYFB 5I17A 1MF2L 2Z31D 2O61A 1C08A 1CQKA 4B50A 4GRWE 43CAB 5JXEA 4LSRL 4Z5RB 1IVLA 3K74B 2PYED 4YIQB 2DYPA 1A4JA 3MLWL 5KVEL 5T1MA 1SEBB 1SMAA 1YECH 1UMPA 43CAA 4YIQA 3U4AA 3KPNA 4PGJA 4R4ND 4M8QB 4ZPTB 3RGHA 1SEBA 1HEZB 1UQSB 1OAZH 1HHJB 3SY0A 3ARGC 2IEPA 2EXWC 3MCLL 2NX5B 4POZC 1I1AD 4ZPTA 5AG8A 3E8UH 1UQSA 1OAQL 3O4LB 3VFWB 3V8OA 1QFWI 5DK3A 4MVBC 4KUZL 5KVGL 2DBJA 2C3HA 4ODTL 3O4LA 5BZDB 4N9OB 4PJIF 3KPRB 2F54D 4RZCB 2AK1H 5JHDD 1OP3H 4MLIA 4IIQA 1AI1L 3JV4B 5E2TH 2DQUL 3SN6N 4R96B 5BZDA 5J7CC 4MCZB 4OCWH 3OWEA 4OQTL 3D18B 1T0NB 1JNHA 3JV4A 3CVHA 2NXYC 1TIUA 3VXUE 4KRPC 3MRGB 4JZJB 4R96A 3C9NB 4ONHB 4UV4H 4YK4C 4MCZA 3FT4A 4GAYA 3D18A 4ZSOB 4TNWF 2WLYA 2CKNA 5D7JC 5H35B 3WIIH 4JZJA 3THML 1I7RA 3C9NA 5CEZH 3GKWH 1SJHB 4LF3B 4M61A 4X5XB 4WIQA 4FXGA 1TPXB 2Y9RT 2Q8BL 4UU9B 1WAAF 4XPGH 1FH5H 3U0TB 5EO9A 4FFZH 3S35L 3D87B 2UVEA 1SJHA 4LF3A 4G5ZH 5KVDL 2QQLL 4K7PL 1JYVA 3HC0B 3LD8C 4DN4H 1MRDL 4UU9A 5TE4H 1A6WL 5FEBA 4JFPB 3DGGB 4U6VH 5KSUA 4IHOA 1UACL 1UWEL 1A7QH 4OUUB 3HC0A 4G6FD 3IRZA 4P46B 1FPTL 1MFDL 3DHJA 4OM0L 2A6IB 3DPBA 1F58H 5CP7B 3QXDA 5DVMA 1AO7A 4M1GH 1ZA6B 2OXGA 1DLHA 5GZND 4ZYKB 3OAYH 1KCVL 2OL3A 4P46A 5ADOH 1X5AA 4K94H 5D71H 5FKPB 4UB0H 4ZOAA 5CP7A 4GBXB 3VXUD 3RPKA 1ZA6A 5IEHB 1J8HE 3MJ7B 5E8EB 3QQ3A 4NZTL 5ERWA 4DAGH 1KCUH 5FKPA 5C70A 4QHLA 1QLRB 1QSFA 3QQNA 4OFKA 3TH4T 1PY9A 5IEHA 1BF2A 2X1XR 3MJ7A 1HILB 1MEXH 1IT9H 4TNVF 1RSFA 3HI1B 5T1KB 5KS9E 2CDGB 1Q9LB 1FVEA 4KJPC 3MJ9A 4HUUB 3SDXB 3QEUB 4PP1D 1N8ZA 2WNGA 1KPUB 3QNXB 1HILA 2WV3A 1DP0A 3HI1A 2CDGA 2NY5H 3VXPA 1IKFL 4FQIH 3QUZD 4HUUA 1F8TL 3SDXA 3MTRA 1Z9MA 1KPUA 3EO0A 3RAJL 4LLQB 4MAUH 4J8RA 4IRJD 3BAEH 4JM2D 4GW5A 5J1SC 3E37B 3ZKND 2CGRL 4CMMB 1O0VA 5HPMB 3EUVB 3O6MH 4LLQA 1ZMYA 1GCFA 5F7FA 2DQDL 5C9JA 3GMPA 4XBEL 