5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
2DQFA 3KYMA 4Z78B 5A2FA 4L3CA 3S97C 5IHLB 4GTSB 2IADA 4JFHD 1V5JA 3A6CL 4JANB 2Q3ZA 1NBQA 1RSFA 1B0RB 4PJFB 4JFFD 2ZUQC 1Q72L 3I85A 2H32H 1QHPA 1QSEE 2BVQA 4HMCA 4UQ3A 5B4PB 5I9QC 3ZKNC 1NMAH 1CGWA 4G80B 4KK5C 1FL3B 1K9TA 5DQ9A 4DZ8A 4YHZL 4OCSL 1I1CA 2YWYA 5F3BB 4UT6H 1EGJA 2BZDA 3AM8A 1C08B 4OLWL 2VDNH 5E1AB 3VD7A 4K7FB 5I18H 3MTRA 3AB0B 3AXLB 3NCMA 1IC5H 1CBVL 4YIQA 3MGTB 1UFUA 3GSOA 5T5NF 3TF7C 1ADQA 2Q86A 4OZIE 4EDWL 5FYJH 2VQUA 3ARFC 5I15L 3O4LA 4RFNC 5FO7A 1S7RB 2B0SL 1QFWM 3BP4A 2D0GA 4HUUA 1F11A 1J1OH 4PLOB 4G8FB 2GJJA 3L9RA 3BH9B 1DBML 2E27L 4M5ZH 1GZQB 2KZWA 4BKLA 4JREB 1GC1L 2PUQT 3L3IA 5MHSD 4RFOL 3H3PH 3G08A 3BZDA 4MVBD 2NY5C 4QHUA 1N6QH 4S11A 3VWKC 5LKNA 3LPGA 5T3ZL 4NO2B 3S4SA 3RZCD 1RIVL 2I5YH 2VXVH 4UNTA 1SBBA 3CH1B 3QQ3A 1JK8A 1FGNH 1Q9WB 2BSTB 3PE9A 4JKPL 5TDNA 5JMOC 2O61B 3ILQC 1JFQL 1A8JH 4L1DA 5JXEC 1S7UA 4PGEA 3DURA 4YHKH 5FM5M 4B0MM 2A77L 4OQTL 1N2RA 4LLVB 4Q0XH 3WN5C 2P48B 5IVOA 5ETUB 1PEZA 1X5GA 3WO4B 4LHUD 4KRMB 4OM1L 4CDHA 3BYTA 2CLZB 4I3SH 2O5ZH 3KHQA 3SDYH 4J2XA 3QHFL 3X14B 4YJZL 4OCXL 1CFNA 2H45A 3NA9L 4JDTH 1DVFC 1NLDH 5HYQB 1Q9KB 5IMKA 4PBXA 1W0WB 3O4LE 1V3LA 2QQNH 4F7TB 3KPRE 1I3VA 2DQCL 2Y5EA 4N90D 2UYLB 2V7NB 2X4NA 2ZWLT 1HYSC 1ZE3C 2BX5A 1D6VH 1CFQB 4C56E 1D5ZA 1FRGL 1OGAA 3PHOA 1IM9A 4KKAC 2NY2C 3VXRB 2ATPA 3L3GB 2WBKA 2NY4B 4MX7A 1UZ6E 4KKAD 3TZVD 3BDYL 5CSBA 3BP6B 3P73B 5HYJE 4Y19E 1WFOA 2FL5A 3GSUA 2DOCA 3N85L 5JA9A 1AE6L 3OKYA 1NAKH 1NCCH 2XRAL 3P77B 1LO0H 1NC4D 4Q97A 2C3XA 1YUHA 3CJJA 4U1IB 4P5MB 4AIXA 1BAFL 1NMBH 1DFBH 1A3LL 1MQ8A 2P8LA 5C07E 3EO0A 3GMQB 3MLYH 4JFFA 5GGTA 3GBMH 3C6LB 4TUJB 3VG9C 4HUVB 2X4TA 1QSEB 2HG5A 4X8JB 4TNVF 1NBZA 3BN3B 4WI5A 4C4KT 3K1DA 5JHDB 3G5ZB 1KIRA 2PYFA 5J12B 3LKSA 2LAGB 3STZA 2ADGB 4UT6L 4NQEE 4I8DA 2PR4L 4UT9L 2J2ZA 1DE4A 5F7UA 4RGOH 4HIJA 4PRHD 3I2CH 5GSVB 3NFSH 2BNQB 3GMOA 5CUSL 5EFIB 2VAAA 4DGVH 4BUGA 4HDIB 3QPQC 5T1LD 4LCCB 5C09E 3HUJF 1D6EA 1S5HA 3C6LC 2XKSA 1QSFB 4LSTL 5EIIB 4Q9RL 2QHLA 1QFWH 4X6BA 3SE9H 5BW7C 4PJIA 4GTQB 4M48L 1F4WL 1DQJB 5D8JH 4OJFL 4Z6AT 4NRZB 4QRPD 2HKFH 5DD6B 1OAKL 1I4FA 1AGFA 1U8MA 2JCCF 3U9PL 2QR0A 4APQB 1ZLWH 2WNGA 3LS4L 1N5YL 3GMNB 1D5IH 3SKMA 4YHYB 3T1WA 2R4RL 3NA4A 2FJGA 2E7LA 2GHWB 4EUPA 2H26A 5KVGH 3EW3B 4U1SB 5KSBA 4XPHH 4LCUB 1TJHL 5CP7A 3ROOA 4P2QD 1YYLH 4NQSB 4PR5B 5HVGB 4U3XA 1NUNB 4HT1L 2ADJA 1MPAL 3WIHL 4CVZA 1QSZA 1QBLL 5AD0A 5DDHB 4ZFOA 3D1MC 1C5BH 3ZSTA 4FFYL 3EYVB 5LVEA 5HHPA 1JYVA 2UY6A 4NQVB 2CRZA 4LP4A 4OM1H 4HLJA 3S5LG 1NCDH 2WBWB 5JHDA 4JO1H 5CGMA 1KJSA 5MERA 4OV5A 3RAJH 3WSQH 1FYTE 3HLAA 3QUZD 3MCKA 1Y6NR 3O9WC 5B8CC 4HKXB 3P77A 1CGSH 2W92A 4PYGA 4WI4A 5JOFA 3TWCL 4Q7DA 5E1HB 1AY1L 5ESVA 2VZVA 4FN0A 3V52H 2C7UB 4LVNB 2A83A 3PP4H 2JF1A 4YWGL 3TH4T 2P8MA 1KT2B 1BJ8A 2AAVA 4ZQKA 3ARSA 2HT3C 3IETA 5SWQA 5D93B 1BQLH 5C2BH 4ENED 1EVTC 1TJGL 1GC1H 5D5ME 2BDNL 2R23B 1RVFH 2YD1A 1PGRB 2OYPA 2NCMA 5AYUL 3PQYE 3SDXA 4P3DB 1FN4A 3VGEA 4R96B 1KLUB 3ZE2E 2R69L 3TP4A 4R0LB 5E03A 5KW9H 5J11B 3V4PL 5ICZB 1RUAL 3SKMB 1N64L 3QFJA 5TF0A 4AENA 2BK8A 3GMNA 4PRHA 5T3XD 4XCCL 3UPRB 3ZKND 3ARGA 1TJIH 3EJZC 1V3KA 3EHBD 3FB7A 1EZVX 4H88L 3SDXB 4MNHA 5EU6B 2PF6A 5CIPA 3TV3H 5C9JB 2CLZA 3UTTD 1C16A 4EDXA 4UBDC 4CUCA 2PO6C 4OZIB 4YE4H 5HI4C 5JW5B 1WBXA 5ELIA 4LARL 1KV3A 2GI7A 1KEGL 1OTSC 4HPYH 5HYFA 3MMEA 5IJKA 5E7BA 1BREA 2X2YA 2XQBH 4WU5A 4MD5B 3KXFE 1JGDB 1T6WA 4Q9QL 1OD9A 3OTTA 3ZTJG 2B2XL 4GW1A 1JF6A 4NNXA 5IWLA 1UCBL 4KJWC 4HBQA 1C5DA 5LXGL 1E0OB 1FH5H 5GSRB 1I1RA 2DJUA 4B7LA 3O3UN 3GBNH 1IGMH 1RZJH 4U1MA 3SDAC 1JGLH 3ZDZF 4U7SA 1UXSA 4LASH 4Y4FD 3LKSB 3L3DA 2QKIA 4I0PA 4DAGH 4HK3J 3WL9B 2LAAA 4AQOA 5BJTA 3BEWB 3ILPA 4MB4A 5EOCH 5DDHA 3F7YB 3V8CA 1WUNT 4U6HA 5MEOA 3GJFB 4OZ4B 4LNGB 3U4AA 2ESVD 3BRGC 3D0LA 3O2DL 1NJ9B 2IG2H 1R3KA 3LN5A 4P2OD 2X44D 4IIQB 2ORBL 1JTOA 1R6VA 1MI5D 4QTIL 3NFPB 1FZMB 3PL6A 4ZPVA 4M6AA 2C1OA 2GSGA 2J5LB 3L3GA 1A5FL 1JPGB 4X4XA 1ZA3A 2BOCA 4DFHA 4PJIB 3D3VD 5I1HH 3NACL 2B5IC 2IQAA 1FNAA 2X4NB 3EGSA 1XR9A 1JF1A 1YPZE 3QFDA 5BV7H 4H0GA 1AP2B 3C5ZD 5I9QB 3JXAA 1SEBA 3SCMB 4LCCA 4GXVH 4U33A 5C0BA 3VXMD 3N1QC 4H20L 2ILLA 2WIMA 4KHXH 1NGPH 4F2MB 2R2LB 3K8MA 3FO9A 1P69B 3EDKA 1EHLH 3T3PF 4NN6B 1KG0B 5DUMH 2VXTH 1J88A 4LGPB 1AD9B 1GOHA 3D18B 2F53E 4XNQA 3QG6B 5C0EB 1BJ1H 1A3RH 3TBSA 3O2VL 1IAOB 3K4ZA 1M6OA 4Y5VB 3IJYB 4JQIL 5DD3H 4X8JA 5AG8A 5BV7L 3NH7L 4DTGL 4P9MH 1UJ3B 3SCMC 2NX5D 1QYGL 2YN3A 1JBJA 4Y4KA 2ITCA 3CDGA 1KGCD 3MRDB 3P73A 1FSKB 1JNLL 3K2UL 5TDPB 1SHMA 5D7LE 4I77H 1FNEA 5FXCH 3NPSB 3MGOB 1U2CA 1T1XA 4ZOEA 3C6LD 3AREC 3QUKB 1IC4H 3OL2A 3Q5TA 4HS8L 4Y4FA 3MRNB 2IG2L 4NPYB 4DN3H 3T0AA 5IROC 4XCNB 5JW4R 1ZGLP 5DMGD 3NCJL 1UB6A 4C55A 2VLKB 3QDGA 4XWGH 5CWSA 2OZ4A 1A47A 1XR9B 4WUUA 3PWUB 3LKRB 3E8UL 1YEJL 4M6NH 3HNTL 1EGJH 5IW6A 4Z0XA 1HSBB 2NXZD 2O26U 4XBPB 5D5MA 5F9AC 4WV1A 2F0YB 2EC8A 3EBAA 4P9HL 5I19L 3SDDD 2EEDA 4GW4A 2F9BT 1Q0YL 5JW4Q 4XP4H 4YEFA 2QQKL 4Y5XB 2B2XH 1A6AB 