5JPNB

Structure of human complement c4 rebuilt using imdff
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
719
structure length
697
Chain Sequence
PTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
total genus 178
structure length 697
sequence length 719
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 5jpnB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpnB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpnB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpnB04
1JWMA 1NFDE 1C5BL 2CKBL 4FTVA 1GZPA 1N6VA 4KJPC 1NFIB 3QEQB 3TCXA 5GGVL 4NZTH 4AY0A 2CK0L 5HYSB 2UVEA 4GJTB 5HGHA 3K8MA 3QDJE 4YHLL 3NTCL 5DRWA 3TIEB 2W92A 5FA3B 2FJHB 4E42A 5GGRB 1Q94A 2NY7L 1W0WA 5FV2A 4XC3L 3HCVB 3WEXB 4JZJA 5FDYA 3O4OB 3GMNA 3LZFH 5ITFA 3LEXA 4WENB 2HRLA 2FEEL 3DPYB 3LPFA 4UIMA 1X6NA 1WUNT 3G5ZA 5B39G 4Q6IA 3HKFA 5DVLA 3Q73B 5D6DC 4OGYH 1ZTXH 1R3JA 4NQDA 3FQUB 1AR1D 4LF3A 1N64L 4D3CL 5C0EA 4G6FB 4AMKH 4CU6A 1FFNA 1Z3GH 5EC1A 3D2UB 3W39A 1T04B 4FTVE 1UKQA 3RGHA 2MPAL 3G9VA 3IDGA 4JZOB 2ICEB 3KDMB 3SE3A 4KKAD 1DANT 3GMQA 4U6YA 1X5ZA 3ZTJH 4Z9KB 5D71L 3PGCB 3KHOA 3HPLA 2MCPH 5FYJE 5LBSL 1MFEH 4NUJA 4M03A 5EU6A 1NEZB 5I8CA 4FFZH 3HQBA 4U1GC 4A6YL 3B9KC 1XF5B 5F8RC 2DBLL 3WNNA 1Z5LA 3I85A 1K85A 4FP8H 3O9WC 2R1YB 2R56H 3ULSA 1FG2A 3HG1B 1KGCD 2EXWD 4R8WL 2F8OA 2UZXB 3CMOL 4HJ0D 4K3HA 4P3DA 4NQDE 1H5BC 2O5XH 2RR3A 5HVWA 3KYMA 5GGTA 3SFYB 1V5JA 4PG9A 1MI5D 3EUVB 4HEPG 4HCRL 3VCLB 4GW4B 1F5WA 1FNSH 3TH3T 3VXUD 2YRPA 3GUTB 3IDJA 2W07A 3CH8A 3DMMB 2NY0C 3B43A 4FXKA 4U7MA 1QD0A 4DWHA 5C0RH 1C7TA 1QLFB 2Y72A 1TZIA 1RPQA 1BQUA 2HRPH 3B2UC 2VAJA 1AO7D 4LSRL 4FZEL 4LLDB 1NL0L 2ZOLB 4E5XB 4J7RA 4NQCA 5ESVA 1KG0A 2D3VA 