3QULA 4MSWB 4FFYL 4V1DB 3NCMA 4IRSA 4S1QH 3Q5OA 1KJ3L 1WBYB 5J9PA 3DTXA 1J8HD 3L3DB 5HVHB 4MSWA 4M03A 4V1DA 3BPNB 1AKJA 5E2WH 2H32H 1VGEL 4O02H 3TFKC 1D8DB 1WK0A 1NGQL 4WTXA 5T3ZH 1CR9L 5C3TA 1W6JA 2I60L 1LVEA 1FIGH 1KC5H 1BD2E 1KCKA 2KQMA 4U4BA 1QR4A 1UWGL 2GTWB 3OXSA 1F4XH 4RISH 3D6GA 4KHTL 5IKCB 4MU9A 4PBXA 1UH2A 4AZ8A 3HZMB 2D7PA 4XWOD 3C5JB 4X9HA 3KXFE 4Z7VF 1YEIH 1JNNL 1U8KB 2GTWA 4NNXB 4X8JB 1LK3L 1CIUA 2I27N 4X4XA 3RI5F 1UEYA 5HSFA 5IKCA 1YMMB 3RUGE 3HZMA 2P42B 2QADD 4P5KB 5H8DA 1CLOH 5C0NC 5HD8D 2W91A 4X6CE 4NNXA 1ZS8A 3F62A 4DGVL 4TSCL 4XCYB 2KZ1B 2X4NB 5GISH 3SO3C 4P5KA 4TOYH 4QCIA 3NZ8A 2PN5A 2GAZA 2ZCLL 3DSWB 4F9PA 4UTAL 2R56L 1T7WA 2DB8A 2EC9U 3ARQA 2X4NA 3BESR 4CN1A 1QR1B 3E2HC 2MFNA 1FFNA 4S1SH 2XKNB 3BPCB 3HAEG 3AUVA 4Z7OF 2BDNL 1QR1A 2A77L 1J87A 2F58L 5CEYA 4HXBH 3M07A 5D2NB 3VI3F 3JWOL 3QDMA 1BD2D 3BPCA 3MNZB 3SDAD 1AXSB 4IEFB 5ILTL 4LDLB 2HWZH 1NDMB 4FN0A 3QDAA 3BH9A 4BQCA 5GZOD 5EZIH 1TXKA 5D2NA 3D85D 3KXFD 4M3KB 3MNZA 1HHKB 3QI9B 4R7DB 1I1RA 4JG1H 4XVTL 3BKYH 1AD9B 2P44B 5TE6H 1NFDF 4S1DC 3MZGB 4QWWD 2DRUA 1F6AA 3FCTB 5FKAA 3VWKB 3AS2A 3V4UL 4LVNB 1WCBB 4MAYD 3LQZB 4R7DA 1X5FA 1RJZA 5E2UL 2EKJA 3S37H 1IAII 3FCTA 4OZGB 5EWIH 1UJTA 1HDMB 1DQTA 1WCBA 4EEEA 4MB3A 3LQZA 1M7IB 1LEGB 3MCKB 2ICWB 2JB5L 3OAUH 4P59L 4WI7A 5E9DA 5GGUB 5ICZB 2FO1A 1NBZB 3SQCA 3KSQB 1H37A 1HDMA 2VH5H 4EJ1C 1TITA 4JFED 1FYTB 2VXQL 3NTCL 3SFYB 4P2QB 4L4TB 1LEGA 2R2CA 2ICWA 1CFQB 5I1HH 1G7PB 5GGUA 5ICZA 2RB8A 4DUXA 4LASH 1KIPB 1GPOL 3AVEA 1CFTB 4BH8B 1FO0B 4PB9H 4GRWH 4DVBB 4XPBH 1G6RL 2P5WE 4L4TA 2X05A 3P30H 5F7YC 1G7PA 4TULL 4W70A 2JJTA 3A6CH 3G6AB 1GGBH 1KIPA 3QHFL 2XTJE 1CFTA 2JJWA 3BUYB 4TN9A 4PD4J 1TNUB 2IAMC 3KS0J 2CKBH 4PPTA 4L4VA 3HQAA 5D6CA 4ZOCA 4QRRB 4MJ2A 5K9QG 1J05A 1WFTA 4JQXA 5CFHA 