5E4EB 4ZFFB 4YXLL 3C2SA 3BMWA 4FOMA 5C0JB 1KJ2B 4MQXC 1T80A 2DLEA 4OLVH 1AO7B 4C56B 3VXPA 3D3VA 1NJ9A 4ZUWB 4LHUG 4NZJA 1FZOB 3QEGH 1NBYA 1P5UA 2APVA 4BQ9A 5KVFL 1Q9WA 2X4OB 3UJIH 6FABL 4I2XE 4KROC 1F97A 1HE7A 1HHKB 3ES6A 5JHDE 4X98A 5FM4A 5CZVH 3MLVH 4NC1E 2OLDA 4TOYL 1QVOA 1T1ZA 2R2EA 1FZOA 5BCAA 1QOKA 1QR1B 5EO9A 4S0TD 1EFXD 1JHKH 2OTPA 2R0ZH 1ROWA 3BJ91 3DX9A 1LEGA 2ICWJ 5DVLA 4MVBC 5E6IC 2B1HH 2R56H 2VQ1B 4QRQA 4WU5B 1T83C 3OPZL 1T5XB 4MLSA 4C59B 3PGDB 2LTQC 3SGDH 1ZT1A 2VDKL 1MCFA 3N1GC 2X4UA 5FYLL 5FGBC 3GGWB 4BFGA 2BCKB 3L7FA 4NQEB 5D7IB 4PJFF 3TH3T 1KTDA 2Y7QA 1LO4H 1QBML 1WBXB 4HHAA 1CD1A 2AI0H 3PP4L 1LQSR 3L5IA 2BY2A 2J8HA 1CDJA 3QI9C 2WW8A 1AGCA 3BKCL 4E42A 4EVNA 3KYKH 1V3JA 2G5RA 4KQ3H 2FIKB 1TNUB 3BH8B 3C5SB 7FABH 1NKOA 2P1YA 4AENB 3QAZC 4Y16D 1B0GA 2F5BH 4HC1L 4Z0BL 5ADOL 3DX6B 4P3WA 3K2MC 2BNRB 3RAJL 4UQ3B 5HD8C 4I3RH 4NN5B 1Q9OB 1TVBA 2R0KH 1HWGB 4GW5A 5L2JB 3QIUD 3P9MB 4LVHB 1XIWB 1C1EL 4PJ7B 3CDGB 3VRJA 3ZKXC 5K59F 5SX5H 3KYMB 4Z78A 1IC7L 4C58B 2P45B 3F58L 5HXMA 3KXFB 3VGHA 4KI1A 5GGQH 1UM5L 4ZUTA 5FB8A 2QTEA 3KAAA 1OGTA 2I24N 1I8MB 3FAXA 5D7SH 1IGTB 1HH6A 1T89C 3GI8L 2DM2A 4OV5B 2CR3A 1GGIL 4TPRH 1OAXH 3C08H 1F3DH 2HJKB 4OZFA 3QDME 4ZD3L 2Q20A 5CLTA 1JPSH 2D9CA 4JGUA 3HMXH 3PP3H 1LP9B 1TN8B 1T2XA 1X7QB 4OD1H 3JZ7A 1RJZB 3SCMA 3PQYD 3NFSL 4TSAL 2VJXA 1D8EB 1JHLH 1OSZB 5IVXB 1K2DA 5IB1B 5E2UL 4FXGB 1A7QL 3EOTL 1LK2A 4E9LA 1QRNA 1DBBH 3TIDB 3FONA 4APQA 1J0YA 3HE6D 3TBTB 2NYYD 4LSPL 5ENWB 3E37B 1SVZA 4QRTB 2QEJA 5K9JL 4YO0B 2VERN 4KHTH 2XZAL 3QPQD 3QJHA 4OZGF 3VXME 3UCRA 3KJ4C 4LVEA 3CX5K 2FZ3A 3NIDF 5KS9A 3FT2A 2A6DA 5K9OA 2MMXA 4DGIL 1MIML 1KTLA 3R8BB 2Z93A 1QSFE 1H39A 1EA9C 1LO0L 2W60A 1Q38A 2I27N 4KXZH 5GGRY 5T1KD 1C7SA 1R3JA 3KWWB 1Q1JH 2YK1L 2EZ0C 3BZ4B 3TLRA 2KUTA 2FH8A 3GKWL 1RZ7L 3MYJA 4OCRL 4O51B 1D5XA 4YHOH 3ZDZE 2DQJL 4K71C 2FX8H 1YNTB 2W65B 3VE0A 1HQ4A 4DUWA 3T0EB 4NNXB 4GW1B 3PV7A 5HJ3A 5EB9A 1UEYA 1S63B 3V79C 1NC4A 4PREA 2C5DC 2VH5H 4LSRL 3REWB 4PJHA 4DGIH 3N1MC 1NLDL 4NDMA 4J8RA 2EICA 1CFBA 1UC6A 1BIHA 1T7YA 1II4E 4KUZH 1J5OL 1JPTL 3EOYG 4EBQL 3MRGA 4FFWD 4XX1E 3U7YL 2LQRA 3QEQB 2ENYA 2AJZA 2WIIA 3TC9A 3MJGX 5T3XL 3TO2A 4JLRA 1U95A 3S7GA 4Y4HD 3O3BA 3U83A 2H1PL 4Z77B 1R5VB 4OFKA 5FYLE 4JKPH 2EEAA 1R24A 1FYHB 3T0DA 1KPUB 1YMMA 2APFA 3VFGH 4F3FA 4UMGA 1OWRM 4UDUB 1CLOL 1T66D 1XEDA 4YX2L 1U95B 3CLEL 3OHXB 5DR5H 3HMXL 3V5HA 1DJSA 1RUKL 2IEJB 1WZLA 3P2TA 1N6QL 1CU4L 3H3PL 2HFGL 3QXUA 5ALBL 1CFAA 4NO0B 1EUTA 4M5ZL 1INDH 1PX3A 3VJ6B 5E8OB 4C54A 4P2OC 2EYSB 3L5WA 3SGDI 4LNRB 3WE6A 3H42H 3L3HA 4O02L 1FLRL 2EKSA 4PGEB 1OCWL 4WI8A 5FYJL 4EDWH 5CP3A 3UYOD 4OTXL 5TGBB 2NY3D 1CN4A 2CUIA 5J4MA 1I8IA 2XFXB 3BDXA 4RWYL 2FNBA 3AM8C 2KZ1B 2IBGA 1GGTA 4U3CA 2H6HB 4X6DB 5CJXA 2R0KL 3VH8A 1KACB 2E7CA 1LE5B 4KMQA 5KAQG 3BVNA 2PMVA 4TULL 1EAPA 2X9YA 5I76B 3CLFH 1UKSA 3QG7L 3HC3L 4PJXE 3MRBA 5KVEL 1BZ9B 7FABL 1WQVT 1UYWH 3RA7H 2VDMH 1ZHBB 4C57C 4YXHL 4LRNL 1NMCC 3OKNA 5ANMA 3BKCH 1U91B 2BVOB 5D1QC 3D2UA 4G9FA 3GSNH 1FP5A 4QRTA 2WMPA 3GSVA 1NCBL 2X5PA 3GEWB 3U9UA 4PLKC 3JV4B 3OKMA 5CJQL 5E5MA 5IMLA 4AQ1B 3PWNB 4H8WC 2VAAB 4M8VA 3NAAH 5J6GA 1K2DB 4UDTA 1OSZA 2R56L 1HINH 1LO2H 1H3PL 4L8BA 1CXHA 5DD0H 4EIZC 2R0ZL 5C0AD 3BZEB 1H0DB 4U1GB 1S7QB 4HXAL 4LKXA 4PLJC 1L7TH 2FHFA 3R06B 3H9HB 2ADGA 1DLFH 4BH8B 3OSKA 2ZOKA 1C7TA 4QHMB 3UJJL 1I7RA 2R2BA 1IM9D 2Q8BL 3RTQB 2AP2A 2F74A 1ZWIB 1L7IL 4WNQA 1JNNL 5EZJB 4AH2B 1U8HB 3OZ9L 1XGRB 5FIEA 4N0FA 1YY8A 2NPLX 1V8HA 4CKVX 4KTEL 4HUVA 2G9HA 5DHYB 3V6FA 4Z7WF 4QT5A 3RWFB 1VFBA 1LP9F 3M1BB 2R29H 3W0WD 1XCTA 1U93A 4AG4L 3OG4B 4TSCL 4HIIA 3PNWB 3GIVA 3OJDA 4PGDB 3DUHA 2HVKA 2AGJL 1IZJA 4MJID 2NY7H 4JDZA 1I8KA 4NO5B 1CDUA 3QXAB 1FDLL 1NC2B 1ZVHA 3SQBA 4F7PB 2XZQL 4M5YH 2DWEA 3FN9A 3GB7A 3E8UH 4P2YA 4PRBB 1QSED 1LE9A 2BNRA 3QH3A 1S7VB 4XPTL 3MREA 1U3YA 2ZSVA 1IGFH 4M4RA 1OAUH 4N9GB 2OI9C 1OB1A 3I6KA 3OBAA 1HYRC 3HE7A 4ETQA 5JR1L 1S7SB 3KR3H 5IHUH 3EO9H 3FQUA 4AIZA 2FIRT 4UIMB 3QDMA 4MNGB 5CJ8A 2EE3A 4WI9A 4DN4L 3UTQB 4QRRA 1TZGH 4OF7A 2NLJA 4PJ7E 2WUBL 3HC4L 5HGAB 3I9GH 1B9ZA 1OAUL 3O81A 4Q9BA 1OPGL 3GGWA 5F9OH 3MRIA 2I25N 1KFAL 1DQDH 1PZ5B 4NSKA 1G7JB 4PJEA 4PB0H 1KB5A 5BO1H 3CK0H 5GRZA 5BVJB 2P7TA 2DTMH 1VESA 4FZEH 4YUEH 4JHWL 1S78D 5EO9B 4YDEB 4N8VB 5GGTL 3MJ9H 5EH1A 1YN6A 2VN4A 1QVOB 1T0NA 3N0PB 3BE1L 3ZYZA 1X5XA 4DKFH 2BMKA 4W4OC 4QHLB 1WIOA 4P3CL 1FQ9C 2W9EL 4FMKA 2VXTL 3TIEA 5LWYL 1KIQA 3HI1B 5MP6L 2D3VA 2GFBA 5J06A 4LEXL 1YJDH 4QOKE 3DUUB 3HMXA 4PJCA 4BSWB 1EH9A 3ZE0F 3ULUF 3WFCL 5KSVB 2VDLH 1HXYA 1T2QL 3O8XB 3VMOA 4ZFFA 4OGYH 3BI9X 4H5SA 4OUUB 4XVTL 1DQLL 2QSTA 4LSVL 2AXFA 1EV2E 4KDTA 3FTGB 4MDIB 2R2HA 1L7TL 4QWWC 3HE7B 5D72L 4HXAH 5F3BA 3QO0A 2NXYD 4Z0XB 3KPSD 1H3PH 5H8DA 2YSSB 4XVTH 4GMTL 5ACMA 2Z91B 3QULA 4LGSB 4DOHB 2VB5A 1OW0C 1MFEL 1UVQA 4D0BB 4UOW0 2EDJA 2D03L 1RJLA 2APBA 3AY4C 4HKZB 3MRRA 5F9DC 3PJSA 3DRQA 5T1KB 4P4RB 5F1IB 3P4OB 5DURB 2KL6A 2BJML 1FZJB 3HHRB 2MKLC 3LB6C 3OKLB 3BQUB 1CWVA 4D4DA 5EBMB 1JGLL 5ERWA 