5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
2GK0A 4ZS7L 1ZANL 5DD0H 2YD5A 4JE4B 4PGDA 1D5BB 4FXGA 5FM5O 2UWEB 5CEZL 2AK1L 1MREL 1Q0XL 4KKCD 3MRBA 3LEXA 4LHUD 1A1MA 3AB0B 1XGYL 2V9TA 1I1AB 2YBRB 3VI3E 4NQCB 3SDAA 5D5ME 3QHTC 2Y5EA 3QIBA 4N5ED 5IIEB 4Z7WB 4QCIB 3KLSA 3EO9H 4YHIA 5E2WH 2COQA 4H26A 2MMXA 2CD0A 5TQ0L 3ZKXB 1DEEA 5EH1A 2V2WA 1X81B 1WBXB 1MWAL 2ED7A 5C0AD 1NFIA 4FQJL 1KN4L 2OR7A 4WW2A 3S88H 3QH3A 3OZ9L 1UXSB 4XP4H 3F6IA 4XWGH 2DRUA 2VC2L 3BZFB 2AJZB 2J88H 3PDOA 4F7MB 1IEBB 4MLIA 3QISA 1PKQE 3PF2A 1C5DB 1RZ7L 3QUXD 3NZHH 1SQCA 3F12A 4P3WA 2YUVA 1L9MA 3DSVB 2BVOB 4P99A 4P4KA 1G9ML 2NTFB 2IBGA 4OQ1A 1ACZA 4LDOB 4C4KT 2WY8A 1SYSA 2IF7A 2YD4A 3IDGA 1AD0B 2UZXB 1KB9J 3ARYA 3E6HB 1CL7H 4K3DL 5TPWL 4U05A 1UH3A 3NACH 3T65B 3MBED 3OKDB 3O6FB 2VXTL 5AAMA 4OB5L 2DQCL 4KDTC 1HSAA 1N4RB 3RHWF 4PJIF 4P2CG 1Q72L 5IT2L 3TV3H 5ICXA 2ZP0T 3RA7L 3E33B 5JPMB 4QRPB 4ZS6C 4DKEH 5JQHC 2Z31B 2WIIA 2VXVL 2R9HC 3CFKB 1OP3K 4UIMB 2Z91B 3ZKNC 4ELMA 4P4RA 3AREA 2HH0L 3I50H 4OQTA 4KI5C 4O2FB 1SVCP 1PLGL 3DUHA 3BIBX 4ORGA 4S1RH 1AXIB 4Y88A 2NXZD 3U30C 3G6JA 2V8IA 2CKBB 2XICA 1PG7L 3ULSB 3QDMA 1JMXA 3FTGB 1VEPA 4W68A 2PUQT 5DJ6B 3MLXH 4HUWB 5AG8A 4Y89A 5A2LH 2B1HH 2XWBA 2DLIA 2A6KA 2PMVA 1XR8A 2RGSA 5IOPA 1PZ5A 3O3EA 4RDQF 3MOAL 1I8MA 5A16B 3NN8A 2V2TA 3K8MA 1RULH 4HDIB 4L9LC 3BSZH 3LKSA 5GGTL 3VXSD 4NQXA 4G6KH 2PYED 4LKXB 2HP4A 1ED3B 2NY4C 5T5FL 2DM2A 5I1GH 4PRBA 4JZOA 4UV7L 4HC1A 3S3SA 5KVFH 2WWKO 4B5EA 5JOEA 5ADPH 3C5ZD 5E5RB 1J11A 3VH8G 3WFDL 5DHXB 5AD0A 3LMJL 1DBML 4HIIB 8FABA 3AU1B 4M4RA 4PJIA 4WB2A 3DXAD 2QSVA 1BLNA 4XXDA 1P1ZB 1MHCA 5CFHA 1LO5A 3W81A 4XMPL 3EJJX 4DW2H 5TE6H 3DGCR 4JFYB 1I7TA 2E3VA 2OCFD 3GSRB 4KK6C 2YN5A 1G7MB 2ICWA 5DRNB 1HHKB 5EIQA 1KLFA 1T1ZB 4U0RC 3UTQB 4KXZH 1R3LA 4U6XA 5E95B 1I9JL 1M1SA 3WE6B 3WXWH 3SDXE 2BEDB 4X6BA 3D87B 4ODHL 2EC8A 1CICB 1D6EA 1UJ3C 35C8H 2P45B 3FONA 1CFQB 2HN7B 1M7XA 1FH5H 4M5YL 1M05A 1JJUA 4LU5L 4Z7VF 3SCMC 5JW3L 5L2KA 1FBIH 5I66A 1MLBB 4Y8AA 4FQQB 5F6IC 3HR5B 1OB1A 3DX6B 2A6JB 3O4LB 5FO8B 4PJGE 4LLVB 1VKXB 1TVBB 2EC9T 4UQ3B 4FQXC 5KJRL 3QJHB 4C56B 4XNQB 1KTKE 1ZT7B 2W07A 4FP8H 2YUWA 1Q8MA 1NGQH 1OGTB 1QLRA 4X6EB 3GUTA 1SM3L 4QGYA 1RHHA 1UM5H 3MRPA 3OXSB 4L9DA 1P4IH 4WI2A 4R3SA 4WRLA 3RFZC 4TUJA 2CMRH 3AMKA 3I6GA 5BJTA 1KTDB 1ZHBA 3SGJC 4K3HA 3VGAC 4M6OL 3EU5B 2FLRT 4M61B 3O45A 3M17A 1LTXB 2PYFB 4C58B 3ARPA 1DBJL 1F6AA 3V9FA 5HDOA 3JTTA 1EUTA 4GG6A 4P46D 1Z6JT 1KTLA 5KTEH 4OQTL 5HHMD 1CVRA 3BIAX 3UYPA 2X70B 2CLZB 4X83A 4JY5L 1GHQA 1CE1L 3GZKA 2VZTA 5IBTL 1PKOA 3V6OE 1GHFL 1RJZB 1YA5A 5EU4A 4Z7VA 3PNWB 4QRSB 5TDNA 4I3RL 1MQ8A 5C0FB 3QZWA 1XF1A 3GFUA 3PGCA 3GRWA 3RUGF 4Z7QF 1QSEB 2JIXA 4YUEH 2C7UB 3P4MA 3MUZ1 5DMIH 4P9HL 4M6NL 3FQNA 4JKWA 1S8DB 4O5LH 2CIKB 3WXVL 4KXZI 1X5AA 4JRYE 3T77A 2P46B 3WUWG 1BGXL 4HC1L 3VE0B 1A7QH 1JMZA 4N1HB 3FFDB 4I0KA 2APTA 4I0CC 1YPZB 5EA0H 2H3NA 3C09B 4EBQH 4JHAH 3VXUE 3HMWH 4JAMB 1A64A 4OZIB 5E5MB 3UO1L 2OTPA 1FSKC 1QYGL 2NX5A 2MQ3A 3PGDA 2GCYB 2XYCA 4MS8D 4RISL 4JFHD 4OSUL 2G5BA 2AVGA 5DFTA 4DGYL 4W6WB 4OIAA 2V3NA 4TSAL 1WT5C 3R8QA 3P0VH 2OJEB 2H32H 2ARJB 3K2UH 4PJCF 3VWKB 1A7PL 2BDNL 2B0SL 1S7UB 4PB0L 1P4BH 5DGRA 5ICYB 3JXAA 4F58L 2WZPD 2YPLD 5HHVH 3LPWA 4GTRB 4HSQA 3WFBH 2FX9H 1YEEH 1GPOL 2YEZA 4U0QB 3VMOA 2C1OA 3SDCB 1DP0A 3BD5A 5EZIL 4UNVA 2G02A 3QHFH 4TUOB 1WFOA 3MUHL 5DYOA 4YPGB 2A6IB 4GBXA 1AI1H 1A6WL 1HQ4A 2IH3B 1OAUH 1F11A 1H3PL 1N59A 2CJUL 4XNXL 4Z7UB 5B39G 3WEXA 3CXDH 5IHUH 1TNNA 2VLJB 3HLAB 5DURB 2ZCLH 3HC4L 3D2UB 3MRQB 4B53A 2VLRB 1R3IL 1MWAB 4LQFH 4WW1A 1OARL 3UTOA 3HE7B 5I1KH 3OXRB 2A1WH 5DJCB 3QFDA 4YIQB 3V6FB 1U93A 1FNEB 2J6EA 1KPUA 1KC5H 1C5AA 4J8RB 3H3KA 5DR5H 3DPYB 1SA4B 1IM9D 4ZO6A 1ZKAA 2J8UE 1OPGH 1BWMA 2ITDB 2QQKL 4WHTA 2R1XA 4NDMB 3NA9H 4YBHA 3ARBB 5DJDB 5IG7B 4JDVA 5T33H 2HT4D 3BKMH 5KSAB 3WJJA 1D7FA 3FO1A 4N8VA 5IVZB 2X4NB 4LIQH 2N56A 4X4ME 4PJCA 4PJDF 4PBXA 3E6FB 5H94A 5IVOA 5HYSG 1MRCH 3MQIA 4QY8A 1UADC 1KJ2H 2Z9TA 1F45A 1BQLH 4AM0A 2W0PA 3NCCB 3DUSB 5H35A 2PN5A 1BQHA 5KSBB 3H7BB 5BRZE 2NY0C 4ODSL 4P2QA 3NCYS 1FYTE 5LGJB 4JFEA 3GRWL 5FM8A 4PJHE 3HG1D 2LV4A 3S35H 4KJWC 5JXAL 1EA9C 1EJOH 2A38A 1C1EH 3EYSH 1JPGB 3IU4H 2ZUQC 5FYKD 3WIHH 3U6RB 2K1MA 4GUPA 2BNQE 4HMDA 2R4RH 4NFCA 5HYFA 1F4WL 3ZYIA 2R8SL 4JDTL 3DIFA 1KFAL 4M5ZL 1RURH 4C55A 1XGRB 2C1PA 1U8IA 5FB8A 2IWGA 4IHOB 4MCZA 5C9JB 2F5AL 5B8CA 5FYLE 5I9QB 3RL2B 3NCBB 5D1QB 4UILL 3HS0A 4XI5C 5F71A 5JHDD 5L0QC 5GXBB 4M7ZB 2P47B 1EZVY 4ZFOB 3BRGC 5CJOL 3KPSA 1T4KA 1IC7H 1FNLA 3X12A 2YWYA 4UU9A 3T2NH 4OGYH 2VRAA 4JRXA 4OCRL 1UYWH 3VWJC 1WWBX 2GK0B 1OM3H 4KGLA 1KB5H 4HQQL 4Y16B 4Y19A 5GSRA 4NJAL 3RHWK 1CDUA 4P2YA 1XZ0B 4FQHA 3EDFA 4H8WC 5BW7A 3MRBB 5I8CB 3O3AA 1A1MB 5GJTL 5CUSH 2F53D 5EFIB 1OTSD 3KDMA 3F8UB 3SDAB 3ISWA 1N9AB 4HPOL 5E4IA 3RY5A 3LB6C 4EI5C 2D7NA 3D39B 3VG9B 3ZTNH 5ID1A 4LRNH 4YHIB 5AZ2L 1LO3L 4H26B 3SGKA 4DUXA 8CGTA 1DEEB 4LOUC 3EOAA 2V2WB 3SKJH 3P0YH 3S4SB 4KHXL 3MRFA 2P5WB 2CRIA 3LD8C 2IPUK 4BK5A 1NFIB 