5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
2PYEE 3Q73B 3O11A 3O81A 3FT3A 4PJ7A 3Q79B 2NMSA 4JY5L 4HKJA 3NZHL 3OG6B 5B4MC 1R6VA 1P7KA 4O2CB 2N56A 3V4VL 5I1DB 4QOKA 5IJKC 4OLZL 5L9DL 3AXLB 5HVHB 3UO1H 1S7RB 2FECI 4LCUB 4CMMB 3O4LB 1UB5B 3GSXA 3DURB 3HXCB 2BOBA 5CSZA 4I3SL 1EHAA 3WIIL 2HFGL 3L3KB 1E4KC 3JV4B 4PJDB 4JFOA 2A2QT 3QT2A 4KKAD 4NBXB 5ACZB 1MZCB 1MFCL 3H42L 3WV0A 1AR1C 3WDJA 2APTA 1BF8A 3QJHB 2ZCLH 3VA2C 5C6PB 3TA3D 1N59A 1S8DA 4I18A 4NQXB 1WIPA 1MRCL 1QNZH 4P3WA 2DLGA 5T1DH 5TDPA 3UJTH 2Z4QA 4NC1C 5H2BA 2MFNA 4PJCA 1IKNA 5D2NB 1MCOH 3N9GL 2R4SH 2L4OA 3PWPD 4AJ0A 1BD2B 2AXFA 4IRSB 5F9WB 4JO4H 4PY8J 1CG9B 1Q72L 1YEEL 1EAJA 1MCPH 2GJZB 5D5MA 2OK0L 1P2CA 3D2UD 4PTTA 1LTXB 3KPOA 3BYTA 2WINA 2NTSP 32C2A 1GZQA 4G8EA 4J3XA 2NXYD 4IRZL 3KPQB 4AEHH 2DL9A 1HI6A 1JNJA 1SYVB 2FZ3B 1VACA 2YD2A 3T2QA 1TNMA 4QHKJ 1WLHA 2H6PA 4L3ED 3UZQA 5FHAH 2E9WA 4BH7B 4LDEB 3V5HA 1D7FA 3EU5B 3W5MA 1U8KB 4JG0H 1OAQL 4U1LA 2CJUL 1FFOA 2ZUSA 3CU1A 4HEME 5MHSE 1J5OL 1I8KB 1M7IB 2DLHA 5T3ZH 2MPAH 5IVZB 1QFUL 1S3KH 2PW1A 4G42A 3MCLL 5SX4I 5DD3H 4FQ2L 5CLTA 2OLDA 4K7PX 1NCCH 3ZTJH 4KUCD 1RZ7H 4OCSH 1YQ2A 2Y23A 1GXMA 2ERJB 4HS8H 1BIIA 5D1XB 1L4IA 2X7LA 2BXZA 5LGHH 1JWMB 4RWYH 4MD5B 3BDYL 2P4AB 1T22A 2Y9RT 3KHOA 3G5VB 3C60C 3BKJL 3C60A 3QUKA 2N1KA 3B2UD 1MWAL 5FO7A 4K2UH 2XG4A 1A3RH 1XZ0B 1S9YB 3AREB 3SDDC 3OKEB 3ILPB 3MLTA 1QOKA 4GG8B 2DAVA 4YPJA 1KBGH 3L3OA 4Z77B 4CL7A 4Y4KB 5DD5L 1XGRA 2CLVB 3BQUA 2X4QA 1ED3A 2ZNWA 3LPGA 1FV1A 2X44D 3ARBD 3MA7A 3UROR 4F7MB 4NO3A 1KOAA 2YSSA 3ZKXB 5HGAB 2BY1A 3MJ6A 1DSFH 1R3KA 1A4JA 2UUDH 5I1CH 1MCWM 1UJ3A 3CH8A 5CGYC 2NY4B 43C9B 2W91A 1JGLH 3D5OF 2Y06L 1RZJL 4GQPH 1S7WB 3BH9A 3E2HC 1DQJA 3KR3L 3IRPX 5C0FA 1PEZA 4HIHA 3U0PB 1BF2A 1UKQA 3H3BC 2HRPL 2O5YH 5E4IA 5J1AA 4FQCH 3HMWH 5C3TA 4FQ1L 5IP4A 2NY2D 5DR5H 1OWWA 4F58L 4P9HH 1FAIH 1N5AB 1OAZH 3CLEL 1FYHB 3HN3A 4JAMA 5I1HL 1I7UB 4P3CH 3K2UL 4HWZA 3S7GA 3CDGB 5EUOB 5JPNA 2YR3A 1MOEA 3BT2H 1IZJA 1LP9A 4P2QA 1CGSL 2EIZA 1C5BH 4PTUA 3D5SA 5IG7A 1PG7W 3EKCA 5BO1L 4JDVB 4G6AC 4WY7L 3VD4A 1SY6A 4NWUH 5JXEA 4PLKD 5CJ8A 1BPVA 2HFEA 2PO6A 4ODTH 4W6XB 3OSKA 5JHDD 3MV8A 1TJHL 5JUEL 3C6LD 3KLSA 1T21A 1UQSB 2V9RA 3VXSB 1LE9A 5CEZH 3C09C 2VDQL 3GK8H 1C7TA 4A6YL 2A9ML 3STZB 1J8KA 3MREA 4L9LC 5IBLD 1OT2A 3VRLF 3G6AB 3SPVA 2C7UB 4X9GA 3SKMA 2IADB 4JCLA 2IPKA 1ZLUK 2N7AA 3QDMB 3I75B 4OD3H 5C07A 1TJIH 3P2TA 3U30C 1LO2L 1HH9B 4KK5D 2EIEA 4CDHA 3WEXB 3OAUH 1YYLL 5DGRA 1GGBH 1NJ9B 1OAYL 3I85A 4MCYA 2R1XA 4YHIA 4I48B 2R1YB 4NKOA 3GMNA 4ZG1A 5DK2A 1T2QL 2ESVB 3LHPL 1FBIH 1TCRA 4WWKC 1QFHA 1Q9KB 1P9MA 1KXVC 3H9HB 2R29L 2ZUTA 2ZCHH 4KDTC 5HVHC 1BOYA 1MLCA 3ARDC 4L3EE 4X4MA 3DWTA 3V95A 3EGSA 1EMTH 2ID5A 2UYLB 2A9NH 5EDXA 2G75B 3EDJA 4QCIA 4F7TA 1GC1C 1QVOB 4I18B 3QPQD 3TV3H 4IHOB 2CMRL 2Z35A 1S7QA 3DPYB 5BQ7B 5KVFL 1IKNC 2YXMA 5BJTA 3E1F1 2A9NL 4ONTA 5FAAA 5K9OB 3S96A 4EZMA 3WFEL 5D96B 5CZXD 4JFEB 4YAQA 5B8CB 1KENH 3O3EB 1CG9A 4G8IA 2EO1A 3B3IB 5FHBH 3RHWK 4KTEL 3DOSA 1ZHBA 4JFFD 4WO4C 1N2RA 2X4OA 5EZIH 3QG7L 3ZTJG 1VGEL 3QP3A 4LASH 4ZO8A 4K3DH 1M6OA 4GAYB 2XWTB 3K8MA 4Q9RH 2HN7B 3A0OA 2HJFA 1TZIB 1CGWA 3VDAA 3VFNA 4WI4A 4X8JB 4L9PB 1FNSH 4K7PH 4X6DF 5I1KH 1UH4A 3FOLA 5EOQL 1AGDB 4JKMA 1J88A 4FZ8L 1G7IB 5D1QD 3BZEA 5E9DE 5B8CC 2UWEA 3VXMB 1PG7L 4KI5F 4PD4K 5AAWA 1CDJA 4G7VH 4Y2DD 1T5XA 3TN0D 2Z9TA 2FGZA 1DJSA 3V6OA 1PSKH 2Z31D 2ZSVA 3S36H 2AEWA 5SWZD 5AZEH 2ZSWB 3DUUA 1NMCB 4G42B 4HHAB 1AP2B 4WTZA 3FFCB 1WCBA 1NKRA 3H7BB 5IMKA 2EYRA 5C0EB 2YD3A 3QHFL 3QXUA 2R4RL 3OAZK 1I8MB 3QI9B 3OKNB 4X80L 3DIFB 4Z7VB 2YPLB 4GO6B 1ZANL 3P0VH 1CGSH 1QSZA 4OM1H 5FXCH 1Q9LA 1U8HB 5A16B 1MJ7H 3B9KD 4P57B 5IF0A 5TF1H 1HSAA 4NPYB 5JHDE 3TO4B 5E2TH 3Q48A 5JPMB 4WNQA 2VERN 1YEJL 4LNBB 3GHBH 5GRXG 1JL8A 4X9FA 3UPCA 3SBWC 2ZKHL 4RGNB 3MOAL 5DA4A 3LKQA 3GSNL 2PKDA 4N0UA 1YN6B 2P5EA 2D31A 2IANE 3V6BR 3P30L 3PGDB 5EB9A 3LN4A 3PZ2B 1AQKH 4JFHD 4EIGB 5AG9A 1LO4L 4UTAH 4KRPD 2OXHA 3WLWC 4NO3B 1CL7I 1QFWL 3VRIB 3MJ9L 4UIKL 1DSFL 5E70A 4YUEL 5JOPD 2WBJB 3H9SE 1CLCA 3FRPA 3V0WH 3KYKL 1T5WA 4OQ1A 5GS0H 4ODHH 2MKLC 5DC0A 3DSSB 1S7WA 1D9KB 3A6CL 4KK5C 3ZKSD 1J87A 4NZUL 3QNYB 3O3AB 4IOFC 1R3IH 2VDLH 2VLKE 3ULUC 5IT2L 1Q9WA 1GOHA 4XZUA 1UZ8B 2VUOA 1U9KA 4KVCH 3C6SB 1BLNB 1FVEB 2ADIB 5I16A 3T4AB 2VDPH 3WNNA 3QWOA 4O00A 5LQBH 5CEYB 3HNSH 3ORJA 4PJGA 4MD4B 4JFDE 4OF8A 5LKNA 4PJDE 1P4BL 3GMRA 3EJZC 3NAAL 1FVDB 2B1AL 3OKMB 5LGHL 4WI9A 2EECA 4NNYA 2GUOB 2EDWA 2DICA 2NNAB 4NN5C 3SKJL 3VG9C 3W82A 4N5EC 2CIIB 4XP6L 1LP9E 4P2QE 8FABA 2AJUH 5JQHC 4NUGL 4Z78B 5FYJH 1E4XL 1J5OH 1N0LA 4XP6H 4LLMA 1DCLA 2BNQE 3TNNB 3L3GA 1O0VA 1QBBA 5EU6D 1KELH 1TZGH 3LPFA 2XQBH 3VWKB 5D6CB 3MNZA 1T6WA 5DK3A 4OFPA 4JFZL 4G80A 4Y19D 4Y4HD 3ZT7A 3T3PF 3WFHB 2DWEA 2H26B 4KKLC 1KB5B 4NQSB 3WUWG 1A4KB 5C6TL 3DX6A 3ULVL 1JK8A 5CZVL 5EN2A 3HPLB 1EJOL 3DMMD 2R23A 4YDLB 3KHQA 4A6YA 4Z7QF 1OP5H 1MFAL 2XKUA 3MBEB 1VERA 4M5YH 3ZMRA 1X4YA 5CLWA 1U92A 3WIFB 4ZTOL 4LVOC 3ISWA 3AMLA 4PV8A 1JTTA 5IMOA 4NC0B 