3MRDA 5GGUB 3TBYB 4KVCH 4YXHH 2AJ3B 1YQ2A 1SM3L 1FC1A 1FH5L 4G8IA 3ILQD 5E6ZA 2G9HB 3N9GH 1DCLA 3K80A 2PYEB 1XGRA 4HUWB 4LQFH 3DHMA 3BPOB 2GK0A 4Z8FL 1EHAA 1TMCB 3X3FL 1A64A 4NBYB 4ZNCD 1INEH 4ELKB 2EIEA 1RFDL 3WS3B 5K9QG 3F6LA 3MLPA 3WUZA 3FB8B 4PGBA 4BH8A 2WWMC 5F1SA 4Z7UA 3RY6A 3B4NA 1MAML 3H6JA 4G7VH 4N0UE 4UTAH 1HK6A 5GS0C 3HNSH 2R1XA 5CIPH 5ESQB 3KPPA 1FNGA 3GK8H 2AEIT 3MRQA 4LPWA 4UDTB 4I1NB 2E9BA 1A1MA 3CZJA 3S6CA 4K9EL 5C0BB 2YUZA 1T3FB 3DWTA 2ERJC 3V4PH 1FFPB 5DEFA 4EZMA 3MLZL 3MRFB 4LLWA 5E5RB 1F8TL 5FGCE 2D9QB 5C7XH 3EDJA 4NP4L 1KENH 4R26L 2FDBP 2F5AL 1RVFL 4G6KH 2BVOA 4TVPD 1A4JA 1S5IH 3ZTNH 1RURL 4GRMB 1I3GH 4HUXB 4RGNC 2W9DL 2H6PB 1H5BA 3QFJE 3TN0D 1RUMH 4JY4B 5JW4M 2D7TH 1CDCA 4AM0A 3QUXB 1H3AA 3SQOL 1MFBH 3G04A 1BD2B 1TCMA 3M1BA 4XPGH 3RWFA 1CK0H 4ONHB 3ARBD 3QIUB 2Z31C 1DLHB 5T5FL 3D85B 3VFMA 3OAZH 5LCVH 5C0NC 2YBRB 3CFEA 5IFAL 4JO1L 1D8DB 1DVFA 4Y19B 3FQNA 4XMPL 1J8HE 2H2SC 3GMRA 4K2UH 3HXBB 3QCVH 1CGTA 4XPFH 4X5XB 2ZJSL 5C07B 4Z7NF 3MNZB 2VH5L 1S8DA 4JZJB 1P7QD 4JPVL 5KVGL 2CKBA 4LU5L 3VFWB 1U3JA 5FCUH 3DX7B 3ZKMC 3MMEB 1DN0B 3OGCB 5DQJB 2E7LC 4U1HA 1P4LB 1RY7B 5EZLB 2DN7A 1UCTA 5HY9B 1Q0XL 1J1PH 4DQOL 4NIKB 3W5NA 5KSBE 1QFWL 3NPSC 1DBJH 2DI7A 5C6WH 4UAOB 5IVNA 2HLAA 4RX4A 3H7BB 3QHZL 4Z95L 5DMJB 5HTSA 3MUGB 1MIEL 5IFHL 3GKZA 2PXYD 2DQDL 1B4RA 4NQXA 1R3HA 4X9HA 3ZDXF 4L4VD 1FN4B 4Z18A 1MUJB 4Y2DA 1N4RB 3E6HB 1OLZA 4PJDA 5L88H 1KN2H 2HKHL 4UT9H 4CADB 1XH3B 4UINH 3MV7D 1UKQA 5GXBB 1VFOA 2CK2A 1KN4L 4IRZH 4G6MH 4B7IA 4GBXB 4J8RB 3FFCA 4NDMB 3EOTH 1YPZF 4JAMB 3CZFB 3CU7A 4XWOD 3R4DA 5JOPD 3VGAC 1BFTA 3AAZA 4TSAH 4OZFH 5DJ8B 3B6SB 5HJ3B 3D25B 1SEQL 3WFZA 1B2WH 3F62A 1NDMB 5FHAL 3C5ZC 2J8UA 5I1GL 3FFCB 3QWOB 2ZCHH 2CO7B 1GGBH 3PGFH 1Y18B 2D7PA 1W72A 2XN9B 4PJBF 3FMGL 2IPKA 3E6HA 1J0HA 1E4KA 5H37G 4WWKD 4Y2DB 5F93C 2R0WH 3FQTB 1RUKH 3LV3A 3F7QA 2P4AB 4NC1C 5TE4L 4PB9L 5FF6B 1G6RB 2Y23A 3C60A 4G6AC 5I0DA 5BRZA 3BHBB 2FZ3B 5KS9B 2MQCA 5C6PB 3WJLC 5E8PB 5ANME 4KKLC 4MAUH 2ED7A 1LEIA 4JREC 4OCYH 1MLBA 5IB5A 3MV11 2A6IB 4U1JA 4V1DA 1C5CL 4RMWA 3WUWA 4JDTL 2ZZUT 5FOJA 3VDCA 2NQCA 2FYYB 3SPVA 2DIAA 2CDFB 5EZLA 3LQZA 1P4LA 1TN7B 3TNNA 1CD8A 3T0XA 3UROR 1TZHB 8FABB 2XWBA 3BD4A 3HMWL 3BPCB 4YPJA 3HRZB 2RR3A 4Y19D 4LF3A 1AXIB 1TTGA 4PLJD 4NCC1 3GSRA 2V8IA 2V5RA 1A1OB 3U0WL 4KK8C 4RAVB 3H3BC 2VDQL 1ORSB 5BOZG 3RWDB 4XAKD 4JO3L 4KJPD 3TO4C 4BZ2H 4NWTL 1N0LA 3FRPA 4WTWA 1TTFA 1LO3H 4PBVC 3BT2L 3MRPA 4RFOH 3QUMA 4HIHB 5EUOB 3IFOB 3FQNB 4GRWF 4M7JL 5E00B 1R0AH 3JBG7 1BFVH 4XMKL 2E27H 5JOEA 2NR6C 3G04B 4QHNA 3C2AH 3VDAA 4KC3B 5IQ7L 3G5YB 2XY2A 3MACH 1MIMH 3QHTC 3S36X 2B4CL 3OKKB 3VRJB 1CE1H 4HUXA 3OR6A 3O3DA 3MOAL 3QJHB 4XMPH 4ONFL 1F02I 3QA3B 3LRGA 4J3VA 3VFRA 5BMFL 3E2HB 3ZT7A 3ZO0A 1ZKAA 3MV01 2XKNA 5A2KH 2WAHA 2DQEH 2X70A 1A6VH 1MCLA 1A1NA 1T3FA 3DVNB 3EYFB 4GRWH 4NQED 5E6IA 4POZD 1I9EA 2C3VB 3WIHA 4J23A 1AO7D 1YYMH 4PLNC 3B8YA 5IMMA 3VGDA 4LCIL 4TRPH 3SJVD 3WS6A 3VXQB 3M17B 1JHTB 2I9TA 5C0AB 5EBLA 5IBUB 4LSQH 1RUML 1BEYH 2V9RA 4PG2C 5HHNB 5ITBH 4U1HB 5F44A 3EUVB 4FA8A 5C0CA 4HIEA 4J3OC 3KPPB 4FHBD 4MQTB 4LCYB 3ZTNL 4Z76A 3WNNA 1ZT1B 1OAXL 2XA3A 3V7AE 5C7XL 2AK4B 1LHZA 4U1GC 5KSUA 2JIXA 1LD7B 3HRPA 4NKDA 4OGAD 3W5MA 2AEQH 3D25A 5BRZD 3SKNA 5CAYB 4NFBA 3STBA 2A9ML 3TBYA 4U2YA 3T09A 4A2MA 2MJWA 4WW2B 3G5XB 4HUKB 4Y19A 3QJFA 4OLXL 1DVFB 1JNLH 5EA0L 4G8IB 3NIFE 3V6ZA 2QL1A 3U6RB 1BLNB 3BIKA 1AJ7L 5E6YA 2GQHA 4DVRH 5D7IE 1FLTX 3L3IB 4AT6A 1DCEB 4OF0A 5JHDD 4GQ9L 1Q9OA 5TJWK 1P4IL 4EN3A 5F1IA 4N90E 1KJMB 3DRQB 2MHAA 4WTXA 4FXKB 2J7LA 1R3HB 2W1NA 2X9XA 3O4LD 1A3RL 2P24B 5CZXC 1A6PA 2JCCB 4EOWH 1H8OA 4NBXB 5T33L 3V6OE 2OK0L 2VR9A 2Z91A 2X1PA 3QULB 3D6GA 3S96A 4WDIB 4NQCA 1VGEH 1S7XA 1UM4H 5FKPB 2FRGP 3TZVB 1HSBA 2AK1H 3O6KL 4CN4A 4IOFD 1EHLL 2BJMH 3LKRA 3LMJH 4OUUA 3CFKB 4XC3H 2FEDC 2NTSP 3O8XA 1MFDL 3QI9A 2Y7QB 3FTGA 1FNFA 3AMKA 4FQHB 1ZHNB 3BWAA 1A9EB 3I02B 1AIFB 4CGTA 4FFZH 1J10A 3RVWC 3QUKA 4D9RE 1E4XI 1OAZH 2EDRA 3CVHB 5C8JA 3HI1A 3O2WL 1G6VK 4OD2B 4KRPD 4E41D 1H37A 2R1XB 4GUPB 1Z6JT 4PPTA 5DEGB 3DUUA 1GIGH 1UGNA 4JG0H 3VXSD 3NGBC 5C09B 3O2DA 5JW3L 4IMKC 1TZIA 4L3CB 5C9KA 3WS3A 1RAMA 4HJ0C 4K3JH 1N4XH 4YFEA 2IQ9L 1MF2L 3ZTJH 5CILH 1A6TB 4RGND 2GW5A 2VDLL 2YMXL 1RHHB 5CCKH 1ITCA 4QRPB 1G9EA 5TE6H 1EXUA 2MFNA 3M45A 4F7CB 1AR2A 1YJDL 1AO7A 1CCZA 3A67L 2DYPB 5D6CA 4S1QL 1G1CA 2R4SL 5GJSH 5BZWB 3Q2CA 1IKFL 5A2JH 1RMFH 3O4OC 1FIGH 1NL0H 3CDFA 2BB5A 2G5BB 3HZKB 4P9HH 4X5WA 2A1WL 5I19H 2WINA 1D9KA 1F4AA 2IFFL 5FO9A 5IB4A 4JHWH 4OZHE 4YUEL 1YY9D 4RSVA 1CLYH 3BWUC 3TZVA 5I1AA 3GSWA 5HDOA 3KG5A 1JZ3A 4ZPTA 1SJEB 2X1QA 1T7XA 3H0TA 4G8EB 1P6AB 5CWSB 3QDGB 3BD5A 1HIML 2F53D 2E7HA 2GJ6E 5KANI 1T5WB 2JJUA 4XXCC 1OPGH 4HPYL 4HUMB 1D9KB 3UTPE 1BQHB 4P46B 3GRWH 5CILL 1D5MA 4DGYL 1FVDA 5D7LB 5DLML 4I77L 2Z4QB 4F7PA 3KPMA 4KUCD 4XHJD 2Z8WC 2HTLC 5I0ZA 4ZTOL 1UWEL 2IANE 4X6DE 2NTFB 3IAPA 4ODHH 1QFUH 1F42A 4OM0H 3KLSA 1TCRA 4PRNB 1U93B 3KPOA 1EEUA 4K3HA 3V6OC 3ARQA 2JTDA 1MWAA 1NGQH 