3QDJE 5IV2B 3G6AA 4XXDA 5DR5H 3HMXL 1AJ7L 3BUYA 3KYAA 1J10A 1XF2B 1A6UH 3N1MC 1MI5E 1YPZE 3KGRA 1H0DB 6FABH 1OGAE 4Y4FC 2PYFB 5ENWB 4BZ1L 1UM4H 3FT2B 3JV0A 3FONB 3W9DB 5JOPE 5CJQH 4R4FL 1HQRA 2F74A 2PYFA 1BWMA 5ENWA 4Z7UE 3FT2A 3PV6B 4ETYA 1JHLH 3PWJA 3BZDA 5IT2H 3RHWF 1A0QL 3EYUL 4HJJL 4BQBA 3PDOB 3DO7B 4FG6D 4D3CL 2EDJA 3DSNA 2PTTA 4RAVB 4XH2B 5DYOB 4PJAF 1EO7A 3PV6A 4NO5A 2JELH 2Y36H 4GW4B 3LB6C 2P5WD 3GK8H 3PDOA 5JW4R 2J4WH 2FGWL 2D7NA 4RAVA 3EBAA 3DYMA 4XH2A 3VFTB 5DYOA 5FUCE 3WIFA 2XTJD 2ZSWA 2NY3C 4HUNB 1NSNH 2HN7B 1LMKA 3PP4L 1OHQA 5HYQA 3VFTA 3QDJD 1MUJB 2UVFA 3C2AH 4ELKB 2R2LB 2HN7A 2HTKC 2NW2B 2AEIT 2BVQB 1MI5D 3BPLB 3QCUH 5B38B 1OGAD 3JWDC 2IPTH 4LVEA 5JOPD 5B38A 3TO4A 1MIEL 2LVEA 5DT1H 3E3QC 1IAKB 4PJGA 1IEBB 3CDCA 3BKJL 5F70A 4L1HA 5DRZA 4N0UB 1QEWB 1CLZL 5E00B 2EDNA 3HMWH 3LS5L 4OD2B 3HNVL 1TCRB 4U1GB 1W8NA 2P45B 3OB0H 4EOWL 1IEBA 2R2HB 3UPAA 4M6OH 5J12B 3MGTB 1QEWA 2VZSA 5JPNA 3VGDA 1UYWH 4BK4A 4K7PY 3C72B 2RIKA 4XVJL 4OGAD 4LSSL 4HLZH 1CXKA 4YE4L 4ZTOH 4HPYL 4LQFH 3HR5A 4JGMA 2V9TA 5FGCE 4KVCL 1FZMB 3LEVL 3N06B 3RDTC 3PGCA 2Q76B 2VLLB 1AQDB 1LO3L 1FZMA 4UOJA 1IAOB 3D39B 4I18C 4LPVA 4OLUH 2V2TB 2BY0A 2IPUG 2BSRA 2R0WL 4DUWA 1CD9B 5D5MA 1EZVY 3CSYB 4PRAB 1U3HB 1ACYH 1W0VB 1IAOA 3D39A 1YEJL 2OYPA 3VGHA 4AMKH 4LRNH 4I77H 2J2ZA 3L5XH 3JV5A 5TFSH 5IOPB 5AAMA 1HXYA 3CSYA 1Q0YL 1W0VA 1M71B 1MJUL 2FJHA 3ARSA 9CGTA 5I8OL 12E8H 1S5IL 3B9DA 5IOPA 4J2XA 3WFCH 1MJ8L 1DBJH 5FFLA 2ILLA 1KYOJ 2E9JA 1M71A 1UEMA 4G6KH 5D7LB 1DBBL 3VXRA 4GAFB 4KQ4L 1FL3A 1A7BA 3MXVH 1HXMA 3O6FD 3W5NA 3FN0H 2ERJB 4NOFA 5CEXB 2DLHA 4N8CH 1NCDH 5DEZA 1T66D 2DQEH 3MLTA 4ELME 1SYVB 3ORJA 3UMTA 1KB9K 4XNZC 2DQIL 3RTQC 5KOVC 3JWNC 5EZOL 1V7MH 3F8UB 4XBPA 1SYVA 4WB2A 1RIHL 2AGJH 2LE9A 5INDB 1DSFH 5DVOA 4LNGB 3STZB<