5HSFA 1C8PA 3AC0A 4KKIA 4WW2B 4LRIC 5SWQB 4G8IA 2J6EL 3QH3B 5T5NF 3ZKSD 1S78D 5E99L 4X4ZA 3PDOB 1M71A 1JRHI 5F7NC 2WBJC 1KOAA 5IWLA 3F12B 1NL0L 2H2SC 5LQBL 1YEHL 4TULL 2CRZA 5GHWL 4GW1A 1V7ML 3BEVA 1N4XL 3P11L 5EUKB 1QA9A 3G6DH 3QIBD 3IDGB 3KLAB 5KVDH 3LPFA 1A1OB 3OJVC 3EIFA 4FFWC 3C5SA 3U1SL 1MRDH 1WAAE 3G5YA 3DTXA 1AKJA 4EVNA 2WQRA 15C8H 3OAZH 1HSAB 1O5DT 1GGTA 3HPJA 2J5LC 3MNZA 5ICXB 1RUQH 3BUTA 1L7IL 4X98B 1FZKA 4IM8A 1T1YA 5L7XH 2VQUA 1INDL 2L0DA 2WIIB 5DRXA 5CBAA 2OM5A 4KJQD 1VFMA 4P4RB 1KJMA 4NQSA 3AREB 4WJ5B 4P9MH 5DUBA 2DJSA 2DQJL 3UBXB 4ORGB 4P4KD 4NHUA 4KTDH 5MENE 3K1DA 3ARGC 3QDMB 3UC0H 2OS7A 3SDDC 3ULUH 1NI1B 2OQJB 3BHBA 3QQ3A 4LVNC 4PIRF 4YDLB 2E7LC 5GGVL 1FFRA 4M00A 5IBLD 2AGJH 4F9PA 2KZWA 3VG0H 4UNTA 2XWBB 1CYGA 2DS4A 4ZUVB 1F58L 4P3DA 1XR8B 5IOPB 2G75A 1PZ5B 1I8MB 3NN8B 1M7DA 1LDPL 3LKSB 4MWFA 3V5KA 2R2EA 4NQXB 1TNUB 5D7JB 4NUJA 4NYLA 1ZK9A 3SBWC 4KUZH 5E8EA 1MFEL 4NKIH 4TNWF 4FXKA 3WNLA 3KJ6L 3R1GL 3WIIH 3P0GB 4HXAL 3KPNB 5J89A 4RGND 2X1WL 2F0YB 1FIGL 5AD0B 4NT6B 8FABB 4PJIB 3SJVE 1AH1A 1BLNB 5F8QC 4XXDB 5KVEL 1RUKL 1MHCB 1FFQA 1LO5B 1Y0LA 2JK5A 3IKCB 4BFBD 1I7TB 3DO3A 3CUPA 4L4VA 2VWEC 5JMOC 1HI6B 1OW0A 2QSTA 4LSQH 4OT1H 5LCVL 1R3LB 4U6XB 4JFXA 4QF1A 2VXSH 4RZCA 1MY5A 3TJEH 2NLJA 1H36A 1RIUL 4X6BB 1IGTA 2I60L 1IGMH 3FONB 1RAMA 1WBZA 5EORL 4PY7A 1G0XA 1BFTA 1DDHA 1JP5A 4Y2OA 5F1NB 3S36L 2EIEA 4MBGB 3N1MC 1A7RL 4FQCL 3OGCA 4HKZA 5I66B 1I7UA 2VSDA 3DETD 4PRHB 2GJ6D 3UDWC 3STLA 5C0GA 5E2TH 2HVKA 3U0PA 3QUMH 3IDXL 3UTTA 2GJJA 3Q3GB 4LPUA 2Z35A 5HTSA 3U0WL 4GAGH 4G9DA 2BSRA 3ZKXC 1RHHB 5E9DD 2X6MA 4EEEA 3MLPA 1UEYA 3KPRE 1T2JA 3MBEC 4R3SB 3ZT7A 3SE3A 4TUJB 1B6UA 2P4AB 1F8TL 2BXZA 4XPAL 2JCCF 1I3RA 3I6GB 4MHHG 1KGCE 1CR9H 2H2PD 5SX5K 4PB9L 1CK0L 3M17B 3NABL 3OGOE 4ZOBA 5C0BE 3MV7A 5T1MB 4R4ND 1F6AB 4Y5YA 1H0DB 5L2KD 3JTTB 2Y6SC 1HKLL 4LLWA 2D7PA 4WI3A 3RDTA 4GG6B 3ZL4L 4L8CA 3OF6A 4Z0BH 1UA6H 2BRQA 5IK3A 3RBSA 3V0AC 2GSIB 3Q75B 2BMKA 3D48R 4K8RL 1EZVX 5D1ZA 1ORSB 4RNRA 4Z7VB 3WO4C 2J4WH 4Q97A 4YDEB 1BFVL 5TDNB 4ZSOE 4MJIA 5B21A 3O6FC 2OP4L 3QZWB 5D70H 3DV4A 3PGCB 4MAYA 4M43L 4NKMA 4TRPH 1T5XB 2WINA 4JJ5A 5EOCJ 3PQYA 3P4MB 1T89A 4GW5A 3TBWA 2Z31C 3WNNA 3FQNB 3VFRB 1GGIL 1S7QA 1HK6A 1PEWA 1IBGL 1GGBH 3T77B 3C5ZC 4ELKA 4U33A 2JCCA 5FKPA 5LGKA 3BYTA 2D0FA 4FN0A 5DFWH 3W82A 3I6LD 3RU8L 3ZTJG 4D0CA 4PLJD 3T0ED 2X09A 5IJKC 5CJ8A 1KCUH 5TE7L 3SO3B 2ZJSL 3MV8E 3SEPA 3SQCA 4NWUH 3DRQB 3BDYH 4Z0XA 5IF0A 4K7PH 2NX5B 4M7LT 4K23L 3PGDB 3Q79B 3MA7B 3DMMD 2R0LL 4YPJA 5C0RL 1NGWA 3KYOA 4H20H 2G5BB 4DVRH 1KEML 1ORQA 1FHGA 2JIXD 4ODTH 2R0WH 4DWHA 1NSNH 4DQOH 1MFDH 3QHZH 3ESVF 4N8CL 3VFNB 2DDQH 3MUGA 5HYQA 1TJGH 4D0BA 5HI3D 5C6TH 1XGTA 4HS8L 4NGHL 3F7QA 5ALCH 4NNXB 3RUGB 1G9NC 1AC0A 4NP4H 1F4HA 2I26N 5C3TA 5D2LE 3IDUA 4OI7A 1C08B 1E4WL 5A43C 2DWDB 1D5MA 4GBXB 1G9NH 1KZOB 1HQ4B 1QLFB 1F11B 1N59B 4KTYA 3O2DL 4UT9H 3GSOA 3AVEA 3EZJB 2EDNA 3AM8A 4D3CL 3QG7H 4LCWE 2VDMH 1CICC 3FQRA 1ZVHA 2DKMA 1I9IL 3K80A 3WKNA 3QFDB 3VA2C 2JJTA 3REWA 2Q86A 3BZDA 4CN4A 1GAFL 4MGXA 4ZAKA 3ILQD 4IDJL 4WHTB 1INQA 1X9QA 3B9AA 5TGBA 4R7DB 4JDVB 2XKSA 1MIMH 3DROA 5IEKA 1MFAL 3ALPA 4IS6B 3FO1B 3P4NB 4PJCB 5H94B 4QY8B 5K59F 1KJ3H 2HFFA 1WZLA 5GRVL 2ADFH 2FWOA 4AM0B 5EZOH 2BZDA 1SEBA 2V5SA 1T6VN 3MRCA 1BMGA 4WFHD 4CJ1A 1AGDA 1EH9A 4P2QB 3VXMA 4ZFGH 5JOFB 2WP3O 1CE6A 4LLYA 5GGSA 3BVNA 5HHOD 3C9NA 1UACH 1I8IA 1JNHA 4MVBC 5ISZA 1N4QB 4WY7L 3ARQA 4WWKA 2D0GA 3SE4A 4HIJB 3T0WA 5IVXE 4PG2C 4GUPB 4P3CL 4MQXD 3CU7A 2D0HA 1Q38A 2VE6A 3INUH 4LCCA 2GTZA 1VB9A 3B2UD 3FAWA 3DIFB 4AIZA 1NCDH 3LS4H 1ONQA 2C1PB 5CD3A 1U8IB 1IKNC 3ZE1E 4I77H 4MCZB 1HOCB 3DUUA 4ONHA 2BNRD 4EUPH 5I1IH 4JFED 4PJDB 4PJ8D 3Q73B 1HWGB 1KELH 1T4KB 1MI5A 3X12B 2DMCA 2HTLC 4HW6A 3EJZD 3QEGL 2UUDK 3VH8A 1JNNL 3PWUA 2QQLL 5L9DH 3W0WE 3JV6A 2AJYH 2FZ3A 3LQMA 4Y19B 1C5BH 4YK4C 2Y07H 3PL6A 5TF1L 4FQHB 4HWZA 3RJQB 3PV6A 3BKJL 2OR9H 3O3AB 3OEDA 3KDMB 4EIZC 1MCBA 3I6KA 5ID1B 4JFDE 1TN7B 4BQ6A 1YEJL 2Q20A 4X7DC 3QDGD 5DTFA 3PWJA 3HI5L 5C7XH 3PUCA 5I6XC 3VWKC 3ARSA 3KPSD 2D31A 4EQ2A 1WFTA 3VMPA 4PJBF 1MAKA 1YECL 4JRXD 5MP6H 5IB3A 3O6LL 1NDMB 5F1KC 1J1OL 3D3VB 2WSKA 1NCCL 1ADQA 1Z0NA 4P57A 4XP6L 4ZS7H 1M71B 3TJHC 3JWOH 3SDCC 2HT4C 1B0GA 3MXVL 2FRGP 3JSSA 4PJ5B 5JIHA 1MREH 1QBQB 1Q0XH 3FQUA 4GW1B 4TNWK 5HD8C 2OTUA 1MZCB 3SQOL 4W6YB 1T6WA 2OJZH 3BEVB 3Q7AB 5I73B 1V3JA 3V6ZA 2Q1EA 4Y1AE 1RFDL 2X1OA 3GMMB 5C08B 4TQEL 1FAIL 3N9GH 1AE6H 1A4KA 3FRUB 2JJWA 3QPXL 3EJYD 3HMXA 3CZFA 3NAAH 3DTXB 1MCNA 4GQ9L 1GGUA 4EVNB 5GS2D 4JO2L 3UCRA 4E41B 4OCWL 4M48L 3HPJB 3MNZB 1IQWL 2X1XR 1KPRB 1DVFD 2DTSA 5I19H 2EYRB 1TTGA 3ARBC 1SY6H 4LSTH 5T3ZL 1MVUB 5DRXB 2V17H 5CBAB 2CGRL 4G6ML 2NY2D 1KJMB 4NQSB 5FYKH 1FNHA 4NCDA 3ULUE 5AEAA 5DUBB 3QCUH 1FGNL 4PJBA 5IJVA 3IFLL 5DO2C 4NHUB 5DT1L 1Q0YH 1K8IA 2W59A 3LRGA 3GJEB 1G6VK 3BHBB 6CGTA 4TNVF 1K3ZA 1UB6B 4NFDA 5IFHL 5C0CE 3S35X 4XBEH 4FZEH 5TPWH 4ZFZA 3V52H 1AKJD 1FNSL 5E8DL 2G75B 5CIPA 3QULA 3Q5TA 1D5XB 5F7YC 1JZ2A 3WUWA 1M7DB 3X3FH 