4G6FD 1WTGT 4K3JL 4PGEB 2IF7A 3ALXA 3KYKH 5BZWA 5EU6E 3PQYB 1A47A 4XBGB 3QUMB 3EOTH 4QXUH 5E99L 1YY8B 1K5NB 2APFA 2LVEA 3QJHB 1BFVL 3VGGA 4GKZA 5C0JB 4Q0XH 2DDQL 4MA3A 2AJZB 5FGCB 2EKSB 1IAOB 4BSVA 1EAPB 3O6LH 4LLYA 1E6OH 1IVLA 5HYJB 1RZFH 1S9WB 3GIZH 4PJ9A 1YMHB 4WW2C 4UV4L 4X4YA 3GO1H 3MLSL 3TN0D 1VFBA 2CRIA 1EFXB 3DETD 4MNGA 1N6QH 3HG1D 2MWCA 3BEVB 3HE7A 4WO4C 1R5WA 5LCVL 5I1DA 4HWNA 2BFVL 3BZEB 1I7ZB 1XF1A 3T77B 4Y8AA 2VLKA 3D9AH 4X8XA 4NQCE 3RWEB 2DQGH 4JQVA 1U3HC 3DMMD 1KTDB 4PV8A 1ZA3A 3PP4L 3UC0L 4U2ZA 3QO1A 4KK6C 3FB7A 1BVLA 2XG4A 4Y2DC 2C1PA 1JFQL 4LASH 4P23D 4NRYB 3HZKB 4NBXB 4PJ8B 5E5MB 4CVXA 4P4KC 5ADOL 4JDVA 1TN6B 1KCSH 1CVRA 4L8DA 1NGZB 4P2OB 1V7NH 3VFTA 4ZFZB 3G5XA 4KTYA 2COQA 2CLZB 1U8JB 3VXPB 3HS0B 4MWFB 2W38A 3BP7A 4RISL 2CJUH 3REVB 4Z76A 3PHQA 1IEAA 1U93B 2H41A 2RBLA 5DVOA 2ESVA 4YHKH 4N1EA 2HT3C 4C4KO 3C9NA 1DQQB 3QPXL 4MNGE 5JO5A 1B9ZA 3O3AA 5DJAB 5CSZB 4RX4D 4PLNC 4C58B 2QADB 3ESVF 3TV3H 2IEPA 3VA6A 3F7VB 1YEGH 1DBJL 3OZ9H 4KAQH 2X9YA 2VLKE 2C7UB 1KENL 1NANI 4OJFL 4MS8D 1NFDF 5E08L 5KOMC 4QEGA 5E0QA 3KYAA 3T1FB 2CDGA 4L8BA 3OHXB 1W6KA 1T0PB 1HHIA 4D9RE 3NOIA 5DTFB 1LNUB 1X6LA 3SKJH 1L0XA 4HUXB 4YPGA 5K9OA 3G6JB 3RVWD 1NGPH 1TTUA 1ZEAL 4LARL 4QXWA 4WU7A 4X9BA 3IS1X 3O2VL 4M8QB 4C56D 2ESVE 3BW9A 1BJ1H 4R7NA 3SPVB 2C3VB 4XGZA 1UH3A 1SJHA 3ZKMD 1IM3A 3AY4A 1E0OB 5FM5O 5IK3A 3QIBB 5B38A 3B2VH 4JM2D 2VABB 3RWIA 3O3DA 4AENA 3BKYL 3DGGA 3U82B 2IQ9L 4R90L 3KLDA 3S96A 4EI6A 4KI5E 5I8OH 1HHHB 1CFNA 3OGCA 1B6DA 4G8IA 3S4SA 3V6ZA 2XPGB 1MWAL 4HUUA 4C54A 1IAIH 5B3NA 3MZTA 5I1JH 5DF0A 2IEJB 4V2CB 1JTTA 1S7WB 1I1YB 5I1EL 3QWOB 2X4RA 2ENYA 5D2LA 2ADJB 1RIHL 2QADD 2BK8A 2B39A 4L29B 2XTJC 3QEQA 5D7SH 