1U58B 3VD3A 3L3DB 4QHMA 5C2BL 1AQKL 1AI1L 4R8WL 5DT1H 5IT2L 4M1GH 4BUHA 2YA0A 4JDVA 2X4PB 1U8QB 2BMKB 4F33B 3VFVA 4PJBE 5DO2D 5DUML 5E9DE 4P2RB 4B50A 4JB9L 2AJVH 5GIRB 3G6JE 2FX9L 2OK0H 5D7KE 3QI9D 3C72B 4NSKB 2H8PB 2BERA 4BM7A 4JFXA 1CFSA 4MQXD 2I60H 5C09D 1LVEA 3HNVH 4JHAH 2KDGA 4WUUE 3WHXB 1JCKA 3IU4L 4YAQA 4NQTA 1P4IH 1J8HB 1TNNA 5BZDA 4AIZB 3FJTA 4ONOA 1TNYB 1F4XL 1FVEA 4FFYH 4YK4B 5TDOA 3H2WA 4U1KB 1A6UH 4FP8H 1ZMYA 3ARGB 4JN2B 1JMXA 3WXWL 4OCMC 1F2XK 1XGUB 3CFKA 4OB5H 3VXRE 4X7CC 3T77A 1PVHA 1VFAA 1BZ9A 5F1KC 5EZIL 3MA9H 1S7VA 1ETZA 5JPNA 3OKKA 2R9HC 4LPYA 1VA9A 1X5AA 2IAMB 1IAKA 2P24A 3HC0A 1O5MB 2BNRD 2BY3A 3GJFA 3LV3B 3HI6H 2YEZB 4IOIB 1OTTD 2P8PA 3BESR 3BVNB 4V2CB 1KIQB 5L6YH 2NY0C 2NY1C 3QJFB 1TPXB 3MFFB 3V6ZB 3S88L 3U0TA 4AT6B 1I3UA 3LQAC 4NRXB 4R3SB 1I8IB 5C08D 3DGGA 4RMSA 4LSTH 4Q9RH 2F15A 5DK3A 4ZTPH 5DFWH 3B9DA 3RDTA 5EUOE 1CXLA 2P7TB 3WKML 4MA8L 3SDDC 5BVJA 4YK4C 1NMCB 4HH8A 4IMKA 1F90L 2EKSB 4XVUD 1QR4A 3I50L 1KB5H 3W39B 4F9PA 4QY8B 1R3LA 3NZ8B 2H2SD 4PJCF 3CSBA 3D3VE 3ZT5A 5JQ6H 2DQHH 4CADA 3QEUB 3UTTA 4L8BB 1RUQH 3GZKA 4PJDB 5CIPB 5C9JA 5IIEB 3M17A 2I9TB 2GYSA 1OB1B 1VFMA 4YHLL 3MLTA 5HVWA 2ZG2A 3RJDA 1FLRH 4MXQD 2A9NL 3O3BB 3VA6A 1X6LA 5E8NB 3VFNA 2CLRB 1U8IA 4Q2ZB 4MA7L 4R96A 2ZUUA 1INDL 3U2SB 4PTUB 3TH2T 1EEZB 4ISVA 5E6IB 2HRPL 4IS6B 3U48A 2HYMA 4J4PC 2AABH 1UM6H 4HWNA 2Y07L 2N7AA 4ZQKB 4NWTH 4JO3H 4YX2H 4X83A 4P2QE 1FRGH 4XCEA 5IVXF 1S78C 1GZPA 3AUVA 5IEKB 1T21A 4N5UA 1RK1A 1DUYB 1UZ6F 2EEBA 3OJDB 3QIBD 4PGDA 3SJVE 3ZE2F 2HT4D 3MLUL 3OR6B 3BMVA 4KZDH 3QB7C 1HHJA 3O41A 4M43L 3S3SA 5BXFB 3BX7C 1IGIH 4PJHB 3RVUC 4HIHA 3INUH 4HIXL 3U0PA 1W2KT 1UH2A 2XIDA 3QHFH 3PZ2B 3V0WH 4JFOA 2QQQA 3ZKMD 4EBQH 3BISA 4LBEB 5IW3A 4KVNL 3P30L 1IKNC 4XNXH 1QO3B 1QBLH 3R06A 1QSJA 1N59A 4UQ2A 4HIXH 3DPYB 1WFUA 4F9PC 1XGTA 3O6LL 4LSUL 1LDPH 4M62H 3Q78B 2I5YL 3IDYB 1RK1B 3QWQB 2EE6A 1T0MA 2PW1A 3WIIL 2XWBB 3GMPB 4KKBC 2H6PA 1HYSD 4YHOL 1I4FB 3HAEA 4ZFGL 1UM6L 5FAAA 2APWA 3WN5A 5DMKA 4U1JB 4O9HH 1U8KB 1Q1JL 3MLXL 4HWUA 2E7MA 4D9LL 5J1AA 3DUSB 2Y6SD 2OR8A 1JTPA 2ZCHL 1MCHA 3DXAD 5I6XB 1U6AL 5BOPA 1LK2B 1KXVC 2JCCE 2VNCA 4XBGA 1S9YA 3DV4B 5F7YC 2BVUA 5EC2B 5HYQA 1A6ZB 4Y88A 5LBSL 3TJHD 5MI0C 1CFNB 1ZEAL 3HI5L 2BEDB 5E8PA 1PYWA 2AJSL 1QEWB 2MPAL 5D1ZA 3ARZA 4PJAA 5I1CL 1V05A 1WWAX 5FYKH 4J3UA 2P5EE 5DZOA 5I1CH 5D1ZC 1FGVL 3LN4A 4FTVA 5GISH 4YBHA 2FBJH 1A7QH 4LCWD 1L9NA 4XP6H 3FT4A 1JGVH 1HI6A 1NBZB 3GBML 2CRYA 2EDDA 1VDGA 5I1JL 1XGQB 2W0PA 1F4HA 1MCOH 5EU6D 4L9DA 4ZD3H 4PGCB 1I7TB 1AGEB 1XH3A 3OJ2C 1U9KA 4O9HL 4WFED 3LEYH 1Z0NA 4QRPE 5D6DA 5HGBA 3DSTB 1U0QA 2Z93B 4OLUH 2YRZA 2NXZC 5E8EB 1JCSB 4UDUA 3MUGA 4P0DA 1IAMA 5ESAA 1S7RA 3UXFA 3VXSB 12E8H 3VXUB 2QSCH 5D2LF 2Q86B 5F7KC 4EQ2A 3KNBA 4JY5H 4QWWD 2CLRA 3B5TA 5E8NA 4QXWA 3AROA 1KJ3H 1FZKA 1MNUL 4QF1A 3RWGB 1KEML 2X10A 5EU7E 5I16B 1JCQB 1IC7H 35C8H 4PY7A 5MHSE 1X3DA 1G7LB 2WQ8A 3E32B 5IJVB 2LU3A 4MA3A 3VFPA 2JIXD 2Y5TB 2J88H 3QUZC 3VFWA 4HHAB 3CC5A 4F80A 2JELH 4QLRA 1WBZB 3NBNA 2VLLA 1BZ7B 3DXAE 1BFSA 4PJXA 4N5EC 3ARPA 3KLHC 3IYLW 1J11A 3FQXA 3NIGF 4XPGL 2VQ1A 1PKOA 4WWKC 3TPKA 3C09B 5JORB 3WHE1 4P59H 4AL8L 4KPHL 5IVXE 4QXTA 5D9SB 3LRHA 3HQBA 1WC7A 4JGMA 4MNGE 3T0EA 4NZTH 1IJ9A 4HH9A 5C07A 3IXTA 3FQRB 4L4VA 2QHRH 2X4OA 1N4SB 5EU3A 2Y4SA 3RWIA 5GRJH 1EPFA 1T0NB 3ZE1E 4ZFOL 1AI1H 4R8WH 3AY4A 3PIQA 4X98B 5CSZB 3QIUA 4YDIL 2IWGA 4ONHA 4DKDC 1S5IL 5HYJA 3OKLA 1UADC 4XCFH 4CMMB 4XNZC 3MZTA 4WEUD 4PJAF 5E94B 3VXTA 3OAYH 4GAJH 2RB8A 2IPTL 1F8TH 4HG4K 5K59E 4RAHA 3VXPB 1HSAA 1X4ZA 3CX2A 4Y16A 3MOBL 4ELMF 4KY1L 2H3NA 5IGXH 4MB5A 5D7KD 2LE9A 2BHYA 2EDQA 4Y2DD 2SQCA 2AXJA 3BZFB 1M7XA 4FQ2H 1JCRB 2XNAB 3RJ3A 4LCCC 3A0OA 3UBXB 5KVFH 5ENWA 4O58L 1JN6B 4XP1H 1FG2A 3GSNA 3OKOA 3I50H 1WWBX 3O11A 3KQ4A 5AEAA 4WU7B 3IDIB 2FIKA 4YXKH 2H2PC 3UPAA 1HXYB 1WICA 4JRYE 4WB3A 2HH0H 1N6VA 1BD2E 4FQQA 4XVJH 1KIPA 5DD5L 4ZTPL 4MA1B 1PKQE 1Q0YH 4LLMA 3FFCE 4KVCL 4G9FD 1RMFL 4TTGA 5BW7A 3EIFA 2X4RA 5DRZB 5E2TH 1OTTC 5IESH 3VG9B 2MOVA 3A67H 2X4PA 3FKUS 1IMHC 4PJHE 3DX9B 4GQPH 1AKJB 4YPGA 3THML 5IJKC 3IB4A 4KJWD 2BC4A 3GRWA 4YHML 5HD8D 1IC1A 1BWWA 1QQDB 3HA0A 4G3YL 5FB8B 4HUWA 3PQYA 3SDXE 1AD9A 3DSNA 5DRZA 3PABB 2X4RB 1ZWIA 4G6JL 4NFCA 3SKOA 3TBSB 3QG6A 2A73A 2DI9A 2ICEA 5SV3A 5T1KA 4PTTB 1J0IA 1SYSA 1WIPA 4BK5A 2YS4A 3FRUB 1MEXH 5ERWB 2UVFA 4NKIL 2FO4A 2OSLA 4Q58C 1WBYA 4AEHH 3X3GL 5J13B 1RZ8B 3UTSA 2CGRH 4ALAL 3I6KB 2MWCA 3KPRD 4N9GA 4R2GC 4WWKB 4FQXB 5DWUL 4EI5B 3OKMB 5A40E 4LEXH 4GW4B 3R1GL 2CPCA 5EOCJ 4IDJH 3L5XL 2IQAB 1E6JH 3TESA 2ARJA 1G7PA 4WHDA 1IBGH 1WAAE 4L8CB 3L5XH 3G6JB 1VGEL 3OAUL 3CD4A 1FBIH 4L8DB 3IT8D 3X13A 2AEPL 1G0YR 2AXHA 2E8ZA 5DWUH 2P5EB 4ZPVB 3PGDA 5E56A 3PNWA 3PWLA 3D5RA 3UTZB 4ALAH 4YC2B 2CGRL 1A7PL 4ZAKB 1QTYT 2C3WA 4A6YL 1CE6B 3HB3D 2YR3A 4HZLA 4JRYD 4XXDA 3VH8B 2EO1A 3QNXA 5D1QD 3O9WD 4YGVB 3B8SA 1FNSL 5FYKE 1YY8B 2X4SA 1BVLA 1MCQA 4L4VB 5I1IL 4PJ9D 4HXBH 1UJ3A 4WW1B 4BFIB 4LKXB 5IVZA 4ODXA 1WIUA 4HJ0D 3T8XA 1YN6B 3QUML 1HZFA 