3WHE0 2X4UB 2R2EB 3V5KB 2R2BA 5KN5B 1H3XA 2PTTA 1F3DH 1EGJA 5E8EB 1B0RA 1A6VH 4YBQD 3TH2T 4FXKB 2Y72A 2FJHB 4KUCF 3MX0A 3RZCB 2X4QA 2BOCA 2AK4A 3QXUA 3QEUA 4J3UA 4OGAC 1BHGA 1UZ6F 4QHUA 5DMKA 1TNOB 3VFWA 1Y0LB 2JK5B 4XPFH 2GT9A 5I9QC 2KPNA 3CUPB 4L4VB 5D1QC 1RZIA 4M7ZC 4IMLB 1QBLL 4QRRA 1LP9A 2NYYD 1GSMA 1CGXA 2FBJL 3QDJA 3RKDC 5SV3A 4YLQT 3BI9X 1IT9H 1LE5A 4GS7B 5DD1L 3BZ4B 4MJ2A 1DDHB 1ADQL 3BJ91 2ZG3A 4JCMA 3H8NA 3OGCB 4HKZB 5D7LA 3TCXA 1I7UB 4N8PA 4PRPE 5B39A 5JUEL 5GZOD 1J0ZA 3UJIH 5F44A 3Q1SH 5BCAA 3OAUH 5C0GB 2QL1A 4YWGH 2HVKB 3SDAC 1HCFX 4MA1B 3UTTB 1A6TB 3IRPX 4GTQB 4ALAH 4G9DB 3SE9H 2YD3A 4HK3N 2VISA 1MJ8H 4TSCH 2LU4A 5JPNA 2AP2A 4O00A 4LHQB 5IUSA 4DGIL 4FTVD 5CZXC 3B5TA 1I3RB 4WW2C 4W4NA 4P48A 3QO0B 4OJFL 5HYIA 2F15A 3H0TA 5HHNA 1MRFL 1YMMB 1Q94A 4M5YH 3MV7B 5HYSA 4Y5YB 4JPIA 2JLLA 1ZMYA 5GGUA 3RDTB 4B7IA 1E4JA 5KANI 1KJVA 3VRLE 4ZFFA 2DQUL 4P4KC 4L8CB 2EH8L 5ALBH 5CJBA 3MUJA 3QSKB 5I1CH 3PGFH 3QJFA 3RGVD 5DGQA 1JN6B 4DVBA 4R96A 1B4RA 4RNRB 1MJ7H 5DK0A 4NZUH 2OSLB 5IBLC 5KZCB 1QG3A 4MB4A 4XNUL 3HHRB 3DV4B 5DC0A 2ZCHH 4NKMB 1AR1C 3JV5A 2DL9A 4JJ5B 1XF5A 1BVKA 3PQYB 4M6OH 3BRFA 3QWQB 1OAXL 2BHZA 3GKZA 3UYRH 5JR1L 3TBWB 4WV1B 1DL7L 3FT2A 3RVXC 3MV7D 2F54B 1CDYA 1S7QB 3AREC 1Z9MA 4IRJB 5EOTB 5E2VL 1ZHNA 4ELKB 4RGNC 3DXAE 4KKBD 4FA8A 2JCCB 3OF6D 3NCYP 3U4BH 2A0LC 2VDRH 4XVUD 4YDKH 5DJYA 5L2JA 5HDLA 1RHFA 5E70A 4YDLC 3V6BR 1JYNA 5D1ZD 1U8PA 1OF2A 3GSQB 4Z0XB 5IF0B 1KT2B 4MJID 5FGRA 1NAKH 1X7QB 1GVIA 2DQEH 1NGWB 2EYSA 2XTJD 3KYOB 4MAYD 4OKDA 4UT6H 4P9HC 1ORQB 5GRUH 3RTQD 4CVWA 3VRJB 5FCUH 2AV7A 1NFDF 3QEQD 3EFFB 5CZVL 4V1DE 2APFA 3BGMA 3VMNA 3MUGB 1KIPB 5HYQB 3ZDYE 2F8VA 1XGTB 5D5MA 4MX7A 4NC1C 3MLTA 2R0KH 2CIIA 5EUOE 1UWXK 3BPLB 1D5MB 5DJAA 3S34H 12E8L 3TO4A 3BMVA 3QQ4A 4YC2B 4CL7A 2G9HA 3STZA 1DCLA 2X2YA 4P2RB 4R0LA 5A3ID 4DEPC 5KSVB 1PKQA 2DAVA 4DGYH 2HFEB 1JGEB 1YEDA 5C8JA 2H2PC 4LPCA 4U1JB 1OAZH 5EO9A 4OKVB 3REWB 1XGUA 5AUMA 4X4YB 3RKPA 4PG9A 4EKXA 5T1KD 2Q86B 1T22A 3V4PH 1U8LB 1INQB 5K9JL 1FO0H 4OTXL 5TGBB 2QKIA 4XCNB 2AJUH 5IEKB 4R26H 1NC4A 4AT6B 2VDPL 1G7JB 4O2CB 5FV2A 3VGHA 1TNMA 4JHWL 3FFCA 3LS5L 1RIHL 1QBMH 3DYOA 2HFFB 3F7YA 3DVFA 1LD7B 1A0QL 3VD5A 1IAIH 2FWOB 3L3KB 3RWJA 1SJHA 1KENH 3D6GA 5JZ7C 3VD3A 3MV11 3HC4H 1AGDB 1CDJA 3EO1B 1QSJA 4LF3B 4RFNB 2FD6H 4NQUA 3CFIC 5GGSB 1RPQA 3BVNB 1KSRA 1I8IB 5B3JF 4XPBL 2XQWA 4HJJH 4ZAKD 3TO2A 4WWKB 4JR9H 5J6GA 2VXUL 4PUBL 1ES0A 3ARWA 1BREA 3BGAA 3QCVL 3V4UL 4ISVB 3CFJA 1I7ZB 3TBSA 4LCCB 2GTZB 4PLJC 4FQPA 3H9SB 3LKRA 4TUKH 3G04B 3B9VA 1NEZB 1ONQB 1P5UA 2BCKA 2FO4A 4JG1L 5DVLA 5CD3B 3T3ME 3QUYA 1KV3A 1YDPA 1AGCA 2W1NA 4ZXBD 3E1F1 1FRGH 3MUY1 1HNFA 5CZKA 4ONHB 4Y5XA 4G5ZH 3VXMD 3CMOH 1ZLUK 3NIFE 4M62H 3MA9L 4X6DE 3EYVA 3VGEA 3KPMB 4RAUA 1N94B 3DBXA 5BQ7A 1MI5B 4XH2A 4K3JH 2J2ZA 1HYSD 3VH8B 5ISZD 1JHKH 5HI3C 3U7AA 3PWUB 4YHZL 2ICWI 3ABZA 2FLBT 3RNKA 1NCWH 2Z93A 1WUNT 3RWGA 2PTUA 2JB6A 1BVLA 5E5UB 3PV6B 1JPFB 3SDXA 2EIBA 3SO3C 4K7PX 4GKSA 1QUNA 4JPKH 1CXFA 5HVGB 2FX8L 1Q9KA 4HXBL 2GJZA 3DRTB 4I6OA 4AEIH 4D0DA 3I6KB 2FECL 2AXGA 3CFEA 4UILH 1FG9C 5DTFB 3PWJB 1F2XK 3S3PA 4A6YL 1F4YL 3X3GH 2D31B 2Y4SA 4FQ2L 4TNVK 5D71H 4JFFE 4OD1H 4XP5H 2CDGA 4PJGA 1BAFL 1IAII 3RWFA 3P4OA 4H25A 5IB3B 3TA3B 4HUKB 1FV1B 1HQRA 3ILQC 3BJLA 3DI2B 3LV3B 4O58H 3C60A 4G7YH 4P57B 1OAQL 2IFFH 1QACA 4JY6A 3P9LA 2WUCL 4LSSL 3PL6D 4OAWA 3NCJH 5GGRA 4GBXC 2VDQH 3FQUB 1TNZB 1AXTL 2OTUB 1EVUA 3L9RA 1NGPL 2APXA 2C5DC 4DN3L 1HN1A 3A67L 4EOWL 4KRPB 3MNVA 5MEPA 1PBYA 2MSPA 2P5EE 1R3KA 1A4KB 1LO3H 1XFPA 4GLRH 3K8LA 4ODUA 3CZFB 1H3UA 1BBJB 2VITA 2X89A 2XV6B 4QXUL 5FYKE 2F5BL 4HIEA 3MOBH 3NZ8A 2J6EH 2A77H 4YXLH 2IQ9H 2MHAA 3V6OA 1MCWM 1DSFH 1FDLH 3WJJC 1FPTH 1GRWA 3H9HA 3SFYB 3BIKA 4U1MA 3VD7A 1YY8A 4PJBB 1U6AL 5IJVB 3VXPA 3GHEL 4PREA 1ZA3A 1UVQA 3JWDH 4KJYA 5C09B 2FCBA 5CLWA 5HYEA 2NPLX 3NFSL 3HKFA 3TNMA 5E08H 3FB7A 5JHDE 3L95B 4FNLL 1E6OL 1P53A 2C3WA 5BOZG 4P23A 5FHBH 1F3JA 3QFJE 1AR2A 1YN7B 4JRYA 4ZFZB 5D7SH 3V8CA 3PP3K 1U2CA 1F90H 4Z77A 1A7OL 4UOW1 2APVA 2HFGL 5CIPB 3QXTA 2FO1A 4OFDA 3QB7C 3VD4A 2GTWB 4GAYA 2DLEA 1MAMH 1C7SA 2R2BB 4LSDA 2O5YH 5DD3L 2DN7A 4X99A 1LHZA 3P73A 2PTTB 2KQMA 3VXUA 1B0RB 1R5VA 1CFVH 4PD4K 2E7BA 5E8NA 5JW4N 1VGEL 5T1LA 5FA3A 5HDQH 4R90L 1JK8A 5E94B 2R0ZH 2BX5A 2E27L 2E6QA 3G9VA 3K81A 3I9GL 2AK4B 4S2SB 1F97A 3QEUB 5F88A 1U3JA 2VDLH 4KDWA 5DMKB 3OQ3B 5KSUB 3VFWB 5B8CC 4MYWB 5GRJL 5CD5C 4NUGL 4OFVA 3WLWD 4FQ1L 2GHWB 2RJMA 3PHQA 2DB8A 2V5RA 3K0WA 1CLZL 3F7PC 4JPVH 4UU9C 1ZS8B 1HEZA 3QDJB 4ZUWB 4GKZA 5D7IF 7FABH 2VZ3A 1DEDA 1GOHA 1S5IH 4OZHE 4RAVA 1QFHA 3RZWA 3S6CA 4XZUA 1A14L 4RWHA 4TN9A 4QXTA 4GLRI 4WNQA 3WFHA 3QA3B 2XN9E 3PZ3B 5BW7C 4RFOL 4L3EE 4N90E 2E9WA 4NO0A 2WQ8A 3OR7A 2H1PH 4EI6A 2EEAA 2XQYG 2NNAA 1INEL 1LO2L 1A6ZB 4AEHL 3SGKC 2OK0L 4B50A 3ELAT 2VDOH 1UH4A 5LKNA 4QRRD 2R29H 2C4XA 2WV3A 4CVXA 4CUCA 5KW9H 1JBJA 4I2XA 3MACL 4PJ9D 2VDNH 4WUKH 5FUZH 1NGZA 2VB5A 1CLOL 4X4MA 5GS2H 5C2BH 5HHNB 4YHMH 1J5OH 1DQDL 3ARDB 5HYSB 5IWLC 