4Y8DC 3BWAB 4IEFB 4WHCA 5I18H 5HYSA 1YEIH 4CRPA 1Z6JT 4GKNB 4Q9BA 4XNZC 1MCRA 1FNLA 4JPVL 3T2NH 3TIEA 3DECA 4Y5XB 5EPMB 4QRSB 5F1SA 3HCVA 1LD8B 3WEXA 5BV7B 1YN7B 1FYTD 2NXYD 1CICC 3TA3D 4NNYB 3WS6C 4OD3L 2FZ3B 2HFTA 4NNXB 3HMXA 1CZ8L 5D5MB 2NW2B 2AAVA 3EYFB 5IW6B 1GGYA 1MFAL 1NLBL 3ARDC 4YXHH 5DJZB 4MLSA 5FAAA 4MJ6A 1EMTH 1DQJB 1FFQA 1NC2B 2A0LC 2R15A 5HI5D 3D2UA 2JB5H 4RZCB 3OEDA 5E24E 1QR4A 3QDMA 5D2LE 1T04A 3RNKB 3OXSA 2FGWH 5CEZL 2EZ0D 3QEQE 3UJTH 4JZOA 1A5FL 3ECBB 4TUOB 1F2QA 5DD1H 4UU9A 3KDMA 1F4HA 4F80A 5I1GL 3ELAT 3Q2CA 5GRXG 5IB4B 3N1QC 4H8WL 5T3XD 3VXMB 2EH8L 2FB4H 5EZIH 1N4RB 1D5BB 1A1MB 1NSNH 1KCRL 4MCZB 5CJ5A 3RRQA 1EJOH 3B9VA 1VERA 2XRAH 5EOCH 3FB5B 1XF5A 1U8IB 4QTIH 4L4JA 3QQ3A 2R1YA 2XIDA 4XVSL 1EO5A 3IDNB 3FRUB 1JTPA 1TXKA 4KTEL 1UEYA 1HZHH 1HK6A 2VAAA 2BHUA 1MAMH 1QP1A 4WNQB 3MXVH 1QFWH 3QH3B 5E94B 3VCLA 4GW4A 1MY5A 4LDOB 3HB3D 3GUTA 2PW2B 3KPOB 3QDME 2AJ3B 4LKCB 1D8EB 2K7QA 3BPCB 3MCG1 3P3YA 1QLFA 4YBHA 4AH2B 3U9UB 3HTLX 2DJ4A 5BQ7B 1AQKL 5C09A 1WSST 5C0AB 3ARFC 4LLDA 4PS4L 3W5NA 4O9HL 5IG7B 4E5XA 5B4MC 1U95B 1R3HA 1YMMD 4PGEA 5B38G 3TYFA 5FYKU 4PLJC 4HK0A 2CKNA 2DWEA 3IFPB 3PQYA 4XBGA 3HI1B 4XTRD 3AFLA 4XCYA 3QUMA 4HLZH 1YY8A 3P2TA 1E4XI 1M7IB 5CBAB 5C0JA 5EOCJ 3DTXB 1CXLA 2AJZA 2JB6B 3CFCH 1IAOA 3S4SG 1QSVA 5I19L 3DSSB 3PZ4B 3ARED 2IMMA 1T83A 2AJVL 3RY4A 3UTOA 1FJ1B 3KWWA 1S9WA 1UB5A 3EZJB 3FFCA 5E2TL 1QEWB 3SDAB 3CX5J 3VFRB 3QWQB 5CINL 6FABH 5FYKH 4F7EB 5BVPL 5TGBB 2EDEA 1DQLL 5GZOD 3CFKA 5F89B 3TFKD 3BEVA 2OR9L 5TE4H 3UJJL 3ZMRA 3OKYA 4L8SA 5C09E 3QQNA 3EOBB 3LV3B 3T77A 1MFBH 1J11A 1DN2A 2Q86B 2XQYG 5CEXB 1BD2B 3RWEA 1WITA 1AP2A 5IW1B 4OF5A 5L7XH 5L6YL 2PUQT 1OAUL 5ICZB 3P30L 4RCAA 3PQYE 