4S1SH 4S0SD 1IT9H 4J8RB 4QHLB 1MLCB 4D0BB 3T1WA 1DQDL 1U3HB 4HV8B 1JI2A 3RI5K 5GRYA 4NM4H 1PX4A 4HUUB 5I0ZA 4XPTH 4GRLD 2DQFA 1PEWA 2VAAA 3QEHA 2X4SB 1KJ3L 5J57B 5CBEA 4D9LH 1SEQH 2E27L 4HKZA 4UTAL 1KN2H 3HI6L 3LS4H 1II4E 2V2TA 4JY6A 1RURL 1G1CA 3QEGH 3O3EA 3JXAA 3CFEA 3KYMA 1OP3K 4S1QH 5EIIB 1EXUA 1YPZB 2P49B 2KZ1B 1ONQB 3ARGD 3MOAH 4LHUA 3RWFA 2R9HC 4JQXA 4RRPA 1KTDA 4X99B 1A6TB 2FX7L 3QHTC 2EDOA 4LU5L 5JW4R 2EDQA 4HS6A 1I9IH 5TF1L 4GTOB 3CZJA 4X8JA 3D39D 2RIKA 4TTDD 3NZHH 3RWIB 2X9WA 3LRSA 1C5CL 3EOBB 1XF2A 2DQIL 4GRMB 1ZOXA 4M1DH 1BFTA 3N1MC 3QIUB 4GLRH 1K4CA 3QULB 1UWXH 3BPLB 5HDQL 5F6HJ 1SA5B 3OGCA 2IH3A 2DM3A 5F7MC 4LHQB 5IWLC 1UA6H 5DXWA 3SCMD 4I2XA 2BERA 2ZG1A 5ICYA 3QFJD 3GBNH 4NO2A 2EDLA 2CO7B 1WCBB 4N0CC 5IFHL 4HIEB 5HYFA 2J2ZA 1OTTC 2I5YL 3QEQB 4P9MH 4U3XA 2E9IA 1A6UH 1ZV5A 1I8MA 5CBAA 5EOQH 5J0BA 1JFQL 1AO7E 3OKLB 2DQIH 1I4FB 2CRYA 1CF8L 5FV1L 2ARJQ 3R8BB 1CE6B 5KSBF 1SM3H 5BRZD 2EKJA 3I84A 4WU7B 1KXQE 5MEOA 4U2ZA 1CR9L 3FT4A 2AGJH 2Y7QA 4N0UB 1BHGA 4HH9A 3S3PA 3O3BB 5I8CB 4GAJL 5EZOL 1IQWH 1KENL 4XAWH 5FHBL 4PJEB 5I1AB 2VH5L 4NCDA 3N1QC 3PWJB 4AH2A 3L5WB 4FG6D 1TTUA 4X6CB 1WF5A 3G5YA 5BS0E 2D7TL 5D1ZC 1FAKT 1T1ZA 3RBGA 3E8UL 4M1CC 4WEBL 1CXFA 5DHYA 4HDIA 4Y2DB 5C09B 3T3MF 1A21A 3TFKD 2HTKD 4KDTA 3QDHA 5FA3A 1A0QH 4AMKL 1BJ1J 4DGYL 3O6LH 1MNUH 1ROWA 4NFBA 2HMIC 2YD7A 4S1SL 1WC7A 4JRXA 1DN0B 5IJVA 4DTGL 1J0IA 3OB8A 4K3GA 5KTEL 4AY0A 1TVDA 3FCTA 3QUXD 2GITA 4NZDA 2R2LB 5EFIA 5KSAB 2BNRB 4E41D 5T33L 4JFYB 4N0FA 2AJSH 4L9LB 4H0HB 2VIRB 1TJIL 3AY4C 4OD3L 4BKLA 4NNYB 1NEZG 4QRPB 4QYOB 1SJEA 2BSTB 3PHOA 1C16A 5EU6E 3U0TA 2P8PA 4NNPH 3KNBA 4PRPD 4MQ7A 3KPPA 3OF6A 5FUZL 2Q87A 5HYIA 1R76A 1TZHB 3HI1A 3INUH 1ZGLB 3LKOA 2PTVA 4Q2ZB 3DTXA 4CGTA 4EDXB 2PCPB 3GNMH 3WN5B 2EDTA 3ZL4L 2ZPKH 2VZOA 1JZ6A 2JTDA 4XCCH 3RNKA 4Z7NF 2BRQA 5EA0H 5DEFB 5J12C 4K8RD 4MVBC 5D6CA 4WCYL 5KAQG 1BZ7B 1MVFA 3BXNA 3QG6A 4LP5A 4YXKL 3FB5A 4B0MM 5E6ID 1NANH 2L7UA 5D2LB 5DJ6B 5DZOA 2P43B 3MLYH 1NMBL 2B1AH 3BT2L 1JCQB 3ARGB 3OAYH 2GCYA 1ZXQA 4P3CL 2DQJL 3K7UA 4KVNL 3PGFH 2H6HB 3QO0B 1LD9A 4Y5YB 5J13C 3MBEA 1NANI 4JRYD 4F58H 1IARB 5AGDA 4R7DA 1ZEAH 5T3XH 4GOSA 4TUKH 3IU4L 4ODXA 2HLFD 1GC1L 2VZSA 2APVA 4NO0B 4JY4B 1UH3A 4R4FH 4OF0A 4S1RH 2CXKA 1JJUA 4D4AA 3MRDA 5F72S 1UYWH 4HWBH 1U3HD 3QIWB 4RCAA 1FLRL 4LCWB 5D70H 3GSRA 4GUPB 1F4WL 1SVZA 1N64H 1FP5A 2YPVH 2XZCH 3FHAA 3V0VA 1X5ZA 1ZWIB 5GGVY 3QXDB 2FR4A 4LSTH 1RUAL 2WWMC 2DI8A 4HS3A 5TDNA 4KUCF 4EI5C 1HXYA 4JGJA 3G6JA 3EFDH 4OIBA 4XPBH 1ZT4B 5IROA 5JHLH 2VDKL 3I6LE 3W0WA 4WGWB 4KKBC 1NCWH 1KULA 1CD9B 3TLRA 4X4YA 1F4AA 2VXTH 5IQ7H 4L8SB 1FQ9C 1J1OL 3N85L 1Y0LB 5FFLA 1TQBC 2EDHA 4P49A 4X80H 3QIUA 1B0WA 2NY4D 4Y16A 3PP4H 4J3WA 4EQ3A 5FYJE 1ZGLP 1MJ8H 1RZ8A 3S34L 4FQXA 2W9DH 1RZFL 3PWUA 3MCLH 4BSVB 3MLXL 3QISA 3WUWA 1QRKA 4QRUA 3DI3B 2R2CA 2X2YA 4ODWB 4NGHL 4M7KH 1S78D 3SE3A 4PLNC 2VR4A 4GKSA 5FA4B 1QQDB 3S36L 5KJRH 2YUVA 3Q5OA 5HI4D 4BZYA 3T1FA 5TQ2L 4DW2H 4OZHA 4Q7DA 1CFAA 3MGTB 4RDQF 1DBBL 4ELME 4K23H 2XYCA 3MRMB 2X4UB 5D6DA 3S4SA 1HE7A 1JWSB 5BVJA 2X1PA 4Y5VA 3U83A 5HYJA 5DHVH 3FQUB 4G3YH 1OM3L 1LD7B 1KCRL 3ARDB 4LLWA 3PGCB 5D1XD 2NPLX 3TVMB 2NY6D 4KRNA 3FT2B 4YDIL 2ADJA 2MJWA 4M62H 3GBLA 4X9HA 1YEEH 3RPIB 2WBJD 1M7DA 4L8BB 3MMEA 4NQDE 1WFUA 4Z7WB 4S2SB 1S63B 3PWJA 2NW2B 1CD1A 3BI9X 3DRTB 2I9TA 1B4JL 2A6JA 4KRPB 4D9RD 5T1DL 5HHME 5I1DA 1F13A 3M8OL 1A7OH 3MRJB 1D5ZB 5IGXH 3OB0K 1S7RA 4PD4J 2QSTA 3HPJA 4HUXA 4Y5XB 1UB5A 1F3RB 3MRFB 5KW9L 2BOBB 5CSZB 3SKUD 1P4IL 4MJIB 5E6YA 4GFTB 1ZT7B 2F54D 4JO3L 1J9CT 4JDZA 1EMTL 5EOTA 5JORB 5BMFH 5CEXB 1HHJB 3T77B 1GGCH 3H3PH 4BZ1H 2AJVL 4GRWF 4CAGA 1O7VA 3SKNB 3PWLB 2DQUL 5JW3H 3VFSB 4O2FB 2G9HB 4Y19E 3DX9A 4FXGB 1G7JA 3D2UB 4QTHB 4ZPVB 2E7BA 2GFBB 3LQAC 4FQPA 4XCYB 5JW5B 5IFJA 3X3FL 5E5MA 5H2BB 5ENWB 3VGBA 4QWWD 1NUGA 3QO1B 1OLZA 4MA7H 4YQXL 3B9EA 3WSQL 5B38B 2DD8L 1GXEA 1YEDA 3CGTA 4C56D 3WFCL 1H5BB 2Z31B 5FYLE 5INCA 3BZ4A 4I4WA 3I02A 4U1MA 3EO9L 1EVTC 2NYYD 4GS7B 5J12B 2V8IA 4GS7C 3G6DL 1YYMH 4OT1H 2WW8A 4U6XB 1HI6B 3JWDH 1I7RA 1V7ML 2AP2A 1QSFB 2R39A 3PDDA 5DVNA 1TNUB 5DEFA 3MTRA 1MI5E 1FL6A 2A74B 3ZT5A 2DRUA 1JWUA 4EN3D 1KCUL 1D5XA 3WJLA 2F8OA 2J1KA 4UOW0 4LIQH 4IDLA 2C1OB 3UPRA 4MS8C 4JM2A 1C5BL 3OZ9H 1I1CA 5EC1B 3BSZL 3F7YB 2V2WA 3UX9B 3NFNB 3PL6D 4JN1L 2IALB 3T08A 1LO5A 1H3TA 4PJ5B 4CVUA 1O6HA 5HHQB 5KSAC 1QPPA 1E6JH 1U8PB 1JPFA 5EUKB 4RAVA 2VITB 4NRXA 3THMH 2ZUVA 4WWKA 1F45A 4F57L 5JW4Q 4JY4A 1EFXD 1OD9A 1NFDE 4BOKA 2I60H 3RVXC 5JQ6H 1QSJA 1SHMA 3MRDB 3BISA 1I8IA 3C2AL 4ZH1A 2YKLL 5ADOH 2AI0L 2WZPD 4GUPA 3T04D 4JZOB 2F53E 2DTSA 3PWNA 3AREA 2Z93B 4Y1AE 4ERSH 1E28B 1HCVA 4Z95H 5DQJA 2KZWA 5DJAB 4QHMA 4JDTH 1BFOA 5D2LF 1BQLL 1IGMH 1JPTL 3C6LC 5TDNB 4OCYH 1IQDB 4XWOC 3BFOA 5KOMC 4NN7C 2DQCL 1D9KC 3T8XB 3S34H 4NN6B 5IVXF 7CGTA 1T7VA 4L29B 3TIEB 2FEDD 3SO3B 4YDKH 2OMNA 3KSLB 4LKCA 2AEPH 4XMLL 3PDOA 4NQED 3QXAA 1CVRA 3IJYA 3T2PA 3ARFC 4NRZB 5E4EB 2O5XL 1Y0LA 3MRCA 1DBJL 1YNLH 5FB8A 3O9WD 4L4JA 2O5XH 3U0PA 