1YNKH 2NY2C 3MV9E 4H1LH 5F93C 5D7LD 1EFXB 5GGUB 4P2OA 3W9EA 3B9DA 3O9WB 1KJVB 4HMCA 1XCQB 5TE4H 1HHGA 1A9EA 3N06B 1HXYA 5BRZA 1JGUL 3IJHA 5I73C 5HXMA 2A74A 4M1DL 4BFIA 4G7VH 4PJHA 5I15H 1DQQA 4R96B 2DQTH 2XZCL 1KTRL 2IBBA 1TN8B 1MJJA 5DK0B 1AO7D 5JW4M 2YC1A 4NPYB 2BJML 3C2AH 3GBNH 4Q74A 2PO6A 3ULVD 4G6FD 4MSWA 3MGOA 1XF5B 2BNQA 3IDIA 1BVKB 3KG5A 1EXUA 3BEWA 4NRXA 4YHKL 1KBGL 5IKCB 3ZT6A 1U8JA 4Z78A 3FT2B 4QHMB 2B2XH 3DECA 3TN0A 4XXCA 3SOBH 4HPYH 2AABH 4PJEF 2P1YA 4Y4KB 4M8QA 3MBXH 3ZL4H 2UZIL 5K33A 3QQ9C 5L88L 2IGFH 3KHOA 4E0RA 2Q8BL 1CZ8L 4X7SL 4ODVH 3HE6B 2Y06H 3O0RL 1U8PB 1OF2B 3CVIH 4F9PC 1JHLL 3HFMH 4HGWA 4I0PA 1YEGL 3C6LA 5E0QA 2XTLA 3IAGC 1B3JA 2EYSB 3IXTB 5DI8A 3F5WB 5IROA 1R5WA 5D9SA 4EJ1C 3MRNA 5CGYD 1T03L 1D5IL 1IGFL 4K7FA 2A9NL 5GISL 2X05A 4NRZA 5ESVA 1XIWA 1AP2B 1YC7A 5F89A 1BBDL 2EDQA 5I16A 3NVQA 4G80B 3BGMB 4X80H 1KULA 4Q9CA 2GJ6E 2EC9U 5GIRA 1F42A 3WJLA 4CDHA 5GZOC 2XRAH 3JBG7 2YRZA 3DARA 1YUHB 3GI9L 3ROLA 1X5YA 5CINH 4JM2A 4JHZA 5E9DE 5LGHL 5DJAB 2BSTA 3UTPD 3TO4B 4MQ7A 2ZCKL 3N85H 5F70A 1OW0C 2DD8L 2VDKH 2XWTB 3QQ4B 3T04D 3STZB 1LEIA 1JFQL 4K23H 5HI4D 1QEWA 3OPZH 4PJFE 5JDSA 5HBBA 5CILL 2LVCA 1PKQB 4A6YB 2EO9A 4GS7C 3O4OB 1KEMH 1YEDB 1S9KC 3GSUA 5EO9B 1H39A 5AUMB 5I8EA 3WFEH 2YUZA 4XP9H 4PGJA 1CD9B 4J7RA 1S5HB 4Z7OE 1EJ6A 3QWRD 5HYJB 2VLKE 4LHJB 1DLHA 1T22B 5F96L 4S11A 4WI6A 2F8XC 3BISA 1QNZH 3G08A 4KDVA 2N4IA 4R2GB 1FJ1B 2QKIB 2WWMD 1RZGA 4PJ7E 4JB9H 2D7TH 5IFAH 1WAAA 4NO2A 5FOBA 1CCZA 1O6RA 1NFDB 3FFCB 1SMAA 4Q9QH 2BVYA 1A9BA 4ESKA 5AYUH 1U0QA 3RWJB 1SJHB 1KCVH 1S9XB 4WTWA 3SE3C 3GJFH 1Z9OA 4I5BA 5J13C 4YAQA 1KPVA 5B38A 4DGVH 4M1CD 1FGVH 3MYZA 5D2NE 3WNPA 5EZLA 5BMFH 5C1MB 4Y5YC 3VFOA 4XHJD 1TZGH 2J1KA 4YBLB 5MENA 2C4FT 2VR4A 1D3CA 3RDTC 2R2LB 5E6ZA 3RX7A 4EDWH 4KKBC 1MVFA 4OLWL 4Y4FD 3I6LE 3T0EE 2GEEA 1DJSA 1EEYA 1NC4D 1U95A 1ZWIA 5FYLL 2ADJA 3TWCL 3UZQA 4KAQH 4EUPG 4U1LA 1F5WA 1HZFA 2IEJB 2X44D 1VSCA 3LKRB 4OLEA 1V5JA 3DGGB 5D1ZC 3EYUH 2ESVB 1A2YB 4Q7DA 3VRIB 1ZLVH 5DD0L 1JCRB 5DMGD 1WITA 5EC1A 5C07D 3QUYB 4WU5A 3DSUB 1YDPB 1AGCB 2XTJC 1KIRA 4MAYC 4GAJH 4XWOC 1BJ1J 4Y5XB 3EO0A 1T89C 2PW2B 5BQ7B 4AG4H 3CVHB 3V5DB 1HZHH 5DVMA 2BVQA 1QSVA 3SJVA 3V5HA 3EO9L 1P7QA 5E2WL 2ENSA 5FAAA 1NCTA 2FIKA 2Z93B 1WEJH 3UAJD 3RWGB 3OKEA 4G42B 4IOIA 5J0BA 2CKBH 2JB6B 3S88L 1W0YT 4U1IA 2P8PA 4J4PA 4XP4L 3W39A 4QLRA 4XWGL 2J88L 4NQDB 5HHXH 2BSED 5J3HD 2GJZB 3NZHL 4RGOH 4D0DB 2AXGB 4V2BA 3CFEB 4GH7B 1T0MB 1G7PB 3RY4A 5L8KB 1Z2KA 4HWEH 3D85A 4EN3A 4OFKA 3L5HA 2R1YB 1I9RH 2CDGB 4PJGB 1NUNB 1U58A 4H25B 1CL7L 1JYWA 3FN9A 5IMMA 3C60B 4LEOB 5F7UA 3NACL 1QFUH 3WMSA 2XXMB 1J8HD 5E24E 4R4BA 4PLNC 3KPRA 5GGRB 3EYQD 4DFHA 1E4KA 2ZKHL 3TV3L 3BPLC 2Y5TA 1XAUA 4DKEL 3B5GA 2FR4A 4YC2C 4WFHE 3MNVB 2BY0A 3AM8C 3I50L 5MEPB 3WYRA 3MZGB 5C0BA 1DLFH 1DFBH 4S1RL 1QRNE 1ZVSB 3TBVB 5HHOE 1M7IB 2CO6B 4ODUB 2JJTC 1A3LL 2A83A 3OV6A 4WU7B 2WNGA 5INCA 1JNLL 4KTEH 1S7RA 3BD3A 1WGOA 3KGRA 3VFGH 5E6IB 2HJLA 3MLXL 4K71B 2VABA 4ZAKC 4JPWH 1QFPA 1CTOA 5E7BA 3BP5A 2B1HL 3BN9C 5J11B 1TVDA 5MEQA 2MHAB 3TIEA 3ES6B 2C3GA 3QXAA 4ZSOA 1RULL 3VFSA 5EBWA 3BIKB 1U8KA 4L8DB 3BSZL 4G6KL 4KQ3H 4AZ8A 1YYLH 4PREB 1FL3A 1UVQB 5I1GL 3MYJB 1Q9WB 5TF0A 2WLYA 4B41A 4GRLD 3FB7B 5HDBE 5KVFL 2BNRE 5ADPL 4P23B 4K94C 1IC4H 4TQEH 1U8MA 1F3JB 4RFNC 4YR6A 4JRYB 4D8PA 4K94H 4WI7A 1G0DA 3GSWA 4K9EH 2DM3A 5TE6L 2XZAH 1HYSC 1UKQA 4MXQD 4GAYB 2O61B 4WWKC 3GI8H 3U4EB 5DFVD 3SE4C 4K55A 4JQXA 2XWJA 4PRAA 3P73B 4HUUB 1MHHB 3WXWL 1R5VB 3UTZB 3MV8A 1A6PA 3MMEA 2H32A 3I3BA 1OP3H 4LCCC 5T1LB 5FA3B 2VL5A 1JK8B 1YQVH 35C8L 1CT8A 1SQ2N 3FB8A 1IILE 1RK1B 4KK9D 1QZ1A 1FH5L 3IFLH 4X4XA 3FJTA 3T3PF 5IVNA 3FQWA 2EDJA 3WLBB 1FBIL 3D25B 1CGVA 2FGWH 3PHQB 2NY6D 3BUYA 4GRMA 4OF8A 1BD2E 3RRQA 1QR4A 1H5BA 1OVZA 5ACMA 3VA6A 3WSQH 4JLRB 4FP8L 5E8DH 2JJSA 3L3GB 1NGQL 5C0ND 1JWMA 1UM5L 1VEMA 1T66C 1X3DA 3D18B 2NY1B 1P4IL 3LRSA 3OAYH 1BOGA 3VXUD 4XZUB 4JY4B 2CMRL 5FECA 4WNQB 5J57B 3WFHB 3HXCB 1JUFA 3PL6C 4FXLA 4TVPE 3RWIA 4MJ5A 4HFWA 2NXYB 1ZHLA 4J3SA 4LCWA 5IVXF 4CRPA 1L6ZA 4YXHH 4IBLT 1HDMA 3HPLA 4IRZH 3OR7B 2H26A 5GJSH 5ADOH 5FF6A 4H0IA 4WO4B 4DAGH 1KLUA 3LKQB 3SPVA 2Q76A 1EFQA 2KDGA 2L7UA 1FPPB 2Y36H 5CHNA 4ZPVA 5KTEL 4OM0L 2GIYA 2YMXH 1FNGB 2YK1H 2JJVA 4DOHB 4I2XB 1X5HA 4JANA 3SY0A 2FBJH 1F00I 3QPQC 1NGZB 3RL1B 5DD1H 5M7QA 3R8BB 3H9ZA 1IGIH 4PJAE 2K9UA 1JYXA 4I9WE 5JOPE 4YUEL 1FFPA 4P2OB 5DMIL 5BS0A 4GTTB 1OSZA 4NJ9H 5BRZB 3IJHB 2Q8AH 2BVPB 2A74B 4O5LL 3HZMB 4NO0D 4BFIB 3WIHA 4KRPC 1DQQB 1IJ9A 2BVUA 5FHAH 1J9CT 1TIUA 2I25N 1A7QL 4DKDC 1GGCH 1WV7T 1MJJB 5IHZA 3U4AA 3NA4A 4M02A 5EU6D 3L6FB 2HAZA 3AXLA 2YC1B 3VD9A 2M2DA 4GOSA 5EA0L 1ZA6A 4U7MA 3GKWH 3D69A 2PO6B 4CNIB 5IVXA 4EBQL 1D8EB 3HMXH 4JHAL 3HMWL 4MSWB 4WTZG 3MGOB 5BVPH 3IDIB 3LY6A 4LAQL 3BEWB 4K2UH 2CLRB 1UKSA 2GAZB 4X0KB 1AD9A 4WFFE 3ZSSA 3D9AH 4OZGE 1U8JB 4Z78B 4F7EB 3HI6H 3DURB 3TZVD 1DE4B 2GKIA 3OX8A 4Z7NF 4GMSH 3P0VL 3BH8A 2NR6C 2YRPA 3K2UL 4HCRH 1OWWA 4X6FB 1BZ7A 3BE1H 4E0RB 3HZVA 1FYTD 1P4BL 