5GGRY 1KTDA 4ODSH 4UQ2B 3WSQH 3CLFL 4CVWA 2JLLA 4NRYA 3HZKA 3O2DL 4H1LG 4PJ8A 5E5MA 5AYQA 3REWA 3HNVH 1IKNA 1H9VA 5FGCE 3N1GC 3IVKB 1NGZA 4P2OA 4P5TB 5GGSY 3OXUA 12E8L 4KRPC 4ZFZA 3D39B 1T2QH 4H8WC 2R1XB 3VXPA 2XG5A 3HS0A 4MWFA 3REVA 5MI0C 5HYJE 4I4WB 3FFCE 5F7FA 4L3CA 4WI9A 1J5OL 2GSGA 1DN0B 4KI5F 3FFDA 1YEHL 3I9GL 5CSZA 5J1AA 1A7QL 1S7QB 1BM3H 4OQTH 3QUYB 5D1QD 3ARYA 5F1KC 2IAMC 4BYHA 2C7UA 5D6CB 1QRNB 2Y4SA 3F5WB 5IHZB 4K94H 2FECL 5D1ZD 1R0AH 2E7LC 3T1FA 2KKQA 1CG9A 1OTTC 1T6WA 5AUMB 3TJHC 3AAZB 3OHXA 4XHJC 5IVNA 3K2MC 4U6VL 32C2B 1VSCA 4M7LH 3QZWB 4K07A 2CDEA 5DTFA 1LNUA 2Z91B 2XZCL 4Y5YB 3MRLB 4HUXA 3WIHL 4OBSA 1T1XA 3DSWB 5E5RB 3QI9C 3G6JA 2E8YA 4QRRD 5JIPA 4N0CC 3O8XA 5GS0C 3WHE0 1A4JB 4OLWH 2X6MA 4EQ3A 4M8QA 5CFHA 1FE8H 1I3GL 3JUYA 3SPVA 2C3VA 3MRJB 1GGBL 1QLEH 3MJGX 1MHHB 1YEFH 4PR5B 2D7PA 3QIBA 4I0PB 2VL5B 4PPTA 5IBTL 4WY7H 1E6JL 1HHHA 2NY4C 5D2LF 5EU3B 5TPWH 1KJ3H 3P9WB 5JXAL 1DQTA 4Q9QL 2ORBH 1Y6MR 4G6JL 2A6DB 1U92B 1S7WA 1I1YA 3DVGB 3QWOA 4YC2B 4BZ2H 2ADJA 2F9BT 3WLBA 3OKKB 1DUYB 5EO0B 2ZUQB 4IMKA 4L29A 3B3IB 5IM7B 2CIKB 3LSOB 2EDOA 3BWAA 2JIXB 2H6HB 2MMXA 3G6JE 3T08A 4GKNA 1RMFH 4PRNB 3HXEB 2DM3A 1HDMB 1FBIH 4Y5XA 5EPMA 4QRSA 3WFEH 4YHIB 4J3WA 2QL1A 4PGBA 5A2IH 2CO6B 1YN7A 4PRBB 4ENEC 3AM8A 1OP3H 1V7ML 1Q72H 3UYPA 3U0TB 2EDJA 4KKCD 4NNYA 2FZ3A 3OF6D 4NNXA 3SDCB 3KJ6L 5D5MA 2NW2A 5C0BD 1QTYT 3HC3L 2E27L 5I6XC 3EYFA 4PJXB 1WWAX 1U42A 3LD8B 43C9B 4P39A 1D9KC 2YD7A 3BZFB 1FGVL 1DQJA 1A6WH 4XMKH 1L7IH 4I0PD 4LLVB 4RZCA 1NCCL 4DW2L 2PTUA 2WZPD 1DVFB 1OAYL 4YZFE 1D6EA 4K3DL 1IKFL 3RNKA 1U2HA 3DBXB 4FHBD 3F7QA 3W2DL 2DQIL 4JKPH 4TUOA 3HZVB 1LK3L 3D18B 4NM8H 1QBLL 5IB4A 4TOYH 4OLZL 3BYTA 3VXMA 4XCEA 2H6FB 