3C6LB 1MCHA 1NL4B 1F4YL 2AXJA 1YEHH 2OSLB 3EYFA 1KCKA 2W9LA 4XAKE 1RZ7L 5CINH 3VXRB 3HS0B 3FO9A 4LFHG 2OJZH 5FCUL 5BS0D 4OUUA 4WUUD 5DD3L 4NKDB 2Q6WA 5DLML 2WLZA 1CGTA 1HIMH 2YA1A 3GIZL 5AEAA 2CLRB 1QQDA 1GRWA 3TT1H 2FATH 3GSUA 1OAQH 4PTUB 5IG7B 1N64L 4QOKB 2RCSH 3T09A 3HUJF 4OLUH 5FO8A 1FLRH 1KGCE 3QZWG 3VFPA 3DV6B 4JFPB 4ZO6A 5FV2A 5GS3A 2MCG1 1VHPA 2X4RB 2YKLH 3DV4A 1CDUA 4UDUB 2R1WA 1V3MA 4R8WH 1Z5LB 5D7KD 3HAEA 4YHPB 2WP3T 1S7TA 3B5GA 5J11B 2FDBP 4XPFL 4R0LC 2ADJB 3WFDH 2VYRE 2X4PA 3SKMB 2ICEB 3MLWL 5ETUB 2V5RA 4PRHB 3PWPE 4MJ5A 5GSRB 3GMOA 1TITA 3AM8A 4MWFB 4RZCB 5CHNB 3ARBB 4LDOB 1MLBB 1NCDH 3MNVA 5EZLB 3OZ9L 3HPJB 3X11B 2Y36H 3FQNA 1QNZL 4P48A 4YXKH 2AXFB 4ZOAA 3S5LB 1NCDL 2CKBL 4B50A 2FHFA 2Z91A 1J1PL 3U7YL 5I71B 1P2CB 2COQA 1JCSB 3I6LD 2O93L 1VFBA 2VLJB 4WO4B 5CEXA 2BOCA 4H0IA 5DUBA 4RIRB 4H20L 3GSNA 2UYLA 5IR1B 4PGBB 4L4TB 1YYML 3PL6C 3QUYB 3PWLA 4XPFH 3VI4E 3WIIH 2W0FB 4QCIB 4F7TB 1VADA 4R4NC 1HH6A 3CFKA 3V7AE 5BQ7A 1BQHB 1CLOH 5E5MB 1NGPH 3L7FA 3UYRH 4IRJB 3MJ8A 4U1NB 2DIJA 2YC1A 5ITFB 3B9KC 1B88A 3WDHA 1J7VR 4KRLB 2BBCA 4RFEB 2X4OB 3DMMA 4F7EA 4NHCL 5DWUH 3RJQB 3SJVA 2NY3B 5IVZA 2XWTA 4M00A 3AREC 3WNKA 1DE4A 5JDSA 3TH3T 3GIZH 4YXLL 1NLDH 3VFNB 3K7XA 1R5IB 3FB6B 5DFVD 2IMNA 1I7RB 4O02H 1GGCL 1WZMA 5GIRA 4XT1C 4YEFA 3GSVB 5I17A 3UTZA 5CINL 3QPXH 1S7VB 1G7IA 2H32A 2BVQA 3MV9D 1A6ZB 4HPYL 2IH1B 1YC7A 3W2DH 2H9GA 3OKEA 2HT2C 2PYFB 4YDKL 1LO5B 4JFXB 3WHE1 3EDKA 3L3HA 1IQWL 5B21A 1CDYA 1F42A 3O6KH 3UTTA 5CS7A 5IMKB 5IHZA 2CLVA 3BQUB 4XHJD 2V17L 3DHMA 3D85D 4M62L 3IXAB 4IMLB 4ELKB 5E7BA 4K55A 1NQBA 3WIHH 4WB2A 5C0JA 2QKIA 2X70B 1A4JB 2GY5A 3SDAB 4IIQC 1U8IA 4XC1L 3PV6A 1GCFA 4EI5D 4C59B 1NCUA 3RIAF 2XWBA 3HNTH 5BVPL 4YFLI 3NIFF 5JPMA 1YEFL 2B39A 4LVHC 3SQOH 2UWEF 5GZOC 3MCG1 5EU3A 3WE6A 3PHQA 4Q58C 2FBOJ 3BRGC 4JHAL 3TVMD 5CIPB 4OFYA 2EXYD 1L6XA 4HLZH 1YJDH 4PJFF 5DURD 1KLGB 4WUUA 1WFNA 2JJSC 4N8CH 3C72B 1PKOA 1OCWL 3MUHL 1JMZA 4G9DB 3T4YB 2CLZA 2VDML 4KK8D 1Q1JL 3VH8G 2ZUQC 3W11D 2PR4H 3KPRE 1KC5H 3RL1B 1G7HA 4JN1H 4RMTA 5I1EH 3BSZH 5DGQA 3GBML 5DC9B 4WDIB 1IAIH 1XT5A 4C56A 2EH8H 4EKXA 3DYMA 4QXGL 3LDBB 4MJ4A 1H3VA 3FN3A 3VXTA 3RZCB 4Y8DC 2AV7B 1I3VA 3EFFB 4LU5H 4XZUB 1YUHA 4HIIA 4AL8L 1W0WB 2IEJB 5E2JA 5DD0H 3E6FA 4H88L 3SDAD 4NCC2 2OZ4H 3GMQA 4M6MH 2J5LB 2HG5A 2BC4A 3MODH 5J3HD 5D7LB 5T1KD 3WNMA 3QDMA 3EO9H 3E37B 4TPRL 4NYLA 5K33A 3GMRB 4ZUWB 4PGEB 5TE6H 2J12B 1KN2L 2CKBB 3SCMA 4H1LB 2GEEA 5GGUA 3TIDA 3U2SA 4Z7UB 1UM6L 3E33B 2XA8H 4G6AD 2YPVL 1OW0C 2ATKA 4TNWF 4U1IB 3DV6A 4JFPA 4ONHB 4XPTL 3PWPA 1H39A 4KDWA 2ESVA 1C5DA 4P23C 4WI7A 3RL2B 5IFAH 4S0TD 4V1DD 1PKQB 4Z5RA 3PABA 4NQCB 3RA7H 3VI3E 4DEPB 4ZFOB 5GGSA 4WI3A 3BO8B 4POUB 5JW3L 1YDPB 3ARGC 3AS1A 1WZKA 3A6BL 4XMPH 2VZ1A 1MFAH 1MHEA 3HFMH 5K9KB 3GMOB 5E2VL 3HKFA 4LSPL 1UJ3C 4LPXA 5D7IF 2ATPA 2XZAL 3LS5H 4PJFA 1T83A 2OP4H 3ES6A 2EDXA 4GRLA 2E6JA 2VTFA 5C08D 1MCLA 1HDMB 5E8EB 1QLRA 4KFZC 4HPOL 1L6ZA 2FJGB 4FQHA 5KSBA 4M7ZC 1H0DB 2QR0B 2Z91B 4BQCA 5E9DD 2APFA 2XWJA 5D5ME 4P2RE 4HMCA 4WCYH 1LP9F 3T0EE 5C7XL 5F7DA 5C0CD 1EPFA 3IFOB 4P46C 1E4XH 1IC4H 4F8QA 3ARDD 4PGBA 1TTGA 3LZFL 3GSQB 3U9UB 4CBPA 1WIOA 2W0FA 4KY1L 5AUMA 5CJXA 4UBDD 1WK0A 2BVOB 2PXYB 4NWTL 4YDLC 4L8DB 4LLVA 5HHPA 4KKCD 1BQHA 4JZJB 1LO0H 5GS1B 3CVIL 4MNGE 2XN9B 3CPLB 1I8LC 3VRLE 4NJAL 4I9WD 1QSED 4ZFZA 1AJ7H 2IPTH 4AEEA 3EO1A 4H25B 1P4LB 1PZUB 4JQVC 2EEAA 4X6DB 3U46A 1AGEB 3RTQA 1UVQB 1F90L 4CVXA 2A77L 5BV7C 2BY0A 3ROOA 4NT6B 3EO0B 3FB6A 3ZKMC 3OKDA 2DS4A 3OKNA 2JJTC 4Z7VA 1X5HA 1RZFH 3DVIA 1UCTA 4GKZA 1YJDC 3PP4L 1MPAH 3GMPB 3ECBA 3K4AA 5DRNA 5IF0B 5F3BA 4LCWE 3MJ9H 5C71A 3NCFB 2EKSB 1IZKA 1G6RL 4LCYA 3U4EB 4LEXL 3X14A 2B0SH 4ZRPA 1ORSB 3HXFB 3GRWA 2XPGB 3O6FA 4ZNEA 4HCRL 1OGAB 5ICYB 2EH7H 4W6WB 1JPGA 1NAMH 1D5MA 3IDMB 4I1NB 3H8NA 1NL0L 5KOVC 3LN4B 5IB3B 3GSNH 4C83A 3VFTA 4RSVA 3K80A 3RVWD 5ECJE 1MCSA 1BBDH 2AGJL 1CXIA 3FQWB 4NUJA 1MRDL 3D0LB 4M3JA 3TYGL 4XXCC 3U7AA 4MQTB 1OHQA 1H3GA 3BUTA 3CFCL 5ITBH 5D70L 1IRAY 3IU3A 1AIFB 2HP4A 3FB7A 4QOKE 1JTOA 1FFNB 3O3BA 3V0AC 3IT8D 5HGGS 3CX5J 2B4CC 1RV6X 4K07A 2J8UA 3WD5H 4MNHA 3OXSA 2GAZA 5KVDL 3GJFH 1MCRA 2M1KA 2JIXA 4TUKL 1PSKL 4PJGB 4PRNB 4CW1B 3QUZC 4X6CA 3NIDE 1N4XH 2M26A 4KQ4L 3I9GH 3P11L 2E7HA 2Q7YA 1S9KC 1T1ZB 3QUXA 5I8OL 4ENED 3OKMA 3OJMB 1PG7H 2YXFA 1PY9A 1VFAA 4GW4B 5D93B 1KACB 3P9LB 2V9TA 5CILH 3VGAB 5IVNA 1G9NL 4RX4D 3D85A 1FNSL 4JFFA 3IDNA 1P7QB 1AH1A 4C1SA 2AV7A 1NAMB 1T2XA 3AU1A 3H9YA 5B3JF 2CK2A 4MD0A 1MELA 3F62A 4XCCL 1A8JH 2VNCA 1K9TA 4CKVX 3QIUD 5L0QB 2HFFA 5HHMD 2VZUA 4PRPB 2VB5A 5GRJL 1N7MH 4NQDB 4XBPA 4Z7WE 4RRPG 2BSRB 4G9FD 4V1DE 1NGXB 2QLVB 3SDCC 4MQXC 1A4KA 1NH6A 4MX7B 3F8UB 3S35X 4I0PC 2XQYK 2W60A 3O45B 5ESVB 1C16B 2BSED 2R23B 2FLBT 4AZ8A 4KRMB 3I6KA 5A43C 5LBSL 4Q2ZA 2O26U 1A6PA 1RJLA 3ZYIA 4GTVB 5C0CA 1ZLSL 1EHNA 5IVXE 4PJ7F 4MJIE 2ZUUA 2PCPA 4WRLA 1CXLA 1MH5A 4HC1H 4WTXA 1CTNA 3BO8A 2JCCA 1OSZB 5IMOB 2VLLA 4Z7VF 5F89B 3T2NL 4PJEE 1AD9A 1AGCB 2O5ZL 4LLYB 1KIQB 3SE9L 3CC5B 3VMNA 4ZTOH 4GBXA 4YPGB 1NUFA 2DTMH 1QSEA 5D2LA 4TUOB 2V2XA 1A0QL 3F65A 4GRLB 5K9JH 4KKLD 2J8HA 4BYHA 3MLUL 5J6HA 3MXWH 3WJJA 2P5ED 2QL1A 2VDRL 5C6TH 1B90A 3DXAB 4B5EA 2OI9B 4PJAB 4XWOD 3FTGB 2NY2C 4UINH 3EDDA 2LFGA 5F3HB 2WANA 4ODUB 2B5IB 3AFLA 3OTTA 4U7KA 5HHXL 1X81B 4CJ0A 5BOZG 2NY0C 1INQA 1KELL 1FYTE 3SGDI 1DBAH 4BQ6A 3TBWB 5FYJL 4BH8A 4Y5XC 2V7HA 3DI2B 2FBJL 5E7FA 1KYOJ 3VWKD 2EC9T 1DLHB 3BRFA 3MYJA 2CXGA 5D1ZB 2F0YB 4KC3B 15C8L 3ARYA 1WEJL 4Y88A 4YE4H 4EUPB 5I30H 1GHFL 1DBML 1GSZA 5JOFA 4PS4H 3RGVA 5IBTH 3X12B 5EU4B 4J12A 4HIEA 3HMWL 1QLEL 2DQDL 4G8GD 4LSSH 5DI8A 4OV6F 3BGFC 4X6BA 2UV3A 1JZ2A 1CE1L 2BJML 2NY6B 4LNRB 5FYKH 4DWHA 1JGLL 3GUTA 3C8KA 1ZVHA 2W65B 3F6LA 5T1MB 5HDQH 4HW5A 1EHLL 4YHOL 1YMHB 3ROLA 3AS0A 1X6NA 5BV7B 3BPOC 1C08A 1KJMB 1CD0A 2I07B 1CIDA 1DFBL 1WITA 4O9HH 2H2SC 4WFED 4XPGH 3SE3C 3ZKQD 4FQXB 4EJ1C 1F11A 3D39B 4U6YB 3KPSB 3HE6C 1PFCA 1F02I 4DGIL 5DQ9A 1N4QB 3V5KA 4GXUN 1YA5A 1XF5A 1FIGL 4LL9A 1RPQA 1CFSA 2NX5E 2P8LB 2DDQL 3F12B 3KXFD 1NFDA 1NLBH 1U3YA 3HE7A 5E8NB 1H8OA 1P7KB 4O2CA 2LVEA 3JSSA 5DJCA 5IB2B 3IDGB 1U95B 1TETL 5IOPA 1G6VK 1CK0H 3ARWA 1PYWB 4FABH 1YEJH 1T0MB 2PYEB 1MJJB 4QRSB 1CQKA 3F6IA 4E9LA 1E27A 2EC9U 5AAMA 1A1OA 1OTUD 4LLUA 1F3DJ 1KTRL 1RU9H 3FQUA 4WWID 5FA3B 3QNZA 4Y1AD 3RNQA 1D8EB 2XIDA 5C9JB 1XR9B 3BMWA 3BZDA 3VE0A 2E5EA 5FECB 1WC7B 3VG0H 1FNEB 1SJHA 1ND0B 3MRRB 1DN0A 5GXBB 1T83C 1S3KL 2GSIA 1A5FL 1T04B 1S9XA 1FDLL 3ZDYF 5IB1B 4D8PA 5EU6A 3IFPA 2QHLA 3GDBA 2BB5A 4GBXC 4MNQA 1HILA 1LMKA 2Z4QB 2V7NB 4WHDA 1QPXA 1XGYL 2VLJE 2BVTA 2DN7A 3RWDA 2VDRH 1QLFA 4JKKA 1HSBA 2AERT 1H9VA 4YNYB 4OZHF 4IRZH 3EYVA 3VXME 5LGJB 3LV3B 5K9JL 4QY8A 3UAJD 2YUXA 5F7EH 4TRPH 4ZD3L 3VFSA 3QZWB 5H35A 5I2IB 4H8WL 4MNGA 4G5ZL 5HHVH 4L4VA 3QH3A 5JW5A 5IFJB 4PRHE 3WFZA 2NR6C 4TSAL 5SWQA 1MHHA 5JIPA 4PJ8C 4Y4KC 3G5XA 2ED7A 4HKXB 1PG7X 5EZJB 4JGMA 1A7BA 3PJSB 1FG9C 3C5ZB 2CMRH 3H7LA 3D3VB 3SY0A 2BDNL 5ICXB 1RJLB 3H42H 4QHNA 1EVUA 2XZQL 1J0JA 4R0LB 1URLA 3IYLW 4QXUH 3NOIA 4LARH 1GZPB 3DX8A 4MQSB 4UQ3B 5JIKA 2FH6A 1Q94A 4P5MA 3ZE1E 1BOGB 1MQKH 1JWUB 2NZ9D 2X4NA 1FIGH 4X6DE 2OBGA 5EO1A 1OAKL 4JN2A 1WTLA 3TESA 3IAQA 1JTPA 3RGVD 4XPGL 1QHPA 4YUEH 3RBSA 5C0RH 4HBCH 1G9NH 3OAUL 2ITCA 4PJAA 3HZVA 2I24N 4WFGD 3I50L 4GTTB 3VRJA 4XP9H 3F5WB 3QQ3B 3NABL 3QXTA 1ED3B 1RD6A 4LOUC 4WFFD 1CXEA 3KPTA 2A9MH 3BQUD 1U8QA 4FP8L 4ZUSA 1SQCA 3QWRA 3ZE0E 5BV7L 3NVQA 5FEBA 4Y8AA 2V7HB 4P4KD 1NKOA 5D72H 3LKSA 3IDJB 4LPTA 4N0YH 1J0KA 4YXHL 1MJ7L 4NCC1 2EEDA 3MYJB 2Y1VA 4DAGH 1FGVH 1UENA 5C09D 1IKFH 4XBEL 1OARH 2R2BA 1J10A 3WUWB 2PW2A 1FGVL 1N0XL 4HW6A 1IQDA 2QQQA 4RDQG 5TQ0L 4YH6A 4HWZB 3UC0L 4JVUA 3ZDZE 4OKVA 5HGHA 1MJUH 1NUNB 3P4OB 2F5AH 5ACMA 1BBDL 2NY1D 2VQTA 1R3HB 5I1HH 4IEFB 5DJXB 1QBLH 5ID0B 4DOHE 4L29A 4MA8H 5AZEL 2JJTA 4UDTA 4OGYL 4ZQKB 5IB4B 2AK4A 1J11A 3ULUD 3IGAA 4Y1AA 4YFDB 3C8KB 5CD3A 3L3JB 5I74B 4DCQB 3E3QC 1U42A 3MRCB 2XKSA 3MGAA 4G7VL 2HFEB 2P46B 2PO6B 1RULL 3CCHB 3RTQC 4MAYD 4TUJA 1C08B 5D7JC 1KUMA 4MSWA 4U6HA 8CGTA 1F00I 3VXSA 4PJ5E 3HS0A 1TVHB 1X5JA 4CDGC 4PY7A 3TVMA 2IQAB 1E4JA 1FZJA 3FOMA 2DTML 5IMMB 2GI7A 3ZE2F 3KVQA 2OI9C 2P24B 2P8LA 3TWCL 2EZ0C 4Z76A 1NFDB 3ESVF 1CD1B 3HE7B 5ISZA 2WUBH 4PUBL 2DI9A 5M95B 3T2NH 3P4MA 4KTEH 4YBHA 3F7QA 1KPUB 1MFEL 4GAGH 4J1UB 3U7WL 3FFDA 4ZSOE 4HUWA 5LBSH 5L2KA 4N90D 2DIBA 5DFVC 5HJ3A 1GPOL 3C8DA 1K2DB 3GEWB 3P3YA 5J13B 2IPUK 3BDYH 3RNQB 4P2QD 5IIEB 3BZFB 4JDZB 5HHOA 1RFDH 1P5UA 1UACL 2EE9A 4CNIB 5ICZA 3JV5A 1OVZA 1KN4L 1JP5A 3MRRA 5IVOA 3REWB 5ANME 3SKNA 2J3SA 3RKDD 3CUPB 3SGKA 3O11B 1IBGL 5ANMA 5EC2B 5IB1A 3IFPB 3DX9B 5C8JB 1QFUH 3ARBC 3VXUD 3CDFA 4M6OL 2YN5A 4D4DA 1S5IL 4AIZA 3GSWB 4DJMA 1RHHA 5C0GB 1ZS8B 1EDQA 1I1FA 1I7TA 2R0KH 2C9AA 3FFCE 3L3IB 1GGBL 2X41A 3QUMA 5FGBA 3BQUC 4ZUVB 4K8RL 4GAYA 3AS2A 3BN3B 4U1JA 4UOW1 5DUBB 3NZ8B 2YEZA 4JRYA 1FO0H 1LK2B 1UGNA 3ULUH 5FF6B 3D48R 4LEOA 3DBXB 1C1EH 3HFML 2BMKA 4PLKC 3TO4C 4MNGB 4DUVA 5FM5M 3GK8L 3KLAB 1VFMA 3W0WD 1HH6B 3R1GH 4UILL 5I1JL 2A74A 3O0RL 1A3LL 3Q75B 5HYQB 4HUVA 1V3LA 3HRZA 5A2JH 2UVEA 1ZHLA 5BW7C 5JZ7C 1W72B 2ZSVB 1KIPB 3DMMB 1KCVH 4JM2F 4KQ3H 3I2CH 3C5ZA 3RJDA 3SJVB 1FPTH 5CJXC 3SDDA 4JHBA 1AP2A 1TLKA 5AZ2H 1QKZL 5CCKH 1D6EA 2DYPD 3CD4A 4PB9H 2FO1A 3NA9H 3L1OH 1MFCH 4ZFFB 1WFTA 3DJ9A 4X9IA 1SYVA 1QRNB 3MPCA 4I77H 4XRCA 5C0AB 2YPLA 4P9HL 3VG9B 4KWUA 3NIDF 4YBLC 4OLVH 2DQEH 2BVQB 4BH7A 1LEIA 1IAKA 2DDQH 4NPYA 4LSRH 1AKJA 2B0SL 1HYRC 1AHWA 3CXDL 4D3CL 3UO1L 4GRLC 4GRWH 3RFZC 5C70A 3DYOA 5JXED 3MRBB 3HE6A 3EAKA 4P5TC 2CGRL 4PG9B 4OZIB 1L0QA 4XP5H 1BFOB 3L3HB 4Y4FD 1JNLL 2D31B 3RWJA 3QDGE 4PP1D 4WHCA 5IMLB 1XGTA 3S97C 4L4TE 5F9JB 5I66A 1SJVA 1U8LA 3CVHL 4M8VA 3MZGB 5DVKA 4PPTA 3H0TB 5CMAB 1I75A 4U1SB 5T5NF 3VXNA 4IIQA 4ZUSB 1DQTA 5D2LE 2AK1L 3VJ6B 4NC2B 3OPZL 2DQDH 1NDGA 4X9BA 4GQ9L 3VFWB 1AXSB 2Y6SC 1A14H 4ZNCD 1IGTA 4XP1H 3SCMC 3SGEH 2DKSA 4TN9A 3PHQB 5EBMB 4Z0BL 4ZXBB 3F58H 5ALBL 5GRUL 3EJYC 5DRXA 3CVIH 4J4PA 5FYKD 3P77B 3SBWA 4FFYH 4HX1B 4X6CF 3SQBA 3T4AA 5J6GA 