3QG6A 4TYUA 3VDCA 2LTQB 1KB5A 2D9QB 3HXDB 1Z3GH 2PNDA 5HHVL 1WSST 3WLWC 2IPKA 3WFBL 2FX9L 1S3KH 1YEEL 2PR4H 2RB8A 4P0DA 4ZODA 2FATH 2PXYA 1Q9OA 3C6LB 3W0WA 3QHFL 1AXSA 5DI8B 3AAZA 4NO5B 4JDZA 1AI1L 1R5WB 1U91A 5F7EH 2BNQD 3MRNB 1OAUL 1FZJA 4ZTOH 4K7FB 3CXDL 5IHUL 1RK0B 5ESVB 3DJ9A 1QBBA 3QI9D 1XIWB 4FQIL 3PWPE 5F89B 2ZCLL 1OD9A 1JZ4A 3ZDXF 3TN0D 2D4DA 5CKGA 4HWNA 1K4CB 5SWZD 3VXRE 2F9BT 2VLME 5LAXA 4LQFL 3M07A 1EGJH 5GIRB 5I1KL 2A1WL 1OTUC 4DK6A 4JFDA 1J7VR 2D7MA 3IJYB 2C3XA 1TZHB 1KC5L 5DHVH 3S5LA 5DR5L 1JWUA 1TVHB 1P69B 4CJ0A 1OPGL 3ILPA 2RFXB 3MGAA 1DQMH 2BSTB 4MQ7B 3NA9L 3L7FA 3TT3L 3U7WH 5T33L 4PJEB 4X7EC 2VZOA 4I0PD 3BKML 1I3VA 1LEIB 3K4ZA 4XGZA 4LIQL 1QEWB 1TETH 3CD4A 4NNYA 1N8ZA 1MRCL 3S96A 1KJ2L 3WDJA 3GGWA 2ZZUT 2UWEE 1RZKH 3GSUB 1BQLL 5I8EB 2HYMA 1QO3A 1GXEA 1G7IA 2BERA 2P7TA 4NQCE 5CZVH 5C86A 2XY2A 4Y1AA 2EDXA 4Z7WE 4KQ4H 2OL3A 3S35L 1YMHA 1WWWX 1RZGB 4GRWF 4YHPB 1WWCA 4JGUA 3VFTB 1EJOL 3GMRB 4JM2D 5GS1A 1I9EA 4NCC2 2A9MH 4NQEA 3EYSL 3WIHL 4RQQA 1A9BB 3JV0A 4X5XB 4YFLI 5J9PA 3S3JA 1J0HA 4RMTA 1KG0A 1JPSH 3CC5A 2R4RL 3MC0A 2ATKA 4QGTA 5JIPA 1RSFA 5JW4Q 4YAQB 1KPVB 1RURL 5B38B 1JWSA 1I1FB 2O5XH 4LVOB 2OTWA 4HLJA 1RY7B 2GUOA 2G0DA 5EZLB 3ULVH 4XHQA 1NBQA 2IMNA 1T3FA 4PD4J 4MLSA 2VQ1A 4X7CC 3EW3B 5DJXB 5FYJD 1MH5A 4UZGA 5ITFA 1IC7L 1OGAD 3DV6B 3T2NL 5C0CA 1A47A 1VERA 4OGYL 1EEYB 3RVTD 1MCHA 1UYWL 4N1CA 1BPVA 4D4BA 3IDJB 2LE9A 1OM3L 2XKNB 1OAYH 1KB5L 1A22B 2NY4B 3P30H 4LBEB 5EC1B 3I02B 4WU5B 4QRPE 4D9LH 1KIRB 3OJDA 1V3MA 2DYPB 5D8JH 4MXWL 2YSSB 5CGYC 3EO0B 1H9VA 3IAPA 3QEQE 4LHUA 5CUSL 4MD4B 2E8YA 3FQTA 1Y6MR 2H45A 2YPKA 4JQIH 3ZTNL 4BOJA 3V5HB 3VU2A 5MEND 5KS9F 2HJFA 2I5YH 1RJLA 3SKJL 1WLHA 3P0YL 2AEQH 4U0RB 5JHLH 1CGWA 1O0VA 5MEOB 5DWUH 3HRZB 1MCRA 3O8XA 3OKEB 4IOIB 5C0AA 3V4UH 2O5ZH 4U1IB 1HH9B 4I13B 4N0UB 4ZOAA 4PLOB 3SE8H 3W39B 3PWNB 5FK9B 4P5TD 4XTRD 4YDIH 4KKNA 2EIDA 3ARFA 5HI4C 4RMUA 4Y4HA 5EO0A 3QUXA 4KY1H 1UB5B 2QQNH 5TDOA 3D0VA 5CEXA 2NQCA 3D85B 3G6DL 4EN3B 4PRPA 4AH2B 3QNYA 4FQXB 1X6LA 5KVDL 4IIQA 3SJVD 2ZNXA 2YPVL 1P7QD 5JDJA 5HGBB 5GGSY 3LOWA 3BOVA 2H6PA 1MRDL 4OBRA 1YN6B 4BK4A 1ZOXA 2FJGB 15C8L 1FG2A 2NY3B 4H88H 3SGDI 1WK0A 2DM7A 5DRZA 1NGXA 1RUQL 5HY9A 1NBZA 3TO4C 2Y5TB 3LQAH 2FH8A 5L7XL 4M7LH 1A6AB 3GIZH 3CXHK 3MRJB 4X6CF 4K3GA 4R0LC 1K6QH 3P77B 4P9ML 4QEGA 3AS2A 3O4OC 2D03H 1QP1A 4KI1A 4KTDL 3CSBA 5AZEH 4B0MM 1UH2A 2DBLH 3O4LE 4PJXF 4FQ2H 3ULUL 4C56E 2AGJL 4XCYA 1MEXH 3VG0L 4OUOA 5EWIH 1BM3H 1OAQH 4R2GC 1OAKH 4ZDHB 3QXAB 3KPRD 3VFSB 5CP7A 1FL5A 4LP5A 1U8KB 1VFOA 5IW6B 1CIUA 3RIFF 1V7NH 2PYEA 4W6XB 4AQ1B 1FL3B 1KGCD 4HKJA 4NKIL 5EU7E 3AS1A 3WIIL 5L6YH 3WDIA 4ENED 4PLKC 2F8OA 1I1YB 2P44B 1KCSH 4XCEA 5C0BD 4M7JH 5I71B 3QIUD 3DXAA 2EZ0C 1IGJA 4YBLC 1IGCH 3QO1A 4ZUTA 4LSQL 4OT1L 2HJKA 1GYAA 2XWJB 3KPQA 3PWVB 2VXSL 1XEDA 4HK3J 3UAJC 3TJEL 3MRHB 3MMEB 2H32B 2YN3A 4P49A 4AEFA 1IGML 2VL5B 5L8JB 5HVHC 4PJXA 2I07A 1HHHA 4JREB 3GHEH 4X9HA 1QSEE 1DBKH 4POZD 4X4XB 1X5ZA 4ZTPH 3QUYC 2X1QA 1AY1H 4WFED 2VR9A 4BZ1H 1GH7A 1YNLH 4URTB 4Y5XC 4NBZB 4V1DA 1JGDA 4V2CB 3BUYB 4GRMB 5E2TL 3P9MA 3QUML 1RI8A 1S9VA 1H3AA 2PCPA 1FT2B 4P5KA 4GAGL 2R69H 1YPZE 1JWMB 3TEUA 4QYOA 1WZ1H 5EN2B 3FOMA 1I85A 4G8GB 1QQDA 2I27N 2R15A 1BOGB 5DD3H 5HJ3A 4OZIE 2AV1B 1AFVH 3MV8D 5FECB 5I1DA 2EXYD 2OMNA 3PWLA 3RWIB 1CR9L 5D6CB 4LCWB 5GRXG 3I3DA 4HS6A 5K9QG 4RAHA 4HWUA 2MKWA 3NCMA 5FF6B 3I75A 2Q76B 1HSBA 2QADD 4ZPVB 5CHNB 4H1LG 1UA6L 2ZOKB 1UT9A 1KJ2B 1JTTA 1P4LA 4JANB 5CEZE 3SY0B 3MPCA 1BIIA 5IW1A 3FO0H 3BYYA 4LLMA 3C60C 2J4WL 3BQUD 1S7WB 1UQSA 1T83A 3CSYA 4GSDH 3OAZK 4NIKB 3L3IA 2VIRA 1H8SA 3MREA 5D70L 4Z7UE 1AJ7H 4HS3A 4TRPL 5DJ2B 2BBCA 2DWEB 2Z92B 4OFIA 1FFPB 2ARWA 5BS0B 3LQZA 1CG9A 1IFHH 5BXFB 1OSZB 1RIVH 4HV8A 1GZQA 4AENA 4UQ2A 5IB5B 1GGBL 3HNVL 4OIBA 1DBAH 2R56H 5HI5C 5IHZB 1JCQB 1CXHA 4OLZH 3DVNB 3AXLB 1JGLH 4KWUA 2QSQA 1FLRH 1ZA6B 3D69B 5IVXB 1KCUL 3GMLA 1ETZA 4MXQC 5DS8A 4NWUL 3BDYL 3W11D 4K7PL 3FT3A 1F4AA 1AD9B 5J11C 4FMKA 3DO7A 1U8HA 3V6OC 4EUPA 4E9LA 3A6BH 4H20L 1E6JH 4G43A 4DVRL 4PGCA 4ODTL 3OX8B 3BH8B 4WEBH 5KSBE 1HHJB 2R0WL 1S7XB 2ZUTA 4LMQE 1NSNL 1EHXA 4MXVE 4DQOL 1MFDL 3QHZL 5DEFB 3HZVB 4NZJA 3MLYL 3QG6B 4JKMA 5IQ7H 2DDQL 1TJGL 4YE4H 4P23C 3UJJH 3NH7H 2IPKB 5ALCL 4HK0A 2XPGB 1EDQA 2NY6C 3VFUB 4NP4L 4KK5C 5F9JA 2PXYB 3IS1X 1AXSB 3AAZB 1A1NB 4JDZB 1G9NL 4YO0A 1U91B 2V2XA 3H2WA 1FZJB 2B1AH 3EHBC 1FVEA 5IMOB 4UT9L 5ITBH 1TCRA 4MDJA 3VFVA 4QTHA 3QG7L 4EI5B 2VDML 3UZVB 3OWEA 4N1EA 3QR2A 4BSVB 25C8H 1BIHA 1L7TH 5E8PB 4JFDB 3TPUA 3PG2A 3S5LB 3EDKA 1OL0A 3K74B 1JWUB 2DBJA 1IM9A 4JFFA 4GXVH 1MIML 3QIWA 4MD5A 5A2FA 2UVFA 1JHLH 2WBJB 3W0WD 4XGZB 5TH2A 4NNYB 4KK8D 5JXEA 3CNKA 1ZLWH 5LJYH 1KJ3L 4I4WA 2ITCA 5HPMB 1IQDA 3TYGH 2NY1C 2VUYA 2ADFL 4LPWA 2EDRA 5EZOL 4FRWA 5FCSH 1VFUA 3KJ4B 1MCSA 1BBDH 2P7TB 3HUJF 4S10A 1KZPB 1BX2B 4ZFGL 4FFVC 1EHLH 3D39E 3T08A 3BWUC 4LPYA 4K3EH 1S7VA 2W9DH 1UACL 1BEYH 1NLBH 1CDBA 2P5WE 2FB4H 2RHEA 3WFCH 5GS1B 5JIKA 2J5LB 3IXAA 3CFBA 1AO7E 1EV2E 5F97E 4NQEB 4RQQB 1YNTA 4ODXA 2E8ZA 5AWNL 3TYFB 5J9PB 5GS0H 3BP4A 4R97B 1MFCH 5BVJA 4X9FA 3IAQA 3MRRB 3CC5B 3INUL 5I30H 1IAKB 1U3HD 4I48A 5CJQH 1NCDL 3LS4L 4QHLA 1KXQE 5DQDH 1JWSB 4S0TD 1G6RA 3KYNA 1UXWA 4I77L 5IHLB 4QWWD 2GUOB 4S1QL 3RWEA 3O2WH 1T3FB 1VFBA 5IB4A 1K8DA 1LGVA 4HJGA 4LVNB 2IFGA 1M6OA 2CLVA 2VQ1B 4Y1AD 4P2OC 5I1IL 5JHDA 5D1XD 3NFPA 2R2HB 4CMMA 1KELL 4HX1B 5SX4I 4IMKA 1FVCA 1KF9B 3QFJA 4D9QD 2IQAA 5IBUB 2EE9A 1S7SB 5L9DL 1I3GH 4FZ8H 2AJYL 4G9FD 1EERB 2MCPH 3ZHLA 3MODH 1CBVH 1C5BL 1I8KB 2XA8L 2Y07L 5CGTA 2XG5A 2PO6C 2OR9L 1ROWA 4OF6A 4LHUB 3F58H 1ZGLP 1K5NA 1X5JA 3ULUD 4GW4A 1G7LA 4U1NA 2XXCB 3TN0C 4XXCC 4OD3L 4LP4A 4BUGA 1W6JA 1JF1B 1W0WA 2HJFB 3T1WA 3MRKB 5JLZB 5C7XL 5ACZB 1OT1A 5EC2B 2CXGA 1GIGL 5C0CD 5MP6L 4JZNA 2LTQC 4GXUM 3T09A 5C0AB 4AYFA 3FL7A 5A40E 1VDGA 1JCKA 3L1OH 2DI8A 2ZUUA 4B7LA 1S7TA 3JWOL 4I0PC 2HMID 4OZHA 1RUAH 3C6LC 5B22A 3ZKMD 4MA7H 1RZJH 5EO0B 32C2B 3QUXB 1PG7W 3RIFK 4CW1A 2J8HA 3C08H 5GSVB 1AGBA 5IROC 4QKXB 4NM8H 5DA4A 2VKXA 3QUMB 2XN9A 5DMJB 3NPZB 3C8HA 2OJZL 3NIGF 5CEXB 3NTCH 3IT8D 4BZ2H 2E7CA 1XIWC 3KPPB 4JG0H 5K9OA 1UM4H 1OCWH 4IIQB 5HGHA 3CIQA 3N9GL 1RZFH 5CSGA 1CGSH 1AE6L 1U3ZA 2O93L 1N3NA 1YQ2A 2EDDA 3KLHD 3WJLC 4ELMF 3NAAL 1ZGLA 1C16A 3MBEB 3O8XD 5KG9B 1FG2B 4ZO8A 3ZHKA 5DRZB 2HT2D 1NGXB 2NY7H 4PY8I 4JM2C 1QFOA 1EMTH 3G6JF 5HY9B 3GSNH 5I19L 4HUVA 1SY6L 1IGYA 4LSTL 5KS9B 2V17L 3ARFD 3V7MA 4Y4HD 3CFDA 5FYKL 1KN2H 5SV4A 3KS0J 3QCUL 3CPLA 3MV9A 2DKSA 2NXZB 3TT1H 4PRPD 1Q0YL 2B20A 1A7NH 4YFEA 4PRHE 3FQXA 3KPLA 4R7NB 1NLDL 2OLDA 1S9YB 1UCTA 1GXNA 4XBEL 4FZEL 1LO4H 3WO4B 1WFUA 3ZE2F 4ZOEA 3V52L 3MLUH 4HKBA 5FYJH 4LEXH 4MNQD 5CP7B 1FL5B 3X3FL 3CGTA 3HC0A 2ZKHH 3VXSB 3FHQA 5C07E 2PYEB 1XH3A 1VCAA 3HTLX 1QLEL 4G3YH 5DRWA 1A6VL 3BP6B 3BESR 4ZOCA 4WTZA 1CVSC 4XCEB 1IKFL 4ZQKA 1FC1A 3C5ZB 2EDYA 3ZZ1A 3U2SB 4LVOC 3DXAB 1JVKA 1A3LH 3Q2CA 4LGPB 4TPRH 2E7HA 4PJFF 4XPFL 1JNLH 4X6CB 2GSGA 5C71A 4F9LA 4PBVC 4ZUTB 4FFZH 3LEVH 4OLVH 1TMCB 2YZ1A 4ZUUA 5FO7A 4NM4H 3GMOB 3KPQB 2VNCA 1R24A 2HG5A 4Q9RH 3U79A 4POUB 2MPAH 2ZWLT 1K9TA 4M03A 1HYRC 2DICA 5ID0A 1IT9L 2IAMD 3SDYH 1O7SA 2Q7NA 1T2XA 1AHWA 3MJGX 4PJXB 2I07B 5DUMH 1QPPA 1MPAH 4GG8B 5IEHA 4XTRC 1V3LA 4BH8B 5GGRY 4N9OB 1N5AA 3PZ4B 1JZ8A 5DUPH 2EYTB 3UJIL 2N1KA 3Q1SL 1DUYA 3OAUL 4YWGL 4F15B 2GJ6A 3P9MB 4AIXA 4U1SA 4LPXA 3DX7A 4ALAL 3CDGB 3SE9L 2P8MA 5LXGH 1MJ8L 4TSCL 2PW1B 3FOMB 3CLFH 2W0KA 1J8HE 3LZFH 5E9DA 2E9JA 2QR0B 3QT2A 3GMPA 4GG6F 2NX5E 5I1DB 4HIHA 2YXMA 1W0VB 3PWLB 3MNWA 1MFBH 4QOKD 3NIDF 4J4PC 5I1LA 4PJFA 3SQBA 4XAWH 1GGYA 5FFLA 4HS6B 1CL7I 1FO0A 5IB2A 3KWWA 1MCIA 5EIIA 4CDGC 2FBOJ 3I75B 4V1DD 4U6TA 4P46B 1N2RB 2ZUSA 3CDYA 5ALBL 4EN3C 3QNZA 5HHMB 5I1CL 4PRID 3PGFL 1FYHB 3RUGE 4F37F 4Z7QE 3GDBA 5IW3A 5IW1B 4HD9A 5KVMC 3KLDA 1GZPB 1JV5B 1MJ7L 2W9EH 4NZUL 2BY3A 1ODAA 4ODWA 4KKAD 4JO4H 2X7LA 5F6HI 4XT1C 1ITCA 1MCFA 2NY3C 3MJ8B 2ZCHL 1E28A 1T0NA 3RQ3A 1E4KC 3FN0L 1W8OA 2GOXA 4WDIB 5I74C 3LQZB 1CG9B 3UYRL 5F1OB 2W65B 4ONFH 2CK0H 2HLAA 4HV8B 1GZQB 4NKQB 3MO1A 5JORA 3LKPB 4AENB 3LKOB 1D9KD 3L3DA 5D2NA 1MIEH 5FUCE 4L8BB 5MI0B 3U4BL 2CPCA 2VDRL 4XNYH 1CGUA 5C0IB 4YDKL 4MDIA 4OM0H 5H37G 1U92A 5CMAB 4XB7A 4HAGA 3T0EA 3GMLB 1ETZB 5DS8B 5F3HA 1ZE3C 4PJCE 4UI2A 3HR6A 3L5XH 3FT3B 1NAKL 2D7QA 3Q6FA 2C9AA 2DQEL 5E2UH 3NFNB 2FH6A 3DMMA 4KKLC 2HKFH 4APQA 4EUPB 4LQ1A 4UT6L 4G43B 2H8PA 1YY9D 4PGCB 5GRUL 2XZZA 1F4XH 5FCUL 4OGXH 4UBDD 2LAAA 4LNBB 4HMEA 4P2QE 1G1YA 4POZC 1FZMA 4PV9A 2NZ9C 2DKUA 1ZT1A 3DVGA 2YPLB 4HK0B 3OSKA 1CDIA 2XACC 4L4TD 2R0KL 5I71C 3B9KD 3OKLA 4OF7A 1IARB 4YK4B 1MQKH 3S34L 2CDFB 4YO0B 2V2XB 5BZWA 3RVVD 4Y2DD 4WCYH 4JQXC 2BC4A 1FL6A 4LAQH 4JKLA 5ECJE 5BO1H 2R1WB 2DI9A 4KRMB 4QTHB 2EXYC 5GZND 2E5EA 1DUZA 3QUZD 3F7VA 2P8LA 1OAZL 2C3HA 4HJ0D 4JREC 3BZEA 5B4PB 3TPUB 3CXHJ 5I6XB 3H3PH 2ZPKL 4PJDE 3O41B 2YS4A 1I3UA 3V4PL 4QRQB 1IM9B 1II4E 2J8OA 1FO0L 2VTFA 3BO8A 3RJ3A 2QADC 3K2MC 1N64H 1GXOA 2AJUL 3UTSD 1NKRA 4R26L 5EBMA 2WANA 4Y19E 1H5BC 3T0DA 1B90A 2PF6A 4KV5F 2JJSC 4QRTA 1H15B 1QBML 4I4WB 1IAIL 3E32B 3KNBA 3VXOA 3MCLH 1KENL 4BQ8A 4FQIH 1UZ8A 1T20A 1FP5A 1O79A 4BQ9A 3VDBA 1O6QA 4E5XA 5ILTH 2FD6L 3S4SG 1CGYA 1S7VB 3ZHDA 1W6KA 3HG1B 1JYVA 1QRNA 4ZRQA 5HHOA 2PTVA 3R4DA 1NMBH 4HJJL 5J1AB 2HTKD 5JNYA 3IXAB 5EU6E 4LSRH 4JR9L 4JFFD 2B39A 1YNTB 4ODXB 2X4RA 3D3VE 4L3CA 3MRLA 3QIWD 3TT3H 1F2QA 1P84K 3BP4B 1REIA 3E37B 4NO3A 1F13A 5JXED 4M4PA 4MNHB 4I48B 4ONTA 4TUKL 1HWHB 1UWGH 1LNUA 4PJ5E 5M94B 4F80A 3FZUD 4MD0A 1C12B 3KYNB 4PGBB 3O2VH 3VXTA 1UXWB 1FNAA 2RAMA 4OLYH 3RWEB 5MERA 1FRGL 1NGYA 4NQVB 1VFBB 3QP3A 4KMTH 4HJGB 4RCAA 4G5ZL 4XVSH 2CLVB 4LL9A 3CMOL 4M62L 5JHDB 5C08E 2BNRA 2AJ3A 4CMMB 4U3XA 4PJ8A 1Y6KR 2P5ED 3FOLB 4J1UA 2M8XA 4K3JL 1FVCB 4Y5VA 3FB6A 1JHKL 3UJTH 2ATPA 2IADB 1X6NA 4E41E 4XB8A 1NCWL 2APWA 3HUJB 3PP4H 3RI5F 4KMQA 2P42B 1KXVC 1XF2A 2ILLA 4MCYA 5IMLB 4LLDA 3EAKA 3VFMA 3UBXG 2X9WA 4UTAL 4JPKL 2K7QA 5LWYH 1K5NB 4GW4B 1G7LB 4N9GB 2F53B 4OV5B 1LILA 4R4FH 5SWZE 4AEIL 2VL4A 3BP7A 4XPTH 3Q5YA 5EU3A 1W0WB 