3SO3B 1D5BA 5E4EC 1A1MA 2FHBA 2SEBB 3WFBH 3FB5A 1F45A 1FVEB 2J1KA 3EDEA 1G7PB 1HNGA 2WP3O 3PL6C 5JW4R 1WQVT 2XZZA 1CDCA 5D4QA 3E6FB 2H2SD 5CD5C 3IDNA 5D5ME 5DO2C 2OL3B 5FM5M 5EBGA 5KSAC 3B9AA 3LEYH 2IGFH 4WNQA 3QH3A 2PMVA 1CDUA 4NCC1 4U1JA 5AYUL 4G8EA 3MGTA 3WNKA 4EDWL 4IRZH 3FAWA 3ILQD 1I1AB 2HMIC 2DQCH 2F74B 3BPCA 2BVEA 4CN4A 4NGHL 4UT9H 2E9BA 3SDCD 3U9UA 4AH2A 5JMOC 2DBJA 3KPRD 5BQ7A 2V9TA 3QFJA 3BUYA 5C0AA 3VXME 3DRQB 3C6LB 1CD1A 4XCFH 2F19L 1F4WH 3RIFF 2DM4A 5DEFA 4NHCH 3AC0A 2YK1L 4YQXL 3IFPA 5I75B 3R4DA 4N9GB 3HI1A 4RFEB 2ZIRB 1S7XA 2DLFH 4IRJA 3VWJD 2DQEH 3QDGD 3ZT6A 1ZT4B 3CZFB 1M7IA 3DTXA 3ZYOA 2FD6L 5T1DH 2HG5B 1U6AL 2JB6A 1QHPA 4MB5A 3ULVL 4YK4C 4X5WA 1EIBA 4KU1A 1BQLH 3C08H 2R4RH 4OCRL 4MD4B 3QHFL 1P4BL 4LIQE 1FJ1A 1GGCL 2IQAA 3E8UH 2DS4A 4B53A 2E6PA 4DFHA 1L0YA 1QEWA 4Q7DA 3RQ3A 3SDAA 1T5XB 3LS4L 4F7EA 3BKCH 3BXNB 5TGBA 4Y7MA 1IGMH 1WZ1H 2C1OB 5F89A 1CDHA 3QCUL 5AAMA 5CUSH 1YNKL 3PGDB 3T2QA 3QFJE 1EBPA 1TQCC 5C0AE 1KNOA 2AGJL 3EOBA 3LKOB 3LV3A 3WBDA 2Q86A 4NOFA 5CEXA 3WDHA 3BN9C 3MLRL 5IW1A 1HOCB 3GBNH 5E9DB 5CAYB 1OGTB 3I6LE 3NPZB 5ICZA 2D7TL 4HJJH 3BZ4B 3M1BB 4UQ2A 3IDXH 2H9GB 3P11L 2NZIA 5BMFL 5J1TC 4G8GB 4P5TA 1XIWC 1RUKH 2Y07L 1CGTA 1U8HA 3D39A 4P2YA 5DRNA 2R1XA 3X3GL 1C8PA 3KXFB 3T1WA 4EKXA 4I4WA 2G2RB 1SYSB 2ICWB 1VPOH 2DQUH 1JZ2A 5E2WL 1Z0MA 4IRSB 1MVFA 5DJ6B 4UTBH 1DN0A 1HWGB 2CGRL 3SOBH 3RJQB 1DBKH 4ODXB 1ACZA 4WHYH 1RFDL 3BP5B 4GAJH 2WNGA 2RGSA 5JIKA 3F6IA 1A0QH 1S7QA 4XCCH 3TBSA 1FV1B 3QUYA 1QYGL 1CF8H 5ID0B 5E8PB 1WBZB 5DWUL 4ZUWA 2HFEB 3VRIB 5D6CA 1XH3A 2GTWB 1QRNA 2GJZB 2H32A 3F5WA 4LLUB 5IHZA 4O2EB 1PSKH 4Y16D 3LKSB 4N5UA 2BZDA 5EBMA 2DTML 2VDNL 4MXQD 5AUMA 1KN4H 3G6JF 3AAZA 