4X99B 4KROD 4K94L 4PJCE 3RBGA 4Z7OF 1PSKL 3FQXB 3D9AH 4QKXB 3CVIL 4LNRA 4M7ZC 4OZFG 2V5TA 1TVHB 4WFEE 4RDQF 2DKUA 4Y8AA 4CU7A 2NX5B 1A6AA 1G9MC 3QDMB 2VXSL 4LDOB 2CRIA 2DS4A 3MRIB 4Z76B 4WEBL 3WJJC 3RFZC 4N9OB 4N0UA 3TVMB 2D4DA 1F6AB 2XQYG 3MNVB 1RZKH 4MDJA 1XZ0B 4N1CA 1FIGL 3LY6A 4MYWB 1KOAA 1QRNE 2HH0L 4BFEA 4XAKE 1R5WA 1I8LC 4ETQB 2NY6D 2V2WA 3CFBA 4LCIH 2AEWA 4TRPL 1A0QL 3CX5J 2JCCA 1ODAA 1VEOA 3QDJA 3S5LB 2DQEL 1JRHL 2K7PA 5KTEH 4HK0B 2P8MB 1DDHB 1O7VA 4FQ2L 1IEHA 4ZUSB 1KJ2L 3RGHA 1JNHA 3UJJH 5IBLD 1P1ZA 4KK6D 5IF0B 5SWQB 4X6DA 3IETB 3HE6B 4ORGB 3LS5H 4M7ZB 3E33B 2P5WB 4ZUVA 5F89A 1RZGB 5E24E 1KCSL 3MACL 2WZPD 3OAYK 1WGOA 2ZCLL 4O5LH 1YQVH 2NY6B 3O2WH 4OZ4A 2HFFB 2BOBB 1IQWH 3T0EE 3UZEA 1GXNA 1Z9OA 3I6GB 4Y1AB 2YRPA 3MR9A 1BFVL 3GNML 2CDEB 1LILA 4XP5L 3TYGH 3V6FB 4O2CB 3NMEA 4HLZH 4FTVB 3BGAA 4OT1L 2OBGA 4ZFOB 1I1AC 5KSUB 4M7KL 4O51A 2VZOA 4R97C 5I1LB 5J1SC 4GTRB 4ZOBA 5D1QA 1NEUA 4YBQD 2AK1L 3SHSA 1NCTA 3ULVF 5F88A 4OZHA 4P59L 4AL8H 1ZGLB 1R76A 1URLA 5JUEH 4X7SH 4MD5A 3ZKSD 2VDML 4NT6B 2ZPKH 2YD4A 3PWNA 3ZZ1A 4FFVC 1OHQA 2HFEA 3TT1H 2K3TA 4Z7UF 1IT9L 3QG7H 3WSQL 2JELL 4KMTH 4NRZA 4Z7VF 5ITFB 4HQQL 2RHEA 4PJ9B 3MV9B 4P2QA 3D69A 4Y4KD 1U91A 4HFUL 4LRIA 1G9ML 3MBEA 4IRSA 5J1TC 3W0WA 1KCLA 2QLVB 2B5IB 4JG1H 2WIIB 2AJZB 2FGWH 3PDDA 4DVRL 1MPAH 3WIHH 3WUWB 2JB6A 4JRXE 3T0WA 1QFHA 2F54D 5EA0H 3TN0B 1BX2B 4PJ9A 5E9DB 4R0LA 4BQ6A 5DJXB 4R9HA 1K8DA 5CS7A 3LDBC 3IKKA 1KCUL 1YDPA 5D2NE 5BRZB 1A6WL 1R3KB 1U3HD 3ELAT 3C60B 4WW2C 4HF5L 1XGTB 5T3XE 1MFAH 3H42L 1LP9A 4JFPB 1IE5A 1MJJA 5DJZB 4LSDA 4FRWA 1WFTA 3EJYD 2QKIB 4I0PB 4L5FH 3EYUL 3B5HA 2HFGH 1X4YA 1CU4H 4I2XA 1A3QA 3ZE1F 4ONGH 4QXGL 1K6QH 3OXRB 3RWDA 3U46B 1N8ZB 4JM2A 1NDGA 1RIUL 3MRLA 5EN2B 5HPOA 2WWKT 3G5VA 4DGVL 5C0FA 1DR9A 1R3JB 3FO0L 5IQ9A 2HJLB 4IHOB 3RVTC 5ICYA 5HHOB 3FL7A 3VG0L 2F53A 4UB0L 2H1PH 4MMXC 3O45A 4U1IA 4IRZL 1GVIA 2LV4A 1S9WB 43CAA 4GRLD 3U4BH 5EULV 3VXUD 4HFWA 4UNVA 3PHOB 2AJSH 4H26A 5I8OH 2XZZA 3FN3A 2FB4H 3V4UL 5ADPL 3QDMD 3MOQA 3OJVC 4DZBA 1BQUA 1MWAL 3UBXI 3VWKD 4D3CL 1ZEAH 1P5VA 2FJHA 3VW3H 2XWJA 5FGRA 1Q9KA 2ZCKL 3A6BL 4JVUA 1IEAA 4KK5D 5IMKB 1ED3B 1ZOXA 4M03A 4CJ0A 3BPNC 3QXTA 1AGFB 2V2WB 3C2AL 4MGXA 2R23A 3MLXH 1WTLA 4Q6IB 3DBXB 3MRMB 4CVUA 1D7FA 3CNKA 4NZUL 1FV1B 1OL0A 5K33A 1DQQA 3UBXG 1I1AA 5A2LH 1RZ7H 3E3QC 1WV7T 3QFJD 3WIIH 4NKQB 2CDGB 3U0WH 3JTTA 5JXED 2OJEA 1TVDA 1FO0A 4G8GD 2BSTA 4NWUL 1J05B 3SY0B 2VLKD 3VRIA 5TH2A 1NDMA 1ULVA 3TFKC 4M00A 5F9JA 5K9QI 4ZODA 3QP3A 4XTRD 1X5LA 3IFPA 1VKXA 5E99H 4WO4C 4NUJA 1G7HB 4J3WA 1CLZH 3GJFK 2ZG3A 3CSPA 3P30H 2E7BA 1S7WB 2VLRB 1HKFA 2Y1VA 5HHVL 2AQ2A 4PJEE 1HHKA 2NX5E 1IARB 3V0WL 5J7CC 4KGJA 2VWEE 3MBED 4IRSD 3CCHA 4RNRA 4C1SA 5DRNB 5EBWB 4RIRB 3MYJB 3HC0B 4P46D 3BZ4A 1F6FB 2PKDA 4PRIB 3O3AB 4Y5VC 1KJ2A 1MFBL 3FZUC 3MXVH 4EUPB 3DX6A 5I2IA 3SE8H 2C9AA 2NZ9C 3QUXA 5C0IB 4P4KD 4PRPE 1I3RB 1RIVH 4J4PA 4E0RA 4X6FB 4K7FA 4D4CA 2F8VA 3FO2A 2XTJD 15C8L 3BUYB 5TE4H 3K7XA 3H7BA 4L8DA 2FO1A 2AABL 3ALPA 1T66C 3W0WB 1Q94B 3TIDA 1QRNB 3QCTL 1UH4A 3AXLA 1CGUA 1RHFA 5A16B 3CPLA 2P5WD 4TUOA 1MCIA 1R3IH 4NO3B 4QYOA 3OGCA 2YHGA 2HFEB 3B5GA 3BUTA 1UB5B 3C5ZB 1PZUB 3GMOB 3BFOA 1N3NA 1GGCL 4LVHC 3FOLA 1IC5L 2ZNXA 5FDWB 1MFCH 1WBYB 4PP2B 1EDQA 5D1QB 3T04D 5JHLL 4LEOA 2RAMA 1G6RH 4HBCH 2BVEA 4PGBB 1BBJA 4LHQB 1L6ZA 5IHBA 4UINL 3SKOB 1X5KA 1ZHLA 5IEHB 3R8QA 3X3FH 2NW3B 3ALWA 3MPCA 3MGAA 4GAGH 1WZKA 2R2CA 4X9FA 1I1AD 2PYEA 2QQLH 3QDHA 2EDFA 3TCLA 4TUJA 3MC0A 3N9GL 1XF2A 4L9LC 5IFHH 1HN1A 3KYNA 1MIEH 5EO0B 1CG9A 4IRJA 1OGTB 1H9VA 4GTTB 4IJ3C 3QNZB 1GHFL 5AZ2H 5FKAB 3FRPG 5B38B 3P9MA 4UAOC 3DHJA 3V4VL 3S88H 2W59A 5ICXA 3QPXL 1V7ML 3VD9A 3IRZA 5FDWA 4CW1B 1MVUB 3SDAD 3IS0X 2VSCA 3C5JB 3QUXC 3KXFD 3NCFB 4JEGB 4G8FA 4DJMA 4JFYA 2IAMC 2NOJA 1QA9A 1ADQH 5D2NA 4GKZA 3KJ6L 2FJFB 1G9NH 4D0BA 4JPKL 3HTLX 4APQC 3VXOA 4M1CC 3MA9L 4WU7A 3PDOB 2GAZB 2FH6A 2VR5A 5D2NB 5L8JB 1QNZH 3BGMA 1G7QB 3HCVA 1WLHA 2SEBA 3U7WL 4JFYB 5F7NC 1H8SA 1I1YB 3V0VA 4IJ3B 5FYKU 4L29A 3IDJB 4E42B 1AHWB 2R0LH 3DRAB 1BQHG 1DVFD 4G80A 4L9LB 2IGFL 1I9JL 5K9KA 5C0ND 4JHAL 3EHBC 4PRAA 2ITCB 4KKCC 3ZYJA 3JWNC 3VD4A 1UWGL 3QEGL 2FD6H 4GKSB 4IM8A 3UEZA 5C92A 4L3EE 2XY1A 1A14L 1WITA 4U6YB 5B38G 1Q9LB 1M6OB 4Y5VA 2BSED 1FJ1A 2M26A 1IAOA 1YEKH 4FQIH 5FUOL 4JHBA 3UDWC 3VD5A 1QR1A 5IHZA 1HHHB 2VLRA 2F54B 1XIWC 1VPOH 4RA3A 5LQBH 5TQ2L 4NUJB 2AJ3A 3RWIB 5CD3B 4BA8A 4JQVC 4W6XB 2C4XA 4LLUB 3QNXB 5INDA 1WISA 2VXSH 3FO9B 1F4YL 3W2DH 4M93B 5D2NC 1MY5A 2RCSH 4K9EC 2GK2A 2IBZX 3H8NA 4R7DB 2OJEB 4HKZA 3L5JA 2WLZA 4LIQL 4YDLB 3CFIC 1KFAH 3FT3B 3NOIA 2IALB 5DHVA 5JIIA 2NY4C 4DN4H 3V9FA 4NKOA 4YBLC 4XTRC 2G75B 3DBXA 4N0YL 4R2GB 5F7LB 2ARJB 2MSPA 3KR3L 4IRJC 2Q7YA 5L0QB 4JCMA 1O79A 1QYGH 1VERA 1P9MC 1XF4A 1W0YT 2QJDA 3CUPB 5K93A 5KANG 3KPRA 1KLUA 5IW1A 3MGOA 4E41E 5DMGC 5FO8A 2VITB 2XYCA 3RZCC 1X81B 2IH1B 4NPYA 1ITBB 2CD0A 1OP5K 5HGBB 4QXUL 1YEGH 2MKWA 5ACZA 2AEPH 1I9IH 1VPOL 3DV6B 5CBEB 1BP3B 4ZDHA 1TDQA 1OAYL 2HVKB 5GGVL 1X6NA 