2A2QT 3IDNA 4PTUA 1XF3B 5DJ8B 3QDGA 4LDEB 4DFIA 3X3GL 3V0VA 1IRAY 5D71L 3VWJA 4OD1L 4XP5L 3QFJD 1J0YA 1TQCC 1BD2A 4O58L 4G7YL 4DKAA 1VACA 2IFFL 2IAND 2ERJB 3OKMA 2PXYC 4PGDB 1RVFL 3NCJL 4FXGB 4KK8C 2IPTH 1HINH 5TQ2H 3TVMD 2VDQL 2IJ0C 4AIOA 4MXWH 3LEXB 4NOFA 4IRSD 5I18H 1RU9H 3DSXB 4DTGH 3MLWH 3UP1A 1JTPA 3B8SA 3QIBB 5T3XD 5C70A 2DQGH 1LEKA 1CF8H 1RV6X 1LO0H 4L4VE 4X5LA 1ZGLB 1C16B 4OZGF 1KCRH 3ZYJA 1KXTB 2QHRH 2VLLA 3MOBL 1DVFA 3DVIA 2A77L 4H1LA 4YXLL 2IQ9L 1IGYB 2IPUG 1DSFL 4P3AA 4J3WA 1FDLL 1FPTL 3CFDB 5INDA 3CPLB 4RDQG 4LCUA 4Q0XH 4PJAA 3JWDL 2XN9D 3V79C 4GTVB 4QTIH 4P4KB 1CFTA 5E08L 2C4FU 2VZ1A 4L3ED 1SYSB 3FQXB 3KJ4C 3U7YH 5FYJE 2A73A 4N90D 1QOKA 1WISA 2YPVH 1OGAE 3L5WA 5FHBL 5F72S 43CAA 3IU3A 5D7SL 4HKBB 1F90L 1HH6A 4WHYH 5DF0A 2OL3H 5GS1C 2Q6WA 1WZMA 5FXCH 1MAML 1LK3L 3HC0B 1VFAA 2O5YL 5F7KC 2X4TA 1IZKA 2FNBA 5DRWB 4R97C 1CFVL 2HVJA 2B4CL 5EOQH 1T21A 3SKMA 3E8UH 4NWTH 1YMME 2M1KA 4ELMB 5HDQL 1MFNA 3G5XA 1LK2A 4OZGA 2UY6A 4YDOB 4YDVA 2R0ZL 5J7CC 1L9NA 4RGNB 3ZMRA 3MV9D 4WI8A 3FB5A 3BN3B 4DJMA 3GB7A 4Z76A 1RJCA 3ULUC 1Y18A 3G6JB 2VDLL 3HI1A 2EDFA 4U2YA 4XX1E 1MUJA 3W5NA 2GSGB 4CN6A 1CFSA 2XZQH 3OB0K 3PABA 4OLUH 2X9XA 4ZUUB 5FEBA 4F37K 2CXKA 4JPVL 3EZ8A 2A6KB 4CADA 1EAJA 2RCSH 5I75C 3O3EB 1LD9A 5I76A 5J1TC 5ID0B 2Q3ZA 7FABL 4UOW0 2V2TB 1BP3B 1OLLA 1S5IL 4ZS6D 4GMTH 2FL5A 1K2DA 4QNPE 1HNGA 3PQYE 5CS7A 4LLAA 2HMIC 1KACB 4LNRA 3ZKMC 3ZYOA 4KI5D 4PRBB 4JZOB 3BXNA 3O11A 1N5AB 5C0EA 3PWPA 1U8QA 2F54E 5C0JA 4DK3A 4KKCC 2FJFA 1DUYB 3VXRA 1AGFA 4G6AD 2GJ6B 4I3GA 1I4FA 2W0FA 2H1PL 3PP3H 4U2ZA 4TVPL 3KPTA 4N5EC 3MLSH 4LSPH 3B2VH 4BZYA 3CX5K 4GTSB 3QCTH 5KAQF 4XNMA 3LCYA 2ICWB 2VDOL 5E9DB 2R29L 5KW9L 3TBYA 3K8KA 2ZOLA 3O8XC 3PDDA 3GMPB 4UINH 2VDNL 4WUKL 5F7WC 1IM3A 2QSCH 4HIHB 4DEPB 3L7EA 2HT2C 4FTVA 3MNWB 2LFGA 5FUZL 4RMRA 5I1LB 1D6EB 4PJFB 5C2BL 4YHML 1J5OL 1N0XH 1M05B 1G7QA 2P24A 2UWEA 1YNKL 3ARFC 4Y4HC 3G6AA 3EDJA 3QUXC 4KROD 2DLHA 5EIIB 1J88A 5L2KB 1I1AA 4U7SA 1CXEA 5TE4L 1OB1B 4MB3A 2WUBH 4LARH 1CGTA 3KQ4A 1LD8B 1BOYA 2WBWB 5IIEA 4Z7WA 4NOBA 4G7VL 4KK6D 5I15L 4WFGE 5FO9A 4IIQC 2DQTL 3RGVA 2DQIH 2XIDA 1QLRB 3GUTB 4L4JA 3CSGA 3GJFA 4ODWB 1BQUA 3HA0A 3MRPB 3QRGH 5EPMA 2X7LB 1O6HA 2CDEA 3GM0A 5D96C 3C2AL 3GBNL 1T2QL 2JJUA 1E28B 1T0NB 1UXSA 3MROA 1WQVT 4J3XA 1C3DA 4P2RE 5BJTB 3CK0H 3BZFA 1DCEB 1ZHBB 1IEBA 4X8XA 3GHBH 1UC6A 2VR5A 3O45B 3SCMD 1FAKT 2B2XL 1HKFA 3SOBL 5ANMA 4HPYL 2AABL 3GBMH 3L3DB 1N6QH 2BVOA 5K93A 3MBXL 2WIMA 2VLKD 2YWZA 2IGFL 1KTLB 1N4SB 2NXZC 2FX7H 5CP3H 3GNMH 4KZEH 4MDIB 1U92B 1AD0A 2NOJA 1PYWA 4ODVL 3ZE0E 3T0EB 1CQYA 5F9DC 2XA3A 1JF5A 2Y06L 5F3HB 3S37H 3T65A 2DLFH 3OKDA 3CVIL 2VJXA 4OLXH 3HFML 5EU4B 4HT1H 4FS0A 1JHTA 3DMMB 4LCIH 3EFDH 3TLRA 2EDLA 4KC3B 3V4VH 2EE6A 3P9WB 4QRPA 4LPTA 3RTQA 2JIXB 3CFKA 3DWTA 4UIMA 1GSZA 1CXKA 2Z91A 4UIKH 1SVZA 4HWJA 1FZMB 1FFOA 4WFEE 5FIEA 5CCKH 1R0AH 2QTEA 3ET9F 4PV9B 3QEQA 4U4BA 4X80L 3E0GA 1NC2D 2GY7B 1J8KA 1U8OA 3HNVH 1ZT1B 2CKBA 3LIZH 3ULSA 4XMLH 2XRAL 3FTGA 5T3ZE 4C54A 2BFVH 5CINL 4BKLA 5I2IA 4HUWA 1U36A 1HXMA 2ORBH 2H3NB 5BZWB 2ZUYA 3N85L 2GITA 1DBBH 1ZEAL 2VDKL 3H9SE 1FL6B 4XCCH 5A16A 3OPZL 4APQD 4HDIA 4J6RH 3CJJA 4FHBD 2EECA 1ED3A 5FUOH 4F33A 2P8LB 3WFEL 3BZEB 4XP9L 5T1KA 3MLYH 5K59E 5HHPA 4QXGH 1MI5E 1LDSA 5IHBA 3KR3H 3AU1A 1QNZL 3RY6A 3BO8B 1P1ZA 2YEZB 4F15C 1N95B 2C1OB 2OZ4A 3IFNH 4JB9L 2D7TL 4RMWA 4JFYA 5IFAL 3CVHH 3GSRA 4N0CD 1G7MA 5DRNA 3RI5K 4Q9QL 4KRNA 5DYOB 5E1HB 1FFNA 5J1SC 5HGAA 2RQ8A 1I85C 5AYUL 4CU7A 5D7KE 3WBDA 3WEXB 3KNBB 2EDWA 1KCVL 2V8JA 4UV4H 5CBEA 1UFUA 1YEFH 2YA2A 1UZ8B 4NZRH 2XQBH 1CFQA 2HN7A 1Z9SA 1U2HA 4DGVL 4E5XB 4WW1B 1WTGT 1FGVL 3DSSB 1IE5A 5BMFL 1U93B 1MLBA 4TTDD 1KPUB 5HHOB 1OLZA 1TZGL 3HR5A 5JNYB 1PAMA 4LLVA 4MAUH 4EDWL 1VKXA 5KVGH 2YUXA 4P46C 4U6HA 2R1XB 2X4RB 4L3CB 3MRLB 4UQ3A 3L3HA 3QJHA 2AEIT 2LQRA 3CLEH 5CSZA 4NKOA 4JKPH 4NO3B 4KAQL 1T7VA 3IDYC 4N8VB 4X6EA 3HXEB 2V5TA 1EO5A 3EYUL 1LNUB 4O9HH 2LAGB 1T83C 4MD0B 3VXTB 2YHGA 1KTDA 4FFYH 5H35B 4GAJL 4CVZA 3ZT5A 1BQHB 4ZXBA 3FMGH 2BNRB 2PYFA 4UBDC 2D2OA 4JFEB 2AJ3B 4AG4L 4DZBA 4PJ8B 1QRND 4J1UB 1HZHL 1FCGA 5F8RC 4HKXA 4O4YL 2RBLA 3KAAA 2AEPH 3CSPA 1AIFA 2ATPB 5DSCA 3A6CH 3P40A 2E7MA 1J12A 2CLZA 5MI0C 2D9CA 1WEJL 1EEQA 4NN6B 2KQNA 4EZMA 3SO5A 5AWNH 4RBPH 1MCLA 4YHOH 1MCDA 2CKBL 1XF2B 5SWSD 2F58H 3PNWA 4QRSA 3VFMB 3WV0A 2R4SH 3R0NA 5HHXL 5C0FA 5T5NG 4PJBE 4UOJA 4ETYA 5FB8B 4RGOL 5C09E 2NY0D 4S1QH 3BP7B 3CDCA 4MS8C 3IYLW 5DK2A 1QSEA 5B8CB 2C7UA 3H9YA 4JN2A 5EU3B 5GZNC 4HLZG 4I3SH 5C0DA 3HS0B 4KJWD 3IDNB 2EDKA 3HNSH 4HWEL 4JVUA 4PTUB 3QDGB 4WUUD 2CIKA 3TH4T 1UM6H 1QSFD 3KPSB 1I9RL 4UU9B 5IR1A 1K4DA 5GRYA 4HBCH 4JRXB 3FFDA 1VACB 4LGSB 3DSWB 3THMH 1YPZA 3TM6A 1QFUL 2YA1A 1B4JH 1U8NA 3OKMB 5GSRB 3ECBA 4JKKA 3VI4F 2WBKA 5E56A 4UTBH 2XA8H 4JAMA 1B2WH 4WENB 1YZZA 2OZ4L 2V3PA 4G6JL 5E5MA 1B88A 1IL1A 2EEDA 1S9WA 1BJ8A 2GCYA 5AG9A 1C5CH 2HWZH 5BV7H 1NMAH 1J87A 4V1RA 4XI5D 1ACYH 1ITBB 4YFLF 1DLFL 4OD3H 1DFBL 2ARJA 1LEKB 4YH6A 2EH7H 3EOAB 1S7UA 3TNNA 