3KYOA 32C2A 2O93L 2EE2A 2JTDA 1J0YA 1DBMH 3EYUL 2F15A 1IGFH 2EE9A 2X4SA 2Z91A 4Y5YA 3QDJD 2EDNA 4A2LA 1IMHC 5F96L 3D39E 4MNQB 3CLEH 5BRZB 1A4JA 5ALCH 5E9DD 4U1SB 5KVMC 3O11B 3V4UL 3JWOC 1UADC 4JY5L 2V2WB 1KJMA 1WT5C 1M6OA 3MRJA 2GK0B 1JNLH 3BQUC 5FKAA 1N0LA 2NY1C 4PR5A 4U1GB 4KJPD 3B9KB 1J1PL 4KQ3L 2HKFH 3O9WB 5C6TH 4HC1A 1LHZA 1A3LH 5H37H 1EBAA 1MCNA 1MRCH 3Q5TA 4B50A 2XV6B 3DX9A 4HFWB 5D7JD 5EU3A 1Z9MA 4X99B 1QRNE 4ZRQA 3HMWH 4YZFF 3GBML 5IF0B 4EIGB 5ITBH 2Z0BA 5IFHH 2A6DA 5MP6H 2NY0B 4U1HB 3DVGA 3WJLC 2RFXA 5JA8B 3VGEA 3OKKA 1DUYA 4F8TA 3TBWB 1PEZA 4NN5C 4R26H 5IM7A 3B3IA 4GW5B 2CIKA 3LSOA 4NZTL 2JIXA 2VR5A 5FYJD 1ITBB 4YHOH 4Z0BH 4J6RL 4PRNA 3P4OB 4OCYH 2L7UA 4IHOB 2CRYA 4OLYH 1HDMA 1UG9A 2BRRH 4XAWH 4YHIA 5D5MF 3HC0A 5ID1A 2BSTB 15C8H 1PVHA 2CKBB 5MHSE 3LZFL 4MA8H 4D2NA 4XBEH 2VTFA 3WJJC 4GQPH 2LTQC 5BRZD 4OGYL 1ZTXL 4JFYB 3QUKB 1LDPH 4PJXA 2CUMA 1AGDB 3V5HB 2EIDA 4XP4H 43C9A 4H26B 4AMKL 4U1KB 1Z3GL 4U6XB 4LLWB 2O5ZH 2DLHA 3B9KD 4LLVA 3BP4A 3T4YA 2EEAA 1ERNA 1DVFA 3B8SA 4P2QA 1EEQA 4WO4B 3RY6C 1WCBB 1JZ3A 1R3KA 3D18A 2AJUH 3H9SB 3S5LA 3V0AC 3ESUF 1UWXK 3KS0H 2MCPL 1U3HB 1MFEL 2MJWA 2NY0D 1ZS8A 3L6FB 1TVDA 4KY1L 4TULH 4Y2DB 3UTZA 3B2UD 4FP8L 5DD0H 2VXSH 1G7PA 2R56L 1IC4H 4P4KB 5AG8A 4YX2H 4NWUH 2BNQA 3E6FA 1JRHH 3QQ9C 2OL3A 2VN4A 2O5XL 1E28A 4PJXE 4OFDA 4LSQH 4X6EB 4OAWA 4GG6B 1WTLA 1FNSL 1DJSA 3MSPA 1WC7B 2VLRB 4A6YB 3ARPA 4YAQB 1I1AA 4XP9H 5I2IA 4P2QE 4GTOB 1JZ4A 2HRPL 2WBJC 3O81A 4U2YA 2AABH 5JW3H 1GXMA 2GY7B 4U0RC 5EOTB 3DRQA 3C6LA 3MLYH 3KAAA 5DSCB 1GPOH 1FDLH 3KYKL 5JQHC 3KG5A 4MX7B 2Y6SC 4N9GA 3DURB 1HIMH 4RFEA 4YHYC 4QXUL 3X13B 1FFPB 2OR7A 1IC7H 1ZT4A 2FJFB 3BD4A 4Q0XL 1GGIH 2OCFD 3MZGB 1EH9A 4R0LC 