3V7MA 4FQIL 1U8LA 4WIQA 3MV7E 2EXYD 2M2DA 1IKNA 4IHOA 2D7NA 4XCYB 2GJ6B 2O5XL 1W6JA 2P43B 4OAWB 5CCKL 2GJZB 4K71B 4I2XB 4K3JL 2PO6A 5I71B 4WJ5A 5HHPB 4QHKI 4Q6YA 3MNWB 2IANB 1MOEA 5GGVY 4M76A 4FQCH 4GSDH 4LLQA 4CRPA 4CN1A 4Z7WB 1MHHB 5IM7A 1J0ZA 1L0YA 3CDCA 1B4JL 2PW2A 1JV5A 2J5LC 4TTDD 3MV9D 1S9XB 3VXNA 5I74B 1HNGA 2BSRB 1NBVH 2UY7A 2HMID 3DMMC 3K4DA 3V6OA 2C3VA 2GUOA 4UTBH 4NYLA 2JB6B 5T1MB 3DI3B 1YC7A 1REIA 4KKLD 4L3EB 3UBXA 1WAAA 1NCBH 5JIPA 3JTSB 1V7MH 3SCMD 5I71C 3CPLB 5A2IH 5DVKA 1S7TB 1QHOA 3MLRL 1WCBB 1GHFH 1I8KB 5F6IB 5I1KH 4D0CB 1YEGL 3LN5B 4JGJA 1XF3B 4YQXL 4FZEL 2EYRA 5I76A 4TULH 1HILB 1SJHA 5H35A 4IIQA 2ITDB 4YDJB 2AKRA 2XQBL 2YXMA 3LEVL 1NUFA 2Z92A 4MCZB 3JWOC 5DMIL 3MRLB 3SJVA 5FYLD 4U1MB 3OXRA 4DUXA 1KEGH 1YECH 3LD8C 4BH7A 5DRNA 1PLGH 3CCHB 4RNRB 1CDHA 1JJUA 2ENSA 1AJ7H 2XA8H 4RMVA 4O2CA 1HOCA 5IB3B 4Z7VB 3IDXH 1KIRB 3DSXB 2PYFB 4N0YH 4H1LB 3FN0H 5DRWA 5JR1H 5KBNC 1VKXB 5D7JA 3IFPB 5IKCA 4PJGA 2F8OA 4MAYB 4Q74A 3DARA 2WM0A 1YUHB 1DUZA 1UA6L 3K46A 3TCXA 3CC5B 4OZIA 5E9DA 1F4YH 5ACLA 5FV2A 5ALBH 1YMMD 1YNKH 3CVHH 5T1LB 4HS3B 4G8GB 5EORH 3WFEL 5ITBL 4LDEB 5EDXA 2OJZL 4WGWB 5C0CD 3VCLB 4MQSB 2CMRH 1QRKA 4F3FB 4CMHC 3QDAA 1CTNA 2EDKA 2OCFD 1UEMA 3CFBB 1DEEB 3EOAB 4QTHA 3RVVC 5HPMA 3VFNB 2V5YA 5D7IF 5SV4A 3DTXA 4ERSH 4POZC 4ELME 4E5XA 1BQSA 3LPWA 3FCTA 4EI5C 4EN3D 2V5MA 2FD6L 3KVQA 5KOVC 3VI4E 2J4WL 1VSCA 1CXKA 2VZSA 4UUJB 2J88L 3UTTB 4Y16C 1AGEA 3IDMA 5DGQA 1OLLA 4PGCA 5ESVB 5HDQL 4YLQT 1CE1L 3DPBA 4LLQB 2VLJB 2NY6C 4L3AA 5DSCA 4J1UB 4KDTC 1HH9B 3WDJA 1U8JA 3OF6A 1MJUL 3LKPA 3FB6B 4LSRH 5J3HD 1EVUA 5AZEH 1EERB 5EU5A 1TJHH 2NY4D 2QSCL 3MSPA 2X4TB 12E8L 2LABA 2IFGA 1HI6B 4W4OA 3RTQC 2CJUL 4GRLA 2P8LB 1M7DB 1HQ4B 3LKPB 2MTPA 3MCKB 1ADQL 4KV5F 3LSOB 3ZE0E 4PG9B 3RWEB 3UDWA 1LO3L 2DQJH 2EYSA 2ZISB 5E8OA 2VDRL 1QSVA 2A2QT 2HKFL 5IF0A 2ZKHL 2VDQH 4M9PA 3SJVB 1E4JA 2EIBA 1FO0H 2FECL 4NUGH 4ZDHB 1OP5H 3AMLA 1K5NB 3EFDL 3VGAB 4N0RA 4ZAKA 1ZLVH 1UYWL 3QDJB 3RA7L 1F11B 2FR4A 1JI1A 1YDPB 3HC3H 5HI5C 3EAKA 5CUSH 5HI4D 1DEEA 3EOAA 4QTHB 3MUJA 3ARWA 3G6JA 4YIQB 4DEPC 3T0BA 3ABZA 3QT2A 4KRPB 4E41B 1MELA 2FBJL 3SBWC 1NFIB 3QYCA 5FUCE 2F8XC 3EJZD 3WN5B 3U4BL 4OD3H 4OLZL 4RBPK 1F6AA 3MNVA 5DJ0A 4OFYA 2Q7YB 4PRDA 3RL2A 1KNOA 1VENA 1S3KL 3WO3B 4HS3A 1C5CH 2AW2A 3CFDA 4WW2F 2RFXB 4LLAA 4L8SA 4MAUL 4RBPH 4WI6A 3WIFB 1JHLL 5B8CB 4ZO6A 2VC2H 3SKUD 5CJBA 3FHAA 4HKBB 4MWFB 3SKJL 3IDGB 2FO4B 2OSLB 4YDKH 4M1CD 4X8XA 4Z7WA 1JPFA 2IANA 4TNWF 2HJKA 4OZFB 4JJ5B 3C8DA 2W38A 5D71L 4QRUB 4XB8A 2WUCH 1KGCE 4MJIA 4L4TB 5F8RC 3L1OL 3O6FC 1LK3H 5HYIA 4YGVA 4Y5YA 1I8LA 1D6VL 3UTPD 2ITDA 2R39A 4KKCD 2F58L 4LSUH 3DOSA 3OKEA 4HD9A 2NW2B 1ZANH 3F7VB 4GMSL 2A0LC 2P5EA 3WJJA 5FO7B 2P5WA 5CBEA 3ARXA 3JSSA 3PL6C 3QCUL 4FNLL 3KLDA 4ORGA 4PRAB 5EUKA 1WCBA 2FL5B 5E70A 2O5ZL 1EIBA 3BGFB 3UTSE 5L88L 3TYFB 4NHUA 1T20B 3ET9F 4KUZL 3L7EB 4X6CF 3OR7A 2UYLA 1CLZL 3UO1L 3ARYA 1I1YA 3V0VB 5GS1C 2ZUTA 1RQ5A 3F65A 1A7RL 1N0XL 1OGAB 3E1F1 5DK2B 5HHME 1O1RB 1IGIL 1T5WA 4NNPL 5IBUG 2E9WA 4BSVB 2NYYC 4ZPTB 4X9GA 1MZCB 2N7BA 3QUXD 1RZ8A 2I07A 4DQOH 3V8OA 1RV6X 5GS0L 2V3NA 4EI6A 3F5WB 1QBMH 5KAQF 1LO4L 5CGYC 2LTQB 2VDRH 4PTTA 1BBDH 3PWVB 3HQAA 1PQZA 3FT3A 5ICXB 5I1DA 4OUOA 5DYOB 4TNVK 2GK0B 4EJ1C 4F57H 1TITA 3NIGE 1N2RB 1YQVL 2HT4C 2EDOA 4XB7A 1S9KC 2ZCKH 5INDB 2A9NH 5HYSG 1PKQA 3SGJA 4XPFL 1N5AA 4ELMA 4S1DD 1U92B 5GGUA 5JTWA 3E6FB 3KXFA 4GAYA 2V2TA 1KJ2H 3VXMB 3BXNA 3SFXB 5I18L 5JQ6L 4YR6B 1QLRA 1RU9H 3Q7AB 3FFDB 1IVLA 5F7EL 1Q9LA 3IGAA 1XCQB 1T7WA 2VE6A 2X4SB 4FTVD 1J1XL 1SY6A 4PV8B 4Y4KC 2PNDA 5HHOD 5HI3C 2V5SA 2CIKA 4OD2A 5E2UH 1YMHA 4AZ8A 3OXSB 1AR1D 4ZSOE 2DQIL 3Q48A 4L9LA 2VDOH 4TTDC 4LMQI 4FFVD 2D7MA 3WFHB 4OGAC 3BP4B 4HUUB 4XP4L 4F58L 4MA3B 2OJZH 4I18B 3VFPB 2NY1B 3VGBA 1MVFA 1YEEL 2YD5A 4QXGH 4PJGE 1JTTA 4ONGL 2K1MA 4WEBH 3CVHL 3WFHA 3SGKC 2CKBL 1G7PB 4BOKA 4R26H 4NKOB 2DLFL 4KI5E 3N1PC 1KTDB 5JW4N 1HHGA 1NCAL 4I18A 3TJHC 1QFWI 1PSKH 1B0RA 1QA9B 1EBAA 5C0IA 4JQXA 3HXFB 4Y4FB 3C9NB 4PJ8A 1KJVA 4R7DA 3ARUA 3RUGE 1UM5H 1OOAA 5GRVL 2CO6B 4M6OL 5DUBA 2H41A 1JGUL 1P2CB 5CSZA 2H6GB 3SE3A 5B38A 1N9AB 3C8HA 1FG9C 5DMYA 2ZOLB 3IXAB 5DJAA 1OM3L 1CR9L 1FNSH 2EIZB 2FATL 1XGQA 4HFUH 4R4NC 3VXMA 1F4XH 5GS1B 5C71A 2V2TB 4P9ML 1I7UB 4WW2A 4Z8FH 1SMOA 1G7IA 2BXZA 3L95A 5DJDA 1YEDA 4EQ3A 4PJ9C 5DYOA 1BVKB 3X17A 1NAML 4GKSA 3HFML 4K94C 1MRCL 2UWEF 3KJ4B 3VWJC 2OTUA 5GRVK 1ZXQA 4MNQA 5SWZA 4WGVB 1C12B 3G9VA 5FA3B 2X4QB 1DZBA 5KSAD 1RPQA 3NN8A 1AHWA 2AI0L 1S7SA 2YXFA 4RAUA 5T3ZD 3FO1A 5HHNA 1E4XL 1RULH 4WV1B 3D39A 2HT2D 5KVDL 2N56A 5IOPA 2VIRB 1SEBB 2BY0A 1TQCC 3MJ7A 5JNYA 3DUSA 2VXUH 3Q6FA 1YPZB 4PJ8C 5MEND 3VFTB 2VLKA 4M7LT 3X3GH 2CKNA 1MHCA 1Q94A 1JN6A 1MEXL 4N8PA 4NNYA 2HLFC 4FQCL 4YEEA 4V2BA 4NOFA 4CVXA 1PFCA 2J6EH 2RBLA 1LWRA 2A6KA 1NGWB 3VFUA 2IEPA 4G6JH 1IQDB 1BMGA 4DGYH 3S4SG 2VOTA 3RVTD 4BQ8A 1CG9B 2CLVB 4XNUL 2VISB 2MNUA 2NW2A 4N0CD 5FM5O 3UC0L 2YZ8A 3RIAK 1QSFD 2V8KA 4ZS7H 1XR8B 3QXDA 5SWSB 3BEWA 3ILPB 1H3CA 3WL9A 1MRDH 