3MRFB 4KTEL 4KPHH 1GIGH 3VWJD 5ICYA 3VFGL 1YEKL 4MU9A 2VLLB 4JPWL 4OUUA 5DEZA 1BD2D 4G8IB 1JL8A 3JWOC 3QDJE 4MA8H 3RWDA 1DVFB 2CRYA 4H1LB 3QDHA 3QIWC 3G5VA 4TUOA 2NY2B 5JXEC 4DN4H 4R9HA 4Z7UA 1PY9A 4KQ3L 4LCUB 5DZOA 1YYLL 4U1GC 4PJAB 4TVPD 2E6PA 4JZJA 1TTUA 3GJFK 3HLAA 3BAEH 3UXFA 1CFTB 1QA9B 3S8WA 4HUMB 2B5IC 5DC9B 4LOUD 3HE7A 3ALXA 3OXRA 1IC4L 3TF7C 3IVKA 5DJCA 3OMZA 4YIQA 1F3DJ 3C5SB 1NCNA 4UB0H 1H3GA 4D9QE 4K94L 3G5YB 5EBLA 4OFYA 1ZTXH 4K9EL 1AKJB 1TENA 2XZAL 4HUNB 4G9FE 3MFFA 2Q6WB 2AJXH 4NDMA 1TJHH 3GI8L 4BQBA 4JEGB 1YJDL 3RPIA 2X4TB 5KSAA 1FZKB 1UZ6E 1T1YB 5IVZA 2X4NA 2HVJB 2H2SD 3E6FA 3SKMB 3JWNC 4JVPA 4HCRA 3G5XB 4OZGB 1YQVL 4YDVB 1NCBH 4JRWA 1LP9F 5GRVK 1PJ9A 4XX1G 3FB5B 4LKCA 2CR3A 3GB7B 4I9WD 5JOPD 3WDHA 4Z76B 3DUSA 1Y18B 5KSBA 1QHPA 4F8QA 5LBSH 2DQDH 1G6RH 1MF2H 2FGWL 3QQ3B 1CFSB 1NLDH 1JPTH 2YR3A 5ENWA 4IMKC 1NEUA 1T1WA 3WSQL 4CADB 3FN3A 4P3DB 3K4AA 1KCLA 5DVKA 3GSXA 1LD9B 2DLGA 1UCBH 4GO6B 4RIRA 3HQBA 3U6RA 1LWRA 4MWFB 4NC2B 2FL5B 1K2DB 4NUJB 4NYLB 5E4EB 2D4FA 2DIAA 1QLEH 4LNRB 1WJ3A 4WFFD 3O11B 5DHVA 1XGRA 5C0JB 1IKFH 1WIUA 3ARGD 4C59B 2FJFB 5C9JA 2ZSWA 4ZD3H 4YXHL 4IRZL 4D94A 1OTSC 3DSFH 3SDDD 3ULVF 3RL2A 3KXFD 3NCFB 5GJSL 5ADOL 4DAGL 1VPOH 4XC1H 4ZFOA 4XNMB 2Y36L 2EXWD 5GGTA 2YMXL 5T3XH 2YK1L 3TBYB 5JA8B 4JFXB 4QF1B 4YHLH 4YFDB 4RZCB 2NLJB 4PJ9A 3L7EB 4MNGE 4FTVB 3DLQR 4PGEA 2P43B 5D4QA 1IGTB 4Y16A 5JQ6H 5I1EH 1CFNA 2VZSA 4RMVA 1S78C 1WBZB 2ERJC 4PY7B 1P84J 1XZ0A 1G7QB 2P24B 1IGIL 1SJXA 3G6AB 5I8CA 1DQLH 3PWPD 4O2EA 5EFIA 4NJ9L 3VXRD 2Q8AL 2VLMD 3STLB 3RPKA 3D39A 3U0PB 5FO9B 3QIBC 2Z35B 5FHAL 4U6YA 4WTXA 3B9EA 3RGVB 1JGVH 3S4SA 1GGCL 5F1IA 2BSRB 2P5WA 2IH1A 3GJFB 5FA4A 1AQDA 4OF5A 3MLZH 5EPMB 1AO7A 4MNQE 1B9ZA 4K7PY 5SWQA 2CDEB 2AS5M 3C72B 3GKWL 3LEYH 3MROB 3HMXL 4IOFD 3D5SA 2AJSH 2NW2A 5J13B 4EXPX 5BVPL 1JF6A 4K2UL 5I8KH 1CDHA 5I1HL 3D9AL 1SBSH 3HI6L 1X5GA 1Q1JH 5ANMB 4KJQC 4KVCH 4GMSL 4LLWB 1I1AD 5HYJE 4F8TA 1MCJA 3QAZB 5EUKA 4HCRL 4NQCD 3U36A 3WD5H 2VZVA 3BE1L 2KKQA 2AQ1A 3KLAA 1DN0A 5IK3B 1A1OA 1Z3GL 1XMWA 1PYWB 3BT2H 2BMKB 4H0HB 2X4PA 1S3KL 1QSZA 1PX3A 2PR4L 3FKUS 5D1ZB 1NFDE 3FFCE 4XPGH 1H3VA 2FATL 1H3CA 2GQHA 4MJIB 1OQOA 3VI3F 4XC3H 1JHTB 2YKLH 4OF3A 4OCXH 5D5MF 1P7KA 3HXBB 2XTJB 4MAYB 4TSBH 5D72H 5F7EL 4X98A 2WINB 5F7FA 4OCYL 3FN0H 3RTQB 4ZTOL 4KZDL 4GW5B 1FFOB 4FOMA 4WJ5A 2Y6SD 3QEQB 4RA0C 3UBXA 1EIBA 3Q48A 5CJXA 1EGJL 1U8OB 1HIMH 1ND0A 5FOJA 5FKPB 2BHYA 2ICWJ 4G6AC 2OQJA 4CMHB 1KEGH 5I2IB 4BKLB 4M7KH 1HXMB 4D0CB 1DQML 3KS0H 4F9LC 4U1KA 2GITB 3O6FD 4ZUVA 1NEZG 3U7WL 4AMKH 1SJVA 4RGMB 4ZFOL 2ESVE 3OKOA 4QOKE 1TETL 2VOTA 1ZAGA 3K1KC 4XRCA 3MRMA 2ED8A 3AS0A 1J1XH 3OAYK 2HLFD 5D7JA 4QRPD 1AHWC 1R3JA 4F33B 1RZKL 2BOBA 2Z31D 2X1PA 3P3YA 1P7HL 1TTFA 3KPNA 5T1KB 4KROC 1TCMA 3LRHA 5HHPB 3QWRA 4D0BB 4NT6A 4J2XA 4HFUH 4KQ4L 3V7AE 2E6JA 3PDGA 4PRIE 3M45A 3DETC 3IKCA 3CFCH 4GKNA 5I1AA 4E42A 5DLMH 2EDHA 1HI6A 2A9ML 3C8DA 3R0MA 1FFNB 5HGAB 3SKOA 5B3JE 4OI8A 1JPSL 4NQDE 4ERSH 5CBEB 3GSOB 3T2QA 1BVZA 3EGSA 5IB1A 2JTDA 3ARVA 3T0AA 4BYHA 3FQRB 2P49B 5F1NA 4WI5A 2O5XL 3TIDA 3BH9A 3ULVL 1JZ3A 2ZPKH 4PV8A 4R4NC 1JZ6A 4ZAKB 4PRHA 2KL6A 3T2PA 2FEDD 3AMLA 4U6HB 2O26U 3L3HB 3Q3GA 4Y4FA 2VXQH 5DEGA 3DROB 5CSZB 5DHYA 4NKOB 4F57H 5TFSH 2DTMH 4XCFH 4PR5A 4UAOC 5D6DA 5LG1A 4KFZC 1OAYL 2N7AA 3W2DH 3P30L 3RX8A 1I7RA 1I8LA 4D9LL 5C07A 1W72H 1CICD 1SEBB 4CVZB 2VAJA 4ZXBB 5D8JL 3MRCB 3RAJH 3WIFA 2FDBP 2HT3D 3G9AB 3VXMB 3H3BC 3VGGA 3M8OL 1Z9LA 1CE6B 4LLYB 4QHNA 5T1MA 4DZBB 1H0DA 3WS6A 3C9NB 4MJ6A 3SDXF 4JQIL 4PP2A 3BDBA 4HKXB 1JNHB 2JB5H 4L4TE 5D2NC 3O4LD 2I5YL 1AIFB 5DSCB 5ISZB 3WNMA 4BFGA 1QPXA 2AEQL 2R2CA 5JHLL 5MHSD 2GSIA 4C56D 5DWUL 4MQTB 1FLTX 3K3QA 5J12C 2D7OA 2O5ZL 2VE6B 1ORSA 3S37X 4N68A 3T0EC 3SE8L 2MJWA 3CX5J 4YDIL 4AIZB 2V5YA 4PJGF 4EIGB 1T5XA 1ZHKA 3DMMC 1NMCC 4KY1L 4APQC 2QQNL 3DUUB 4UMGA 5DK2B 4JN2B 4LLQA 4L1DA 5C0DB 1O1RB 4MMXC 4JO3H 3VFRA 4MVBD 2KBGA 4UT7H 5IR1B 1K4DB 3ARTA 2L7JA 3UTSE 2EEBA 3JV6B 3PZ1B 1H8OA 2FZ3B 3SN6N 1U8NB 4H88L 5FM5M 3ECBB 4Z9KB 1J8HA 2CKNA 4N0CC 4FG6D 3PL6B 1NUGA 3IB4A 3FAXA 3DRQA 4HWZB 3FHAA 3LQAL 1IL1B 2WW8A 4M7LL 1S9WB 2ARJQ 3GIZL 3MA7A 2Y7QA 3MXWH 4HGMA 4UTAH 5KOMC 4U7KA 1BZ9A 3GEWB 1K6QL 3V2AR 3OJMB 1QSED 5DD6A 2D03L 1NPUA 2Z8RA 5AZEL 3VFNA 2DBLL 2HTLD 3TNNB 4BM7A 4TTDC 4FQLH 5A2IH 4OUUB 3RIAF 4NNXA 1GC1L 1MEXL 3RUGA 4X9IA 3RWDB 4YX2H 5HVFB 5EWIL 1BFSA 1BM3L 5J6HA 1C08A 1OAKL 3G5VB 4XMKH 2YD2A 4P59H 4WIQA 2V7HA 2DWDA 2DQFA 2OR8A 1B0GB 5DDHA 4CVUA 3B3IA 1RVFH 1QLFA 2YD6A 3PIQA 1V7NL 4YGVA 4NHCH 4WHYG 3B43A 4JZJB 4Z18A 4U3HA 5L6YL 4C1SA 3AUVA 3V6ZB 4GRLA 1KCSL 1NANH 3IVKB 4J3OC 3RVUD 1NJ9A 2QLVB 3SHSA 4W81A 3VWKD 4OM1H 4M7JL 3W5MA 2VAAA 4LPVA 1WF5A 3DNKA 4OFPA 3H42H 5EBLB 2VMFA 3TFKD 1WBYA 1IGCL 4DOHE 3MFFB 4I2XE 4R7DA 4RMSA 3TJHD 3RPIB 3SDCD 5CEZD 1TJIL 1MCPH 3ARRA 3E30B 4IS6A 3P4NA 4O02H 3Q5OA 4MQXC 3JWDC 5HD8D 5TDPA 3B2UC 4BH7A 4LKCB 2VLJD 1DBKL 4LSUH 5DURD 3D2UD 4ZTPL 5D7IE 1AY1L 2DOCA 2ENYA 1JRHH 2VLRD 1K8IB 3TP4A 4BZ1L</