2HG5A 2EIZB 2BNQE 2KL6A 3H9SD 4JFFB 4QRTB 3O6LL 1G6RH 1MCBA 1ZT1B 1E6OL 1KELL 4I13B 3KYNB 4F9LA 3GIZL 1EJ6A 2R2EA 4OZ4B 2XWTB 1A7NH 1W0YT 3QSKB 4KK6D 5FF6B 2ICWI 3QUXD 4MXWH 3GO1L 4JZNB 4GBXB 1PX3A 4K23L 1AKJB 3BXNA 4JJHA 4Q97A 3LN4B 5HPMB 1N6QL 1G9NH 2C1OA 1F90H 1OTUC 5F72S 1VEMA 4RQQB 3U6RA 1A3QA 5KAQG 3UP1A 1WIPA 1OQXA 1OD7A 1UWGH 1F2XK 3LKOA 4JN2B 4NDMB 3D9AL 4FABH 4XXCA 3HZMA 4GQ9H 2C4XA 2DQGL 4FRWA 1WLHA 1SM3H 2HT3D 4J1UB 2WMPA 4QXTA 3C2SA 3U9PH 1RAMA 4OCSH 2VLRD 4JY4B 5KN5B 4KJWC 3IFLH 4KPHH 1X5XA 1MJJB 3MUJA 2XT1B 4NRZB 3V0VB 5FO9B 4LASL 3K2UH 2AQ2A 3PV6B 5DK3A 2UWEB 3RAJH 1KCSL 2XTJB 2FSEB 3MRKB 4BZ1H 1V7NL 4G8GA 3I75B 5HHOB 3T2PA 4NQEB 4XNZB 2CJUL 3KXFA 2HFGL 4PRIB 5ESAB 3AROA 2G2RA 1SYSA 4YHKL 2ICWA 3JV4A 1TCMA 2NXZC 3ET9F 5J11C 1KTRL 4IRSA 2A9NH 4M5ZH 5DJ6A 1JCSB 4YDKH 1LVEA 4HK3J 4Y19B 1CICB 1MCQA 4ODXA 3MRIB 3S5LG 3AXLB 3FTGA 2WWMC 1JI2A 3OMZA 4JFHE 3TV3L 3UPRB 2WWKT 2DKMA 1YEGL 1ITCA 3OZ9L 4KAQL 3HZYB 5E8PA 5DQJA 1CFQB 2HFEA 2GTWA 1NCAH 2GJZA 4LLUA 4O2EA 4ORZC 1IAIM 3RWHB 1Q9KB 1Y18B 3HPJB 1ND0A 4HZLB 3FO1B 1F58H 2QEJA 3SGDI 5FIEA 4NHUB 5ESQB 1PZ5B 3SKJL 4EJ1C 4G8GE 2YD8A 1NGPL 1MY7A 5T5FH 4MNQA 3KXFE 1QHOA 3VXRB 2BB6A 1AQDB 2GJJA 4ORGB 2PCPB 3O11A 1CGSH 2FLBT 2V2WA 2XKSA 2AV7B 2GI7A 4IS6B 1FNHA 4LRNH 1CLYL 2GK0A 4K7FB 1FZJB 4C57C 3B2VL 4OCXH 4HPYH 3SHSA 2XTJD 3K3QA 3O9WA 3F6LA 1GGTA 4QCIB 1W8NA 4CN1A 2PO6A 1VFUA 1SJXA 4ZO7A 5I8OL 5JQ6H 2AQ3A 3MJ9H 5DUMH 3R0MA 2D2OA 5IF0A 4XMLL 1IAIL 1SY6H 4JJ5B 4LL9A 1CICD 5F7DA 4WFFD 4U1HA 3QRGH 3QUZC 5KAQF 1O7VA 2C3WA 4KI1A 2PNDA 2DQTH 4YHMH 4FQCH 2FEEI 4GW5A 1P7QB 2EYSA 5D7SL 1JNJA 5I18L 4IBLT 3ARFB 4B41A 4LHUB 4DTGL 4MJ5B 4MNQE 1RUPH 3EO9H 3ARDD 4HX1B 2OZ4H 