3BN9D 2A0LD 4P3AA 4RGNC 4EI5B 4PJ9B 4RFNC 3RWHA 1NGWA 3V4PH 5HGAA 2YBRB 1I9RH 4JPIA 2MTPA 3ELAT 1HNGA 4ONGH 4JVPA 1NC4A 2Q8BL 2NNAA 4C56B 4BM7A 3QPQC 3I6GB 3BE1L 2CIIA 4OGXL 1J8HD 2BCKA 1FNHA 1SMAA 3TO4D 4G43B 2X09A 5EPMA 3B5TA 2WQRA 4QRRE 2IWGA 1AGFA 4PJGF 2HG5B 1CGYA 1K3IA 2L7JA 1REIA 3L95A 3HA0A 5IMMA 4HCRA 1YECH 1SBBA 2FD6H 3GRWL 3OWEA 1FGNH 1AR1D 3O2DL 1CFTA 2ORBH 1CWVA 4DGVH 1DQLL 1TVBB 4MWFA 4RZCA 5M7QA 4IRSD 4M6NH 4LLDB 1V3KA 4HWUA 5IJKA 4MJID 4J3VA 4PJAF 4JM2D 3MJGX 3MX0A 2P5WE 5MENE 4CMMA 2HLAB 1HEZB 4GKOA 4TTGA 2P8MA 4K8RC 4MVBD 4ZFOA 4XCFL 3ALWA 5DS8A 4XH2A 1VFBB 4WO4A 3IJSA 3O3DA 4N0CD 4P23A 2GHWB 4D9QE 1XAUA 2XOTA 3SPVB 1T1WA 4IRJD 3VXOA 1R24B 4JFDD 4HUUA 1EFQA 3O4OC 2X89D 3MXVH 4CVZA 3WEXA 1M1SA 2ATPB 3O4LD 1AGBB 4JQIL 4H20H 4HKZB 3MXVL 1RHHB 3PXJA 5C0GA 4AL8H 2YC1B 2V2TB 1FNGA 2VLJD 3K3QA 1MEXL 3MZTA 2V3PA 4QXGH 1DEDA 3K4DA 4X7SL 4XCFH 1VFOA 1N94B 1Q9KA 1N95B 2VDNL 1NC2D 2OL3B 3MJ7B 4KAQH 1MREL 1Q9OA 5CP7B 1DE4B 2XTJD 1K8IB 3WDIA 5JDSB 4ZAKC 2VWEC 4IJ3B 2AXGA 1GAFL 4KK9D 1SA4B 1CICD 4XCNA 1QA9B 1DQLH 2MCPH 3TPUA 2VDMH 4WGVB 1ZKAA 3BDBA 3UZVB 5EBWA 4XNYL 3V7MA 1ZT1B 1D5BB 3HQBA 1TNZB 4A2LA 3GRWH 2AS5M 1L9NA 1YJDL 3CPLA 3V5HB 1I3GL 4KZEH 3C08L 3GJFA 4H25A 4I9WE 5GGTL 4WHYG 3HMXA 1HYSC 1KJ2A 3DSXB 3CVHB 5KG9B 1N6QH 5D7IA 2FEEI 4X6DA 1J12A 4FXKA 3C09B 4U1HB 4CVXB 7FABH 2DQTL 1NAKH 4YFEA 3QEQA 3EZ8A 1ZSDA 3MV11 4ODSH 4XNZB 4JFQB 4NN6C 5C0JB 3TCLA 1AGDA 3W9DB 2O61A 1G9EA 1YPZF 3QEQE 2A0LC 4V1RA 5ESAA 3G5VA 1LEIB 5F3BB 5FO7B 5I6XB 4WFEE 4WVRA 3FMGH 5SWZE 1S9YA 3ARQA 3HNVH 1I1AB 2CUMA 2JELL 4LCYB 4GG8A 1OAUH 2DI7A 3MO1A 5CIPA 3QBTB 4M93C 4MXWH 1D5MB 1F6LL 1NBVL 3VFGL 2EYRB 1A1NB 1CFQA 5D8JH 4C54A 2APBA 2GY7B 3S9DB 3ALPA 1IM9A 3H0TA 1JBJA 2BNUA 2OM5A 2EDDA 4ZO7A 3ZKNC 1HSAB 3TO4A 4YHYB 1INDL 4FMFA 4JDTL 4KV5F 5F7FA 4HF5L 4R96B 4HIHB 1B4RA 3LOWA 3VMPA 1AO7D 1X5LA 3JTTB 2Y07H 5DRXB 1N4PB 4AENA 1U2HA 2P42B 1A7NL 3FQTB 2D7MA 4WFFE 3UYRL 5E00A 4ONFH 3QCVL 4NRYA 3S88H 1GIGH 5IBLC 4F3FA 1X5KA 1BEYH 4R2GD 5IM7B 3RWHB 4FG6C 2W0KA 1LP9B 2IQ9H 4P2QB 1JGVH 1RIHH 4J3SA 4JFYA 1TIUA 3PHSA 4I77L 2CQVA 4Y4KD 1CL7L 1ZA6B 1I1AC 2EYTB 1AHWC 4P2RD 4QYOA 3WNOA 1D9KA 1LEGB 3HLAB 4OCWL 3KNBB 3V79C 1VB9A 3QRGL 2WWMD 3O8XC 1Q9WB 2UUDK 5EULV 3RY6C 1BQHG 1LE9B 3RX8A 5KSAD 1E4KA 3P9WB 3MSPA 5DVOA 3MV01 3DVGA 4NZJA 5MERB 5D9SA 2CK0L 3G6AA 3PE9A 1I3RA 3UTPE 2VKXA 1IFHL 1I1RA 5EU5A 2HFFB 3V9FA 4F7CA 2HTLD 4LCCC 2ADGB 2IPKB 5F9OH 1I3GH 4KZEL 5C07B 4D0DB 1XGUB 2OZ4A 5I1JH 5T3ZE 3HZYA 3JUZA 4MA1C 1TVBA 4OT1L 4DQOH 5KVEL 4QOKD 1RZKL 4MAYB 5IW6A 3HR5A 1EBAA 1CI5A 3MUY1 4XMPL 2ITDA 3O45A 4FQJH 3DECA 1V7NL 3BJLA 3GMNB 3FAWA 2HLAA 5DK2B 1LD9B 5HI5C 3UPAA 1AR2A 4D4BA 4HAFA 5I1GH 3KWWB 1LO3L 1QD0A 1TN8B 5F7DB 1CU4H 4UT9L 1BECA 2CH8A 2QSVA 1OPGH 1GSMA 1WT5A 3B6SA 3NFSH 4JLRA 2Y25A 5C0DA 4HQQH 1OLLA 1K8DB 1UKTA 3Q6FA 2DWEB 2H26A 3X17A 3HC0A 4MJ2A 4WV1A 5JIIA 4N9GB 5I15H 4JQIH 2VC2H 1WGOA 5EN2B 3HC3H 4GTQB 1BIHA 5IBUG 5GS1A 5D1QC 2OZ4L 1DUZB 4M1CD 3CH1B 5SWSE 1P4IH 1U8JA 4JREC 5KW9H 1BD2D 3JTSB 1TJGH 5JA9A 3RDTA 3RVXD 3MJ7A 1OB1A 2OL3A 4JHWH 4NJ9H 1MY7A 4MA3B 3RZCC 3RHWF 2A73B 3UBXA 4KJYB 1INQB 3QEQD 3S3SA 1BM3L 3GI9H 4PFEA 3EO0A 2DKMA 1XF1A 5DJ0B 2R0ZH 2P7TA 4PRPE 5DTFB 2WUBL 4RBPH 1QA9A 4X4YB 5CBEB 2D7NA 5HBBA 5KANI 1G84A 1HQ4A 4GKZB 4N8PA 4OCYL 3RAJH 2ILLA 2IBBA 3UDWC 4OCXL 1GOGA 1HKLL 1KIRA 1OM3H 2XV6B 2CDEB 4E41E 2B1HL 4QXTB 5GGRY 4R90L 5JO5A 3W39B 3GJFB 4WTWA 3LEVH 1Z3GH 2ED9A 4N1EA 2VDOH 3Q2CA 4D0CA 1S7UB 2HTKC 3TNMA 5T3ZD 1JUFA 3RY5A 3R0MA 2ICCA 3H7BA 5MP6H 4LSQH 5EU4A 5JQ6L 4HZLB 1BP3B 1P6AB 3DLQR 5AYQA 3PZ4B 4JKWA 4JFQA 1N4SB 3L9RB 4BSWA 3T1FB 3DSVB 4P4RB 1S9VB 1EJ6A 4ONGL 4DZBA 1XF2B 5T1MA 4EN3B 2AJ3A 1D5IH 5D5MF 5C92A 1YMHA 2MOVA 1X5GA 4P57A 4YFLF 4R2GC 5EU7C 2F74B 3MLXH 3S4SG 3QNXA 5E0QA 4O4YH 1CTOA 1QG3A 1NBYA 1D6VL 2R2HB 2JB5L 5IEKB 1IKFL 3BEWA 4PIRF 1W8OA 3HRPA 4JPKL 1KCUH 5B22A 4PY8I 5J8OA 1PQZB 3MLRL 2VDKH 3KYNB 5F1IB 3RVVC 2JIXB 3DRTA 2I9TB 3STLB 5C0BD 3BPOB 3EYUH 1V7MH 4F33B 3U9PL 1IEAB 1KFAH 3R0NA 4G8FA 5D71H 2NR6D 1T6VN 4DN3H 3P9LA 4FTVE 3F7PC 1XIWC 1XGPA 2FX8H 3BPNB 3QA3B 3I50H 3MFFA 3O3AA 5GJSH 5DWUL 1IGCH 1RVFL 3JTTA 1JZ3A 5F1OB 4PJIB 1RUMH 5HY9A 1BX2A 1F4WH 3CNKA 1FVEA 4RGMB 2OR9L 5IVXA 4I3RL 1N6UA 5GGTA 3B5HA 1RJCA 5EU6B 4F3FB 2HVJA 2ZUXA 4HKJB 4OD1H 1G7JB 4R4FL 3MQIA 2DQUH 3OG4B 5AD0A 5E94B 2BSRA 3AXLA 5CZKA 1KEMH 3QO1A 4JPVH 1ZEAL 5T3XL 1PX3A 2Q8AH 3PNWA 4V2BA 4YZFF 3MA9H 3QB7C 1DVFD 3PGFL 2VKWA 4IJ3C 2DQJH 4H26A 3NA9L 4OTXH 5ACZA 5AZ2L 5CCKL 1IC5L 3KPRD 4LLMB 5I8EA 3DVGB 1OSZA 4U6XA 5F89A 4Y16C 1N59B 2VOTA 2AJXH 3QDME 4F7CB 1FG2B 3VCLB 2GITB 5EFIB 2XI9A 3EOAB 4I6OA 4L1HA 1XGUA 2XACC 3LQAL 3MRQB 5DHXB 4DUXA 5HI4C 3IDUA 1CL7H 1BD2A 1UEYA 4AT6A 4FTVD 3SDCD 4PGCA 4FFZH 5I75C 2NZIA 4QRPE 4QXWA 4G3YL 4G9FE 4KKBD 2H1PH 1ZLUH 4PJ5A 3BKYH 1GIGL 4J2XA 3KPOB 1SQ2N 3LKOB 3UJJL 4X5WB 5ICXA 1JPFB 2EE2A 3DTXB 3JUYA 3ZHDA 4QHNB 2WINB 5DRZB 4PV8B 2GJ6B 4KK6C 4OLUL 5IK3B 3ARFB 4MDIA 1OW0A 1KPVB 1S7XB 5E1AA 3MV7D 1U58A 2D03H 1BMGA 1BZ7A 2GYSA 1T03H 1WJ3A 2XTJE 5T5FH 3FB5B 4FQQA 3RWEA 3QEHB 4OZIE 3OR7B 3D18B 1QO3B 2VR9A 3S3JA 3BD5A 3PQYE 1TFHA 4QHMB 4HK3N 2E3VA 3N1PC 1NSNL 1SJXA 4YHLL 3LD8B 3HUJB 1KN4H 3C5JA 3OR6A 1V5JA 3RDTB 4C4KO 4ETQA 3HB3D 3N85H 3QI9D 1KTDB 4X99A 1DANT 2B4CL 4P5TB 1Q8MA 4Q0XH 4OZFG 4CN1A 5HYSA 4NO0A 3UBXB 1LEKB 4MQXD 3MFGB 5D1XA 1U8MA 1MHPL 3S37L 4XTRC 2VZ3A 4HS6B 4FABL 2AJZB 1OD7A 4Z8FL 5E2UL 3TP4A 1PZ5B 1Z0MA 5D2NE 3TIEA 2NY1B 4LCWA 3QUKB 2VJXA 3RWIA 2IG2L 3EOBA 4YBLB 2W65A 2F5BL 3RVVD 3F7RA 3FQXA 4BK4A 1UKSA 1G7QA 3ET9F 4KK8C 3NCYP 2IBZX 3ZDXF 4LPUA 1BQLH 1FJ1A 3V2AR 2VR5A 1F6AB 2QQKH 2PW2B 3HE7C 2WBKA 5F7NC 1FFRA 4OUUB 4IOSD 3SDXA 1N6QL 3UJIH 1VPOH 3TNMB 4LDLB 5CIPH 2A1WH 1UYWL 2YSSB 3RIFF 4XP4H 1R0AH 2R8SL 1ZT4A 3CZFB 5DJXA 5KS9A 2VLKD 3F12A 2QADB 1CE1H 2BJMH 5FYKL 2BVPA 4ZFGH 2EDFA 4NQVA 1U2CA 1EAPB 1R5VA 2IGFH 1KTLB 4JZJC 4FNLH 1LE5B 1B6DA 3L3JA 3MV7B 1UH2A 4F57H 4L1DA 4KMQA 3NTCL 2F74A 2ZCKH 5ISZD 2X4RA 4UQ2A 1GAFH 1E6JL 3VA6A 1MJUL 4YE4L 3S35H 2R2HA 1X7QA 5TFSH 3FT4B 5HHMB 4DFIA 4M7JH 4M48L 2VXSH 5JPNB 5EUOA 1C5CH 3ARTA 5ETUA 3VGEA 5I1AA 5JR1H 2AQ1A 2RAMA 1N8ZA 1INEL 5F1IA 1F4HA 4QRPD 2BY3A 1I9IL 4D9QD 1FZKA 5ISZB 4MNQB 1DLFH 3ZL4H 3MNVB 3X3GH 3JWDL 3V5DB 5L2KB 5F8QC 3GSXB 5L7XH 1O6RA 2BRRH 4TVPL 3MGOA 3ILQD 2CPCA 1FFQA 2BVUA 3L3KA 4YDEB 4PR5A 4PG2A 4HMDA 2VLKB 4C56E 4IOIB 3OAZH 2C3XA 3EYVB 3MRHA 4W68A 2Q86A 2VLRB 3FT2A 4RIRA 4F37F 3DROB 4ZOBA 3UTPD 1LILA 3SEPA 2DD8H 5IJVB 5IEHB 1CGXA 1H3XA 4MA7L 3PIQA 4YQXH 1KLUA 1L0XA 3CUPA 4WB3A 5DJ8A 2HVJB 4WWKD 4NM4L 1B9ZA 2ICWB 2GK0B 2BNRA 4ZUUB 4AIZB 1EA9C 4PJCB 2R1XB 4YHIB 1G0XA 3QUZA 3WXVL 4MAUH 1EO7A 4U6VH 4IRSA 5DUML 1MQKL 4AEFA 1U3ZA 2AJVH 4Z0XB 4NBYB 4OZ4A 3PHOB 1CXKA 4MJIA 4AMKH 1ZT7A 4K3HA 4MQ7B 1IAII 2DMKA 4PTTB 3ULVE 5JXEC 4GLRI 4U0RC 5INDA 1VSCA 1KB9K 1L0YA 2J4WL 4TULL 4BELD 4KKCC 5TPWL 4YX2L 4Z7WF 3QUML 4O2FA 2XFXB 4P23D 5IGXL 4L8CA 1NGZB 4WHYH 1A7OL 4FXGA 1FG2A 2FZ3A 3FKUS 3G04B 4EUPG 5I75B 4MYWB 3EJYD 5DJ2A 5IW1B 1ORQB 5GS0D 5K9OA 5KBNC 3HRZB 3VI3F 1KCSH 1ZVSA 3IDXL 4MXQD 5F93C 3B3IA 1HK6A 1HKFA 2AJUL 5F7LB 5HHVL 3TO2B 1KGCD 4JKPL 2W9EL 2D7QA 1OTSD 3G6JE 1EZVY 1SM3L 3ARFD 1AI1L 2GJ6D 4Q74A 1H36A 4IMKC 2VXVL 2ARWA 4XPAL 1AY1H 1RI8A 5I19L 5I1IL 1FZMB 3RQ3A 3BN9C 1QRNA 1KPVA 3HNSL 4PRIA 2I5YH 3WKML 2YMXH 4LVNC 4DVBB 3VWJC 3U4AA 2LV4A 3LKRA 3P4NB 3OPZH 3JWOL 4XVJL 1VGKB 4X98B 2XWBB 1XZ0A 1AHWB 3QQNA 5EC1A 2XRAH 3V0VB 3HZMA 4QEGA 2RJMA 5IV2A 2W38A 1A5FH 4RFOH 3ARSA 3CLFH 4YIQA 3VD9A 3FFCA 4PJCF 1C8PA 3FB8A 1PVHA 4RAVB 4DKAA 3CFCH 4XXDA 4P5TA 3R8QA 4XP5L 1XGTB 3EYSL 3MUZ1 5F9JA 5I66B 2QV2A 1AE6H 1RU9L 1Y18B 5D93C 1J86A 5IQ7L 1IGFH 1LO4H 1E4WL 2YUZA 2WY7A 4N68A 1DUYB 2J7LA 2FB4L 2D0HA 1TETH 1NDGB 1PKQE 5HD8D 4OZGB 1RAMA 4OV5A 2Z93A 1X6LA 4I0PD 4QF1B 1E28A 5GGVL 4NZTL 1S5HA 3D6GA 3IFNH 5JIHA 1KSRA 5J1AB 3SKOA 4HCRH 4YDJB 4RGND 4LSDA 4QRUB 5H8DA 4QHUA 1KPRA 1RUKL 5C2BH 3E6FB 4NC1E 1F3JB 3HCVB 1MIEL 3BP4B 3C5ZC 5I76A 4EI5A 1KJ3H 1FPTL 4PJ8A 4H5SA 3OV6A 2P48B 4WUKL 4OQTL 4NQCD 5FGRA 2LAGB 2QSQA 4JR9L 4NQVB 3B2VL 4JDVA 1WZ1H 3Q0HA 5EORL 1J1XH 1KTLA 4Z7UA 3KG5A 3MGTA 3FFDB 1TENA 3R1GL 1C5AA 3QNYA 1GC1H 1YMMB 4NM8H 1BWMA 3WN5C 3DETD 3PWPB 4WW2A 3IU4H 2BCKB 1AQDB 1K2DA 3O4LE 2CDFA 4DN4H 4G43A 5JMRA 2IFFL 1C1EL 4HXAL 3TZVA 4JVWA 1FNAA 4RMRA 3KPMA 5CZVH 3VXRE 4D9RE 2G5BB 1JIBA 2ADIA 2DLIA 4FQIH 5DUPL 2PNDA 3N50A 4AEIL 1YDPA 1AGFB 3PF2A 2YD9A 2PN5A 3L95B 4JPWH 3MBEC 4JFZH 4EBQL 2UZXB 2R69L 5ACLA 4KY1H 1OP3H 5KZCD 1D5ZA 4PJHB 2Z0BA 2BZDA 2R1YA 4NKOB 2GTWA 3BDXA 2VQUA 5E8DL 5EZIL 5LAXB 1NBZB 1DBAL 3TYFA 2R69H 5BRZE 3MGOB 1JN6A 3D5RA 4P0DA 1U0QA 3QUMB 4MCZA 3QHZH 5FUZH 1ZLWK 1N3NA 4U1JB 4MNQD 4NNPL 1HHJA 1LK2A 5B39G 2WUCH 3IFLH 1V8HA 3EGSB 1Q0XH 2CIKB 1VENA 5IEHA 2G75A 4P2OB 2YA2A 3GSQA 3U9UA 1CFBA 4YZFE 3VMOA 5BW7A 2AJSL 4IRSC 3WFHA 4TSCL 4LAQH 5D7SH 4YR6A 2G60H 1UB6B 4L8DA 2D4DA 1S7QB 4XCYA 2EDKA 4LF3B 3BPLC 5EZLA 1AD0A 4CADB 4NSKA 4GTPB 3KS0J 2P1YA 4ZAKA 4ZFZB 1KIPA 2V9QA 4NZUH 1QP1A 3TBSB 3NIGF 1FORH 5C08A 4JR9H 4ODHL 3ULUE 5F8RC 3I02B 4HAGA 3MLZH 4KU1A 1K8IA 1AGEA 4M7ZB 5E56A 1U3HA 4HV8A 1IEBB 3D25A 1HWGB 3TPKA 4L4TA 4LAQL 5D7SL 2AXGB 3QDGA 3JBG7 2X9XA 4L8CB 3PP3H 4R4BA 2IANB 5F7UA 1YZZA 4MAYC 3N06B 4A6YH 4Y89A 1IAKB 1T5XB 1G9NC 3SDYL 1RHFA 2ZKHH 1MAJA 3X3GL 2D7PA 1QBLL 5B4PB 4HH8A 3QSKB 5EIIA 1DLFL 2I9LB 3VXSD 1H3CA 1NEUA 1JF5A 4M61B 4NQUA 2ZSWA 3DUUB 1OGAA 1BQUA 3UEZA 1N5YH 4FXKB 2AJYH 4I5BA 1I1AD 1VA9A 4M7LT 1CGUA 2HT3C 2EH8L 3VFTB 5TE4L 1ZAGA 1FZMA 3UTSB 1YNTA 2DB8A 3TN0B 3CLFL 3HAEH 2J8UF 4IIQB 3LRSB 1KC5L 4NUJB 1FLTX 3C9NA 3VXMD 1A6UL 1I8IB 2O61B 3D0VA 1MIML 3BEVB 4PJ7E 3JV0A 1T1YB 5L6YL 1QBAA 3QUXC 4KQ4H 4HJGA 1G7MB 3DSFL 3NA4A 4JZOA 2DLTA 5T1LD 5DR5L 3PUCA 4XVJH 4H1LH 2XY1A 1XF3B 1F97A 2VLRE 3DSFH 1XF4B 3CJJA 3NIFE 3WKMH 2UZYB 1J1XL 1IVLA 3ZTNL 1AFVL 3RKDC 2M2DA 3B2VH 4HX1A 4HULB 1FSKB 2ADFH 2VXVH 4LQ1A 2Z92A 4KGJA 1EUTA 1EK3A 3SHSA 3MRGA 1EH9A 4UIMB 3TYGH 3EDFA 2FJHA 3LIZH 2PTTA 3DHJA 4NRZA 3HR6A 1HHHB 1W0VB 3KSQB 3OXRA 3PL6A 3UTTE 4WU7A 1FZOA 4QF1A 3O6KL 4R96A 1XR8A 5GGVH 2E7CA 3V6ZB 2UY6A 4HH9B 5ESQA 3CFIC 1NAML 4K2UL 3FQTA 1T1XB 3QEGL 4PRHD 4NNXB 2OQJB 3GHEH 5J3HC 1M05B 3NGBB 3BIAX 3BP4A 5J1SC 1DBKH 3L5WA 3FZUD 3QQ9C 4TULH 1UC6A 1R5WB 1J05A 5K9QG 1QR4A 1HWHB 4OCLC 3ETBF 1CFTB 4Q6IA 4WW2C 1TQCB 3KPRB 4U3CA 1MPAL 2NXZD 3G6JF 2X1XR 3NCCB 1IAMA 4Y4FC 4Z7OE 3G9AB 4RFOL 4U3HA 5T1LB 1DVFB 1HXMA 1M7XA 5J11C 2HA1A 3VXTB 4XNZC 2LU3A 4LP4A 4G5ZH 1AQDA 2NY5H 2Z8WC 2ESVE 2BFVH 1YY8A 1T7WA 1YUHB 4HIIB 4YHPA 1KJSA 4Z6AT 2VLLB 2HKFL 1JZ4A 4NO5A 3E34B 1I7ZA 2KBGA 3VD7A 2X4PB 4HG4J 4DOHB 3FCTB 2CRMA 2IPTL 4BFIB 4UMGA 1IL1A 3RWCB 1AY1L 1JHTB 4NOFA 4ZPTA 4RISL 4LSUH 3RUGB 2V2XB 3C87A 4LCCA 1O1RB 4F2MB 3OAYK 4N90E 2W07A 3QHZL 4F9PC 3HPLA 4KRPC 3FQNB 5BXFA 3B83A 2R0LH 2W9EH 4JKPH 5LAXA 4EDWL 5JLZB 4KJWC 4R9HA 3HE6D 1EUUA 4NKQB 5E8DH 2NY3C 3PABB 4NQCA 2YPLE 3M17B 4QRRD 5C7XH 3WS3A 2BVEA 4HK0B 4D2NA 4K7FB 2YD8A 1H3UA 2NY6C 4XXCA 3LMJH 2XN9E 4RAUA 3PWVA 5CUSH 3UJTL 1PBYA 2MMXA 1MSPA 4KI5C 2RQ8A 4PRBA 5DT1L 3N1GC 2DQHL 4IRJC 1NMCC 3SO3C 1GYAA 1IC5H 5HYJE 1JGEA 2VAAB 5TFSL 3NAAH 5IROC 1Y6KR 3TPUB 3K2UH 4OZGE 2M8XA 5EBWB 1J18A 2GQHA 1NFIA 3RVWC 3ARGA 4LHUD 3VFRB 2GCYB 4PJXB 4NSKB 3WFDL 4ENEC 35C8H 4KVCL 2HRPH 2O5YL 4NFDA 4JPVL 1CICB 2VLME 4NM8L 4WIQA 3KYMB 1RY7B 1NCAL 3JZ7A 3GZKA 5DHVA 2SEBB 1FVCB 4R8WL 1QR1A 5KG9A 5F1NA 3DSNA 9CGTA 1A7PH 2E9JA 1IEBA 3D25B 5GS0L 2BNRE 1FT2B 4KH2A 3LB6D 5IFAL 5I0DA 5L8LB 2I27N 2RCSL 3T0XA 3ARED 2GJ6E 1DDHB 1OTTD 5FGBC 2F8XC 1NGQL 1OTSC 2XA8L 2ZG2A 5B39B 1QQFA 3GSVA 1MIEH 5I17B 3TCLB 3NN8B 1HQ4B 2FATL 1NPUA 5EO0B 1NDMB 2FX8L 5HI3C 2VABA 3QULA 5FK9A 1WVZA 3VWKC 3OGCB 2Y5TB 3IFNL 2OJZL 3IDYB 1NCNA 2IG2H 4G6ML 5FCUH 5L7XL 5SWSA 3EO1B 3PQYB 2DOCA 4JFDB 2PYFA 4DKDC 1S78C 3QQ4A 4JFXA 1QSFD 4Q0XL 3HXDB 4F80A 4N0RA 5FYLH 4HS8L 2X6MA 1JGUL 4DKEH 2AEPL 3DUHA 5DJCB 3AB0B 4KUZH 4L5FL 3TC9A 1RMFH 1JPSL 4CU6A 2R4RH 4XNMA 2XKNB 2FBJH 4M48H 5AG8A 5I1EL 4M6AA 2JKXA 3S35L 3LEYL 1YMMD 2PR4L 4BZ2H 1A1OB 3AVEA 3HG1E 1WBXA 5GGQL 2XRAL 3SJVE 5MEOB 5K59F 4PJBB 2LAAA 2Q76A 3SJVD 2VQ1A 3JWOH 4N8CL 1ZLVH 4I0CC 4HGMA 5I6XC 1T04A 3HMXH 4QLRA 4ZFGL 1ZLVK 3IF1A 1Q38A 3TVMC 3KYNA 3WJJC 1HHKB 1YEFH 3C2AH 2ENYA 4AEHL 1IEAA 3UJIL 2V5MA 2YHGA 2V7NA 4R90H 4XC1H 4HC1A 3MRMA 2PTTB 1AI1H 3QJFA 1YNKH 1JF1B 2YD1A 3KQ4A 1RUPL 4OM0H 3WLBA 4OCXH 1EV2E 5DJZA 1X5YA 4JO1L 3CFDB 3MFFB 4LASL 1VGEH 2AK4E 1TNNA 4BUGA 3RZCA 4C58B 1XIWA 3DX7A 2V5YA 2R4SL 3GM8A 1UM5L 2YA0A 2AV1A 5LGKA 4KKIA 5DFTA 4NDMB 1FL5A 4G7YH 4KGLA 4S2SA 5D9SB 1M05A 2GAZB 5E8OB 3WFEH 2YRZA 2NW2A 4U7SA 4Z18A 1WCQA 4M43H 4JHWL 4YX2H 1MI5A 2VXQL 2FHCA 1BJ8A 4OD2A 5JNYB 3QI9C 3O6MH 5ISZE 1MWAA 4B41A 3KLDA 3PV7A 3PNWB 4HUKB 5DD6B 2HFGH 4FS0A 3VD3A 3C5SB 4M02A 5EOTB 3HXEB 1DP0A 5F9AC 5I1LA 2CDGA 3ULSA 1FBIL 4E5XA 4OD1L 3NACL 1OPGL 4K9EL 2WP3O 2H6IB 4Y5VC 2FX9H 4Y4FB 1BZ9B 3L7EB 4R2GB 4B53A 4PLOB 4U0QB 5E24E 1Q94B 3IKCA 4X7TB 3QG6B 4XBPB 3OX8B 1KT2B 5CILL 5ENWA 4PJAE 4ZPTB 4X5XB 1LO2H 4PJFB 5J4MA 3GO1L 5I8OH 3FO1A 5ESVA 4TOYH 1N4XL 3IS1X 5FKPA 4KMLB 2BRRL 3H3PL 4TVPH 1J0HA 2BHZA 5C0AD 4BZ1L 5C9KA 5D71L 4J3OC 1LDSA 2ZP0T 5EU7E 5CKAA 4A2MA 1X5IA 1EIBA 4XBGA 4QRRB 2XWJB 2E6PA 2IJ0C 4KROB 4RGOL 4DVRH 1H5BC 2J88L 3VGGA 5DJYB 2A73A 1IFHH 4HK0A 5IHUL 4LLYA 4JPKH 3MV9A 2E7LA 5TJWK 3MR9B 3O8XB 2AJXL 3SE8L 1D5XB 1B4JH 3L5XH 4Y2OA 4WI6A 3GSRB 1R3JA 4N0UE 3BUYA 4HLZG 5J6HB 2R56H 2XN9A 5E2WH 5LXGL 4F9LC 1FRGL 3T0EA 1OWRM 2BHUA 4J4PC 4LCWD 5IQ9A 4QXTA 3W81A 1FAIL 3H9SD 4HJJH 4JJ5B 3E0GA 3HUJA 4RQQB 5HXMA 5EUKA 1JGVL 1RIHL 5DHVB 3ZYJA 4KI5E 3JV6A 3G6JB 4WWKB 2FH8A 3HZKB 4D0CB 1HHGA 5T3XE 1U8MB 4LEXH 4ONFL 1ODAA 4JZNA 5GHWH 5C09E 4S1DD 2IAND 3LEVL 1DDHA 4BFGA 2OR9H 4KMTL 2CUHA 2LVCA 2OYPA 1JVKA 2VE6A 1T20A 3GSOA 2AK4D 4MXVF 3VXUB 3BGAA 4MSWB 1BAFL 3VGHA 4W81A 5IEKA 3QIBC 5I73C 4W4OA 5L2JA 4GXVL 1KJVB 3RGVB 4ZOEA 3EYUL 5IW3A 3REVA 5IB3A 1O1SB 1AXTH 4IDJL 5KS9B 3ULVD 5E2UH 2AW2A 4CVWA 1QEWB 1DBJH 1YNLL 4MA1B 3MJ9A 4F33A 4PJDF 2JELH 4J1UA 3FQRB 2OJEB 4G8FB 4YC2B 2XKNA 4XMLH 5DO2C 4YHLH 1T66C 1D6VH 1KJMA 3C6LA 1IGYA 4NHUA 1WBXB 1YEKL 3GIVA 1EBPA 4CJ1A 1GGUA 1A9BA 1X7QB 3IU3B 5HHOB 3D39E 4OFYD 3D3VD 4HQQL 4LSTL 4MGXA 1K85A 4GTMB 1G7LB 5E6IA 5C3LD 1ITCA 2CLRA 2J8UB 4ZDHA 3MMEB 2NY7L 4MNHB 1CFSB 4UT9H 4RMQA 2DBJA 5EC2A 4K7PY 5F71A 1CDCA 1OF2A 5LCVL 1QYGL 4PBVC 3WXWL 2A6JB 12E8L 2VDOL 5IOPB 4PJXE 2Q7YB 3RWGA 3IVKA 5FO8B 5GHWL 1T0MA 2PYEA 3WHE0 1VFAB 3UJJH 5HSFA 2D9CA 3U4BL 1EEQA 4LSPH 3HG1A 2NCMA 3L6FA 3A6BH 4ZUVA 4FFZL 3SGDH 2MCPL 2VLRA 2Q86B 2Z8RA 4K9EC 1FNEA 5HGBB 4FHBD 1IAOA 2EDRA 1SJHB 3ME0A 1RIUH 3MACH 5I8EB 4NDMA 4ALAL 3LPWA 3NFPB 2R0ZL 1GOFA 5T3XD 1SYSA 3L5XL 3RTQD 4JO2H 3VCLA 1O5MB 2GK0A 3M1BB 3SE8H 4RA3A 1MRCH 3MRLA 3ZDXE 2FL5B 3MRQA 5DYOA 1HQRB 5E5UB 2ZCLL 3WKNA 4M9OA 1YEDB 4P4KB 2MNUA 4LAJH 1OP5K 1K5NB 5CWSB 3V4UH 5SX5K 2E7MA 1A6WH 1AC0A 2VZTA 1U91A 2Q8AL 1DVFC 5DMYA 3OHXB 3KYAA 4M6ML 4HXBL 3UYPA 3LV3A 4ZSOA 4LGPB 5JW4M 5KSUA 1KEML 1FCGA 2JCCB 2GJ6A 4YO0B 3QZWA 5H35B 3GMLB 3L7EA 4QGTA 3ARFA 5J9PA 4OLZH 5L9DH 4PJ9D 3G04A 1KIQA 3VXQA 4QTIH 3V4VH 4HD9A 1W6KA 2KQMA 1ZA3B 3A67H 3RU8L 1ORQA 3FONB 1SEBB 4HF5H 1RUML 1QRNE 3CSPA 4DZ8A 5KTEH 1BJMA 2V8JA 5C0AE 1INDH 1QO3A 1U3JA 3FO1B 2ARJA 4UT6H 4PGZA 3EYQC 3MRBA 1V7NH 2NX5D 4X4XB 1XCTB 1I9JH 1MRFH 1JF6A 4BK5A 2C3VB 2DQGH 2F54A 5D8JL 3VFVA 3H3KA 3O6ML 2AKRA 4PB0L 2X42A 5GIRB 3C5ZD 2VXQH 3MLRH 5CMAA 1PZ5A 5GS0C 3LSOA 1WV7T 4ZOCA 4FZEH 2X4NB 5L88H 4HT1L 4YHZH 3LKRB 4IS6A 4F15B 2VH5H 3VFWA 2BK8A 5GZOD 1M4KA 2DYPA 1NFKA 4E0RB 2J6EA 2FWOB 1NUDA 4XMKH 1DLHA 5FGCB 3FQXB 5JOPE 4PRDA 4TQEH 5ID1B 5EBMA 1TPXB 4OGZA 4ZXBA 3O3UN 2ITCB 2C4FU 1FJ1B 3MV9E 3P77A 1MFBL 1JNNL 5J6GB 5LWYH 1CBVH 4PP1C 1FE8H 1HHGB 5HI3D 4OI9A 1CDBA 2HTLC 1NCTA 5MP6L 2P5WB 3OQ3B 5MENB 3QXAB 1B0RA 1A6AA 2MQ3A 2HKHH 1QSEE 3V8OA 5F70A 4PB0H 4APQB 5E99L 4U2YA 3C8HA 1YEGH 1VCAA 3VXUA 1WICA 1KJ2H 4MMZC 3BW9A 3VXRA 4Y4HB 4Y19B 2R2BB 3QFJE 5GGRA 5DQ9B 4NKIH 4LVHB 4NKDA 2Q6WB 3L5IA 1KJVA 4Q9QL 3QIWD 2KQNA 4HBQA 25C8L 1MREH 4PP2A 4I0PB 1RZGA 1N8ZB 3MNWA 1BM3H 2CGRH 1JGUH 3FHQA 1J0YA 2BP3A 3D1MC 1U95A 1I85C 3MRPB 4LRNH 2OJEA 4GBXD 3CXDH 4D3CH 4DUWA 1MJJA 4QRSA 3UMTA 1TJGL 5CKGA 1ZHNA 3VFPB 3CCHA 2VLRD 1U41A 4LSRL 1KV3A 3CXHK 3HNVL 1L7TL 4YDVA 4HXBH 1RIVL 4DFHA 5KANG 3R06B 1A6VL 1Y6MR 4ELMF 5C9JA 2APXA 2OS7A 3GMQB 1UCBH 1RURH 2X4TB 4G8GA 2B2XL 5D7LA 5E6IB 2ICEA 1UADC 4PRHA 3IJHA 3NFSL 3VGAC 5K59E 1J1PH 4L4VE 2A83B 4D8PB 4Z76B 1ZVYA 2CO6B 1NAKL 5FDYA 2ICWA 1CU4L 1NI1B 4GW1A 3P0GB 5I1GL 4O51B 3QUZB 3U6RA 2NW3B 5DDHA 2ATKB 2H3NB 2DMBA 1A7PL 2EIBA 4ONHA 4YJZL 3O4LA 1FNGB 3AUVA 5GGTH 3S5LA 2PUQT 4AG4L 3VDCA 3VXSE 3DSUB 1C5DB 3FO0H 2VL4A 2F19H 4DK6A 3ZYOA 3MCKA 2PXYC 4YLQT 2QHRH 4DGVL 4YNYA 4LBEB 3Q1SL 2VLJA 4CN6A 3C60D 5HGBA 2VAJA 3B2UC 3SGJA 2BX5A 3QUYA 4E41B 4IOFD 4KVNH 5ANMB 3CX2A 5TE7H 1CT8A 3GB7B 2IBGA 2VSCA 4POZC 5H37H 1QYGH 1LQSR 5D2NA 4OCNC 5DT1H 2FL5A 4IRJA 4XAKD 1QLRB 4PGDB 4XPHH 1ZGLM 1HQRA 3T65B 4D4CA 3GI8L 3SGKC 2Q8BH 2DBLH 5B3JE 1MEXH 3BH8A 4R3SB 3RVUD 1VKXA 4ISVB 1JRHH 1SMOA 1ZHKB 2DWDB 5D7LE 1YEKH 2VISB 3KYOB 4U1HA 4LEOB 5CJOL 3INUL 2IQ9L 3KPQA 3WS6A 4J6RL 1KNOB 1ZSDB 3RP1A 2P44B 1E6OL 1KZOB 4LSUL 3SFXB 1BOGA 1E4XI 3W9DA 4Z9KB 4Z0BH 5EO1B 1N9AB 3P4NA 3VFMB 1A14L 1U8KA 1J0ZA 1EGJA 1PLGL 4XB8A 3U7WH 1JI1A 3MRNB 1KB5H 4GMSL 5BRZB 1UEMA 3S6CA 2VDLL 4Q9QH 4LSVL 5HPOA 1ZTXH 4ZYKB 2Y4SA 3TWCH 3H6JA 4YHYC 5IHZB 5JXAH 3HQAA 1A1NA 2EDYA 4MB3A 3ULUF 3T3ME 1MNUL 1S9WB 4XXDB 1UG9A 1O79A 4S10A 3O2DH 3ZE1F 1WTGT 5ALCH 5FCSH 1BD2E 4XRCB 4H8WC 4KMTH 2X70A 1KTKE 1W6JA 1NBVH 3FN9A 3GMPA 3E8UH 5DRNB 3BEVA 4NKMA 3C60B 4JFED 5C0NC 1JYWA 1DBKL 2RR3A 1I1YB 2D7TH 1RULH 3BWAA 4HJGB 5EG6C 1OAUL 1P1ZB 4OZGA 4G9FB 1WBYA 5D4QA 2W1NA 3O4OB 2I60L 2MQ0A 3MLTB 3BE1H 4CMHC 4OF5A 4N8VG 2HJLA 1FE8L 3MBXL 3G5ZA 1T89C 3SE4A 1DANU 1JPGB 3IDMA 4LKXB 1GGTA 3LKPA 3T0EC 4F9LA 4KTDL 4G9DA 2EE3A 1L9MA 4KHXL 2R56L 4EQ2A 3GKWH 5E4EC 4NQCE 3EOTL 1U8NA 4XMKL 1R3KB 3RL1A 4APQC 2A6DA 3D0LA 2PXYD 3DGCR 3DGGB 1R3LA 3BGMA 2AK4B 1CGVA 4YK4C 4FA8A 1JYXA 4HT1H 5FKAA 5L88L 5IHUH 5A2IH 2GJJA 3F58L 5GRUH 1QFPA 2X89A 2QADD 2J88H 4P9ML 4WW2B 1A3LH 4GKNB 3O0RH 2YD4A 5F96H 4AK1A 1FFNA 3QQ9D 2C1PB 3G6DH 1T7YA 2D2OA 3BHBB 4K3JL 5I9QB 2ZG3A 4PJ9A 4LRIC 1MIMH 3NH7H 2EDJA 2J8OA 4FZ8H 4QHKI 2EIZB 4M5ZH 2D7OA 4XC3L 3FT3B 3LN5B 3KXFE 3WMSA 3O2WL 5MHSD 4HBCL 1ULVA 2QJDA 5GGUB 3TIDB 1MAKA 3U2SB 3MRPA 3RPKA 2HH0L 1T3FA 4JQXC 4U1IA 4QTIL 2AJYL 4FOMA 1KCLA 5HYSG 1IE5A 3NACH 4WFHD 5L8KB 4M7LL 2EYSB 1PKQA 4M6OH 1JGDB 3QG7H 5D7JA 1CDGA 3AU1B 3B8YA 5IIEA 1H3AA 3TJEL 1LVEA 4M1GH 3STZA 3IETB 1F6FB 4PRID 4YHNA 1XIWD 4NO5B 1P5VA 5F6IC 3ZT6A 1X5FA 4KROD 5C0IA 2CSPA 1A6WL 1X5XA 4CU8A 3DYPA 5F88B 2HRLA 3HI6H 3LS4L 4X4ZA 3AM8C 1A2YB 4X7CC 4N9GA 1QKZH 1HDMA 2Q7NA 1XH3A 1KIUA 2H8PB 2W60B 5ADPH 5FO9B 1RUQH 4RNRB 3WYRA 2X10A 3QCTH 1KCVL 1I1FB 1I7TB 4KQ3L 1MCJA 4HWEL 5JLZA 1H0DA 1CZ8H 1U8JB 3P9MA 3D9AL 4V1SA 4CN4A 2WV3A 3UP1A 1HINL 4XH2B 2HT4D 4UU9A 4MA3A 4JO1H 4OF7A 3B9KA 4K7FA 2ORBL 1ADQH 2XXCB 3K74B 5C1MB 2VRAA 4ZTPH 4PGJA 1EJOH 1QSEB 3KDMB 1YEIH 1HHIB 2Z35B 1EEYB 2X9YA 2YS4A 3MRKA 1CT8B 3ZHLA 4HKBA 4JRYE 3WBDA 2ZZUT 4PJXA 5EO9B 1KIRB 1NGYA 3RI5F 4AYFA 2UVFA 2WUCL 3IFLL 1XGYH 5FYJD 4OGXH 1FFOB 1ACZA 4R3SA 2I9LA 1M7IA 1TZGL 4ISVA 4U6TA 2DJSA 3KJ6H 4MHHI 5CP7A 3ZO0A 2YZ8A 1IBGH 3CFBB 4L8SC 1Z9LA 4BH8B 3UTSA 5F21B 2X7LB 3U0WL 4Q9BA 2RHEA 4KUZL 3KPNB 1DQML 4X6FA 1WFOA 2I25N 4EN3A 1NDMA 2WMPA 3L3DA 5E6ZA 1YY9C 5FK9B 4ZNEE 1G7MA 3EJJX 4LLQB 2EKSA 4Y5YC 1NBYB 1RJZA 1NEZA 4WHTA 3PQYA 4PG9A 4OZIA 4OCRH 2FO4A 4U4BA 5D7IB 4G6MH 1XGRB 4PUBH 1VEMA 3TEUA 3O6FC 3DVFA 4XP9L 5DI8B 2G2RB 2BHYA 3HB3C 4WUKH 5FUOL 4JJHA 1JNLH 3FFCD 3ROLB 3QDJD 5M94B 2WIMA 4OAWA 2JIXD 3B9DA 4G9FA 2VL5A 1FZOB 5C0FB 4PBXA 3BP6A 1FPPB 3FB7B 4XNQB 4PJIA 1FYTB 4EVNB 3VXUE 3AGVA 3LKNA 5TH2B 1TMCB 4NZTH 1XGQA 2DQEL 3NBNA 3PGDA 4NNXA 3VH8A 5D1QB 3V6FB 3IF1B 4LCIH 3CDGA 3RZCD 3GHBL 5E8NA 2NY4C 3QIUC 2BNUB 1PYWA