5C0FB 5C6TL 5F72S 1RZJL 1BBJB 3EJJX 3D18A 2VQTA 2DQGH 3BEVA 4QRUA 3Q7FB 2IMNA 2BRRL 2AXGA 1EGJL 4M6NL 4XVUC 3HZYA 4P9HC 4JFEB 3CK0L 1W0VB 5I30L 4MHHG 4PJDF 4WB2A 4LCWA 3BPCA 4LOUD 2IF7A 4XNUH 4O2EA 2IMMA 1SY6H 4HS8H 1MH5B 4OF5A 2YMXH 4PRDB 1TZGL 4LARH 4MJ4A 3GUTB 4NO3A 1KZPB 3PDGA 4HXBL 2AJXL 2GKIA 3IJHB 4XBEH 2JJTC 3RX7A 5IHUL 4MXQC 3TV3L 2X89A 4OZHF 1J0KA 4Y4HC 5IGXL 5JIKA 3BPLC 3GI9H 2C1PB 1H36A 1NLBL 5BS0B 1KB9K 1WWWX 1HCVA 3HAEH 3MRBB 1U3ZA 4JKMA 2JJSC 4G9DB 4HWBA 3DO3A 1F45A 5FV1L 3Q3GB 4HUNB 2CH8A 3H9YA 1MRFL 4I48B 3L3OA 4UU9C 2BDNH 3OJMB 1P9MA 5DC4B 2YD3A 1BVZA 3RI5F 1MCPH 1RZFL 3KYOA 3F7YA 3CGTA 3DROA 4MNQD 1BLNA 2O93L 4Y1AD 4LBEA 1KC5H 1IBGL 4OQTA 1M7DA 2OZ4L 1S7WA 1L9MA 1YNLL 3RWEA 2BNUA 1CVSC 2GOXA 5JO5B 3LEXB 2VABB 4NKDB 4GXVL 1AC0A 3DVGA 4CAGA 5EN2A 2DJSA 2VUYA 4KTEH 1NDGB 2CDEA 1HH9A 2D0HA 1M71A 2CR6A 2XACC 2VLJA 3VJ6A 1JWUB 4FZ8L 3DGGB 5EU5B 2BHUA 4XRCB 1L7IH 3CZFA 4X4ZA 2EH8L 2VXQH 4XCEB 1CF8H 1CT8A 3T3ME 4CVZB 1CR9H 5C0CB 1BJMA 4QGYA 1FV1A 1OSPL 1SJVA 1C8PA 2VZTA 5CEZE 1JGUH 1G0XA 4P4KC 4C83A 5IB2A 1RZIB 2AV1A 1MCNA 4K8RL 1NKRA 3DIFA 2H26B 1NGZB 3NAAL 1DTUA 2VLME 1T0PB 3S5LA 1G9NL 1ZLUK 3RVXD 4Z77A 4U05A 5CJQH 3T65B 3WYRA 2PTUA 4KZEL 3QXWA 2HLAB 2GITB 5IESL 5IIEA 3IAQA 2DLFH 2XKNB 1RZIA 2UWEB 3GIZH 4DAGL 3IFNH 3OF6D 1J8HA 1T03H 3TT3H 5F6HJ 5C0RL 2FECI 4IMLA 1BEYL 4AJ0A 3LKNB 2KQNA 4PJ5A 1ZLVK 1EHNA 3ARBB 3DSWB 3L6FB 4KAQH 2FLBT 3OEDA 4XVSL 5JOFB 4ORZC 4GAGL 3CSYA 1YYML 3W11D 2BNUB 2EC9T 4R4ND 5JO5A 4X99A 1RJCA 4LLDA 1CICD 1F13A 5I1LA 5IVZB 3EKCA 4OZGB 4RGMB 5KSAB 3HXDB 1RU9L 2MPAH 1ZK9A 5HHQB 4ONFH 3CSYB 3HS0A 1A1OA 4WO4D 1B88A 2P8PB 2CSPA 5FECB 4WY7L 4BFBD 4HC1A 5C08E 3QEQE 3MOBH 2LFGA 1OCWH 3U0PB 1B0WA 4N8VG 1DFBL 1XF3A 2CLVA 2L7UA 2YPLA 1QBQB 4D4AA 3EJYC 3RKDD 4F7MA 5DS8A 4F7EB 5F7MC 3V7AG 4LCUA 5CBAA 1SJHB 5D7JC 1ETZB 1R3IL 1CD9B 2RQ8A 4I4WB 3RZCA 3KPLA 5AYUH 3VI4F 4DKEL 3H9SD 25C8L 4UU9A 3RL1A 3QCTH 1MCRA 4CVXB 1MREH 5GRJL 1KIUA 1CL7H 5D1XC 2F19L 3IJHA 3RKDC 4NZTL 4K7PY 4Y0GA 3EYOB 3U2SA 3H0TB 3TWCH 1LNUA 3MRFA 3GSWB 4LLWB 2Q6WB 4NRYB 3RVWD 2EC9U 1NFDA 2UVEA 3O6LH 1JMZA 4O2EB 5IG7A 1JZ5A 2ADIB 4YHPB 1XZ0A 5IM7B 4OCXH 5T3XH 1MHHA 5F1OB 2OQJB 4FFWC 1MFNA 5SWSE 4PD4J 4NCC2 1RJYA 5ESQA 2G2RB 2AXGB 5HHVH 3RWCA 1CFTB 3W9DA 1C5BL 4OFYD 3STLB 3UX9B 4G6FB 4F33A 1O7SA 1VACA 2GJZA 3AFLA 1UQSA 1FE8L 1JZ7A 4YHYC 4GJTB 2EDBA 1EXUB 1ZANL 5JA8B 3NCYS 2V9TA 3BO8B 3AS3A 4M43H 5FGSA 4XPHL 3PQYB 1MLCB 5F6HI 5DI8A 5CINL 1ES0B 1NUGA 1RZGA 4PB9H 4DW2H 1MI5B 3LB6D 4PJEF 1QQFA 1CXIA 3L1OH 1U42A 2GJ6A 4XCYA 4CJ1A 2Y07H 1OAKH 1MREL 3U9PH 2COQA 3ZKXB 3LEYL 3KPMB 2Y72A 5B3NA 5F70A 3AB0C 2VITA 4TUKH 2XXMB 3SE9L 3PGFL 3WFDH 3F6IA 3Q3GA 3PJSB 1PX4A 5INCA 3QIBC 1T04B 1IM9B 2VTFA 3U1SL 4HGKC 1AFVH 3S36H 2IAMA 5KZCB 4YHLH 1GGYA 3O4LB 2NY2D 1RK0B 2ZNWA 5JPNB 4QOKA 2V3PA 3V4UH 3CUPA 3RJQB 5I8OL 3BRDA 4RGOL 4JRYB 2R8SH 4RGMC 5GGSA 3T2NL 2L0DA 4OLWH 4JN2A 5JZ7D 3IFLL 1ZA6A 3MJ6A 4OCSH 2JK5A 1IM3A 5F8QC 2D31B 2EH7L 1J8KA 1LD9A 4NQCD 2CIIA 2DKSA 4XI5C 4JZJA 4MA8H 1GPOL 4Y16B 1RIUH 5EUOF 2FWOA 4OGXL 1ACYL 3DMMA 3KS0H 2O61A 2YA1A 3BEVB 1LD8B 2PCPA 3JV6B 2BSSB 4PJXF 2FSEB 5L7XL 3GHBL 3IFNL 2DQFB 2XTJC 5HYJB 1J1PL 4JZOB 3PZ3B 5DVOA 3ZDYE 2EO9A 4TPRL 3E6FA 4Z7QF 4KTDL 1NCUA 4ZFGH 4DKAA 1JPST 1CGVA 3DMMB 5D7SL 2JJVA 1P2CA 1NEZG 1CS6A 1EZVY 4NCDA 5GZOC 1SQCA 4MCYA 4MXVE 4PP1D 2QSVA 2AK4A 5MEQA 5SX5K 2D31A 5AZEL 1VGKB 2NY1D 1DANU 5EWIH 3BWAB 3I02A 1FSKC 1O6RA 5HYSA 1BZ7A 4OIIL 1QD0A 3SDCA 5MEPB 1WBZA 4KK6C 1TETL 3QIWA 2YPVH 1G9MH 3QIUC 4L8CA 2EH8H 3KPQB 1FT2B 4AY0A 5FKPA 1K4CA 4FZ8H 4LK4A 3NCYP 1JUFA 1BQHA 4P46A 3RI5K 3TT1L 3BQUD 4POUB 4HJJL 4C4KO 4I0PC 2FX9H 4EUPG 4X7SL 1UACH 2APXA 4JFHE 5JUEL 3OXSA 1FGNL 3MRCA 4EN3B 5BVPL 5ESAB 4KH2A 5E8EA 5HYEA 5DJCB 4JFFE 2Q7NA 4PUBH 3GO1L 4HK3N 2FBOJ 3BW9B 1CL7L 5SWZB 3HUJE 5GRXG 3MLWH 4MNQB 3K8KA 3FB8A 1QLRB 1MCPL 1HSAB 2HRPH 4FQ1H 3BSZH 1RURH 5FYLH 25C8H 3ULUE 4EUPH 1XF2B 1WT5C 3QNYA 3HE7D 2NMSA 1DL7L 4KUCF 1DANT 4OM0L 2Q76B 2ZCLH 1I7UA 3EFFA 4ZH1A 1PKQB 1XF1A 4P5KB 1OGAE 5HHMB 5J6HA 4P3AA 1UWEH 1NFDE 3T4YA 2YD8A 2FLRT 1NI1B 2HT3D 1DSFH 1I85A 3W9DB 2F74B 4RAVA 1PQZB 4G9FE 3L3KA 5B39G 1JE6A 5JORA 2AS5M 3SO5A 4H0HB 5MENA 3IDGA 5DMIH 2OR9L 3EUUA 4HKBA 4MWFA 3WXVL 4EI5D 4EN3C 1NMAL 1HHGB 1G9NC 3DETC 4LQFL 1JHTA 4XVSH 1JZ4A 2EDWA 3OX8B 4P48A 1A6ZA 1KPVA 5DK0B 2AJUH 4WV1C 5A16A 2A6JA 1FG2B 2A1WH 1Z3GL 1MCWM 4NZDA 3U9UB 2ESVA 3MLRH 3QEHB 4WFHE 3TT3L 1T03L 4PY7B 5DRXB 4HV8B 4F8TA 4LL9A 3NFPA 1U36A 3WDIA 5EC1B 4U7KA 5D96B 4ZS7L 3QO1A 5CBAB 3BUYA 3PWPA 4YZFF 3SGJC 4J7RA 4MLIA 4UTBL 4Y2DC 4OFIA 1SJXA 2IJ0C 3X12B 1BIIB 1MFEH 1QFOA 4RIRA 4ZUUB 5H2BB 3ZHDA 3FQTA 5E94A 3VXTB 2R1WB 5EU4A 5BJTB 4YR6A 4NQDD 3SN6N 3K2UH 3MV8A 5EUOA 5DJ6B 4PP1C 3WFBL 3WXWH 4FP8L 4GBXD 4ZYKB 1W72L 5F7DB 4Y5YC 3IXTB 3W82A 3ZL4H 2WQRA 4JZOA 1B6DA 1H3UA 3WS6C 4X4YA 4LSVH 5CJOL 4JFDA 3TA3C 1MLCA 4U3HA 1JPFB 1OAZL 4YFLI 2H32A 4TVPH 3SQCA 3JTTB 3OB0K 3K74B 1J87A 3ZYIA 5TE7L 5C0BE 3GSQB 3IKCB 5L2KD 4O2FB 1U3HC 2O5XH 4QRRB 3WIFA 4XC3L 2AJVL 1CYGA 4JB9H 4UIMA 1DUYA 5GGVH 4Q6IA 3S35L 4LCYA 2J3SA 1E6JL 5IJVA 5T5NG 1ZA6B 3FB7B 4RISH 4P3CH 1G7LA 3NCBB 3V5HB 3CAFA 4H20H 1I9IL 2W0FA 2APTA 5T33H 4EOWL 5TE7H 5FGBA 1NFIA 2A6IA 4V1DB 2ADIA 3DV4A 4XBGB 1J18A 5C0GB 2FJHB 1KCRL 3MCLH 3G6DH 3DIFB 4PB0L 4NHUB 5DZLA 3TYFA 4TVPE 5JPMB 5DMKB 4TNWK 1NC2A 4IOSD 4D9QE 3ARDA 3MA7B 4KFZC 3TA3B 4GTMB 4ODWB 1DN0A 3LH2H 4H26B 5C1MB 4J3TA 3F7VA 1M4KA 4UILH 1VEMA 1BOGB 5B4MD 1R3LB 1XGYH 5DXWA 4G3YH 1X9QA 1PBYA 4D4BA 4JZJC 3C09C 4GTOB 2MCPH 4I13B 2F53B 4XH2A 1OF2A 4LQ1A 3REWA 4PJFE 5HHOA 3MXWL 3RX5A 1NC4B 4PREB 5KS9E 3LQMA 5I30H 5IROA 5DJYB 3DVFA 3DO7B 2P47B 1EJ6A 2XZQH 1UQSB 4M5YL 3LN4B 1IGML 3GBNL 5IWLC 1E6OH 1CIDA 2YBRA 4V1RA 2VYRE 4Z5RA 3QZWG 4LLDB 2NY7L 3RNQB 5E7FA 3IDMB 5DD5H 4I6OA 4WHTA 5ISZE 3IF1B 4TSCH 4Q9QH 1FFOB 4HKJA 2OQJA 5H35B 3RWJA 4U1SA 5KSBB 1MJJB 5DJZA 3K1KC 2W60B 1HCFX 5T1DL 4MJ6A 1T21B 5E5MB 1AHWC 1GZPB 1IAKB 1ZT4B 3LKNA 3B2UC 4IMLB 5I75C 5DVMA 4G6FD 2W91A 1LDSA 5J1AB 2PO6D 4YE4L 1S7TA 4H8WL 1DQJA 4P49A 5LGJA 1BX2A 2Q3AA 1IGCL 3UAJD 3KSQB 2YPKB 5DURD 4CVWA 3MV8D 3OKNB 2NR6D 3QDJE 5TDOB 4JG0L 2OP4L 3GMPA 3TNMA 1T0MB 2PW1B 4UU9B 3MV9A 4P2QB 5J8OA 2E6QA 5IB1A 4ZG1A 2BNRE 2R69H 5ITFA 2X9WA 4KJPC 3P4NB 3DYPA 3IF1A 5F88B 3BHBA 2PYED 1UJ3C 4OLEA 1TJGH 2PW2B 4JZNB 5GHWH 2EDTA 1BBDL 1ZV5A 1L4IA 3O6ML 3DXAA 1FFNB 4PUBL 4P2RA 5CP3H 4PYHA 4P5TD 3V4VH 3DO7A 2XN9E 2H6FB 1KPRA 3NIFF 3O8XD 4KPHH 5KSAA 4PV9B 3PV6A 3SO3B 4YDOB 3SDAB 4LRNH 1XFPA 5LAXB 2R1YB 5FYJU 1TENA 1S9VB 3BOVA 1IGTA 2P44B 2VISA 4P2CG 5KSAC 1LP9E 2BNQD 5ISZD 3WE6B 4I9WD 1H3TA 5DJ8A 3WKNA 2KKQA 2WANA 3GJEB 1BGXH 2HFFA 4OIAA 2WWMD 3RVUD 1NCDL 5GZOD 1NGWA 4L4TE 2FEEI 4CN6A 3U36B 1OM3H 1QG3A 2J8UE 1JGEB 4OIIH 4RWYH 2IH1A 1RJLB 1EEZA 4JM2F 1CFQA 5IR1B 1YYLL 4A6YA 4OCYL 3JTSA 2F58H 2NXYC 5D5MF 1GCFA 2A9MH 1R24B 3MV7B 1EFQA 3U30B 5IK3A 5C0GA 1EK3A 4GXUN 4O02H 3LS4H 3C5SA 3QO0B 3RPIA 4HPOH 2XQWA 3FO1B 1CXFA 4MD4B 4KTDH 2ED9A 2OS7A 2YKLL 5I1AB 4M48H 2V2XA 3RZWA 1AXSB 1IEBA 5FFLA 3BPLB 3LAFA 7CGTA 5D7IA 4OGXH 3TBWB 4YC2C 4ZAKC 4YDKL 3VFOB 1CFSB 5HYSB 4FXLA 4JFXB 4F58H 4NM8L 3I75A 4NBZB 3T8XB 1GPOH 2H32B 2K7QA 3F8UB 2CKBB 4WI2A 1JK8B 4HGWA 4XP6L 3C8KA 3QQ9D 4Z7VA 2W65A 4K55A 3VE0B 1TTUA 1XMWA 4BQCA 2DL2A 5IV2B 2LU4A 4X5LA 1KXTB 5DVNA 4H0IA 5CKAA 5IHZB 3U0TB 4YH6A 4URTB 5DUBB 3AS1A 1JPTH 3MLSH 4GBXC 4WUKH 3E3QE 5CGTA 3X11B 2DQUL 3BD3A 2ZSWB 3OV6A 4P4RA 4F15B 4U7MA 2PCPB 4RGNE 1BIIA 4ZUUA 4TN9A 5H2BA 2B4CH 1H15A 2JJSA 1TNZB 1P4BH 2NY0D 1JVKA 4HZLB 4XXDB 3K0WA 4C56A 4ODSH 5DJ2B 5EPMB 5IW1B 3T08A 1DBJL 4D8PA 4D9LH 4TUKL 3ARTA 2JJTA 1GGUA 43C9B 2ICWI 4GT7A 3WNMA 2DI8A 1WEJL 3H9ZA 4NZUH 5CSGA 3WNKA 5CINH 3B9KA 4QHKJ 4CL7A 1S7XB 3DSFL 2HJFB 4AEEA 4ZAKD 4U1LA 4F15C 4WCYL 2NY3B 2OL3L 3VXNB 1YMHB 2QQNL 2CIKB 4TQEH 1FE8H 4LNBB 1FORL 1ORQA 3D39B 4NJ9L 3QZWB 5J12C 2ATKB 5CEYA 4FXKA 3EOBB 4JHZA 2IADB 1W0VA 4MS8C 5DFTA 1MVUA 1RZKC 2XZAH 1AD0A 2A74A 4RFEA 4X0KA 3TIEB 5IFAH 4X80H 4NM4L 3KLAA 1CXEA 4YHIB 3SGEH 1PAMA 3QCUH 4FNLH 3U6RA 5IBLC 5J6HB 5E5UB 5T5FH 3F12B 2YWZA 4BZ1L 3KYNB 4LHUA 3VG0H 1JFQH 1FAIL 3VDBA 2CUHA 1QLFA 4DFIA 4ODBD 2HP4A 4U6YA 2YC1A 3JUYA 4OF6A 4R0LC 4G5ZH 1FHGA 2VXVL 3FQWB 3TBVB 2F19H 4JO2L 4ZXBA 1LK3L 4Z7UE 4K3EL 4CMHB 3STLA 5K9KB 4GS7B 1F3RB 4MNGA 3RWCB 3BQUA 4ZFZB 4FG6C 2F5AH 3E0GA 1FVDB 5EG6C 1J8HD 1GGBL 3BKJL 4LPTA 4R90L 4BSVA 3O8XC 5J9PB 1B0GB 3MODL 2P5WE 4G7YH 3I6LD 4QRSB 3SKJH 1NFDB 2WP3T 4HF5H 3V2AR 5EBLB 2GTWB 1NSNH 4WY7H 4XT1C 3OWEA 4PJHF 3MJ7B 2YPLD 3IDXL 5FOBA 2XKUA 2HTKD 3SDCD 4KJYA 1CD1B 3KS0J 1MI5E 1AGBB 2WWKO 1C1EH 3EYSH 43C9A 3FO2B 1EO8L 4N8CL 3BZFA 1RFDH 4X6FA 1FZMA 3PL6B 4XNYL 4F9LA 4U0QB 4MD0A 3PZ4B 3LIZL 5LGHL 3KPLB 4I3RL 3SDDB 5J57B 3ETBF 3NTCH 1EJOL 3AS2A 4KMTL 5FKAA 4NC2B 4HJGA 2OXHA 4YQXH 5F1NB 5C08B 3MUZ1 2F5BL 4HC1H 2ID5A 4MXVF 4R7NA 5FYJE 4JRXA 4CMMA 4F7CA 4PD4K 32C2A 4QRPA 2GY5A 4HCRA 3QHZH 4U6HB 2KQMA 4Z95H 4KQ3L 4L4TA 5KZCD 3HS0B 3TO4D 1M05A 4LVOC 1XAUA 5DA4A 3WNPA 1Q0XH 3IFOA 4GLRH 1WC7B 5GJTH 4ENEC 2EIZA 2ZKHH 2NNAB 5D7LD 1WZMA 3LPFA 1TN6B 2FHBA 3F7PC 4PP2A 1WT5A 3B9KD 2VLLB 3QWRD 1J05A 5EOTB 3IDNA 5I66B 3D5OF 3P4MB 5GRUH 5IMLB 3CFCL 4PJ5B 4NN7C 3UMTA 1N94B 3PWVA 2D4FA 5I8KH 1OSPH 1RD6A 4TOYH 5D1XA 3QCVL 1HDMA 4ESKA 1AXSA 3KDMA 2EDEA 2G60H 3ECBB 1WWCA 4PRID 4E41A 3NZHH 3PDOA 3IU4H 5C0AA 4OGYL 1MJ8L 1KLGB 5LCVL 1PG7X 5TFSL 3D0VB 4PJBA 3VXSA 1UJTA 2JB5H 1UXWB 3V5KA 1YJDC 1IEAB 4YFLF 4YDLC 3ESVF 4M8QB 3V6BR 3VU2A 1FZKB 2XWJB 4MMZC 4QF1B 4X4ME 4ODTH 3JVGC 3MRKB 1Z9MA 4JFZH 5AG9A 2PTVA 1TLKA 3KNBB 3C5JA 1EAPB 4H1LG 1AH1A 1J7VR 2AV1B 5CZXD 4J4PD 3GB7B 4RRPG 4R4BA 2XT1B 5IBTH 2IAMD 2DWEB 2UZYB 3T2OA 1QP1A 1NUDA 2DLGA 4WTZG 5F9WC 5BS0E 4DKFL 3BE1H 1E6OL 1CT8B 5KJRH 4Y4KB 5CJ5A 1YNKL 2XICA 3CDYA 3GHEH 5EU7C 4D94A 3GIVB 4GAYB 3ARGD 5ICYB 1MRFH 4G43A 4IDLA 5AUMA 5L2KA 1U92A 3QQNA 3BYYA 5IQ9B 1IRAY 1VCAA 3TPUB 1QFUL 2EIDA 3SGEI 3FB6A 5E0QA 4Y5YB 2EZ0D 4K9EH 5TH2B 5C0EA 3QUMB 4K94H 3S3PA 1NCWL