4TTDC 5DRXB 5MEPB 2NTFB 3OKLB 3T2NL 3T3PE 1MWAB 1MCDA 3WN5C 5IOPA 1GYAA 1BZ9B 1FL5A 1H36A 2BSTA 1CU4H 1CTNA 2CKBA 4LVOB 4PJXF 3U48A 3CVIH 4LLMA 1RURH 3DARA 3OWEA 1D5MA 3VXRD 3QXTA 3E37B 3EW3B 4F15C 3QUKA 5T1LD 3KPLA 1T20B 5H94B 4KMLB 1QFWM 4YXHL 3V5HA 4ONHB 2R2BA 4H26A 4ZXBB 1EMTL 5TE7H 4GUPB 2Q7NA 4U1KA 5GRZA 2MQCA 4AEFA 2JB5L 2XA3A 3E3QC 2FGWL 1HHJA 4WO4A 3UJTL 4DVRL 2Z31D 1NQBA 5DD1L 3S7GA 3GMRB 1JPTH 1WCBA 4W70A 3VWKC 3J8F7 5EWIH 1U3YA 2FB4L 5EZIL 1UGNA 3UPAA 1NSNL 1MCOH 4TUKH 3TPKA 5CP7B 5D1XB 3V6OC 1EJOL 3L6FA 4NRXB 2XRAL 5EOCL 1U91B 3VFWA 4QTIL 3MROB 4RMTA 5T3XH 1L4IA 4KKJA 5KJRL 5K9JH 5GXBB 1QO3B 3ARFD 3N0PB 4LHUD 2R23B 2EEDA 4KRPB 5LAXA 4ZUSA 3QG6A 5IUSA 1HZHL 4MA1B 1RZKH 1MAML 4WFHE 3MXVL 1QFWL 4GG6A 1IEHA 4JO1H 4XWGH 5TE6H 2WY7A 4A6YA 2DQDH 4YAQA 5L2KB 1KIRA 3VXSB 2R0ZH 3QRFM 4NC1C 3IDUA 1U8PB 4EVNA 4U3HA 4ZOAA 1ZLWK 2YZ1A 4DAGH 1I85C 3RVXC 4FQQB 2IAMB 1JHKH 5DSCA 1JP5A 5C08B 8FABA 3T0EC 3CH1B 1X4XA 1EX0A 4R7DB 4MX7A 5F88B 3DURA 3JWNC 1OGAD 3KPQB 1C3DA 3JZ7A 4ZOEA 3X13A 1FFPA 3L5HA 4DKDC 2X5PA 2FJFA 1F6AB 3CFCL 2EIZA 1NDMB 4H25B 4JFFA 4HIJB 4QT5A 5JR1H 1U0QA 1ZT1A 1AGEA 3SKNA 3HC4L 1JPFB 3KYNA 3DX8B 4GG6E 1R3IH 1GRWA 4OZ4A 1QSFB 1UQSB 4L9LC 6FABL 5FF6A 3OQ3B 4JZNA 3GSQB 4GBXA 5FYKL 1FZMB 2V17H 3BYYA 1AKJA 5HPMA 4FQIH 2J6EH 5CP3A 2YOCA 5DD5H 5TE4L 1HXYB 4RQQA 4KRPD 1IM9D 1KFAH 1C5CH 3MFFB 1MFBL 1JI1A 4GH7B 4JN2A 4NDMA 4I77H 3O3BB 2NY4B 5L7XL 5EG6C 1AD0B 2L4OA 1VADA 3BAEL 3C09C 5JXEC 4ODSL 3WSQL 5KN5A 5L2KD 4X5XB 4NRZA 1UCTA 4M6AA 3V0VA 2WANA 5FO9A 3VMOA 3DHJA 3PV6A 4P99A 2UWEA 3D85B 4JY6A 3HNVL 4ZO8A 2FSEA 3MRKA 2W0LA 4G7YH 1NGYA 2DLEA 2VXTL 2IAMD 3I75A 4JFFE 5HHOA 1T2QL 5C08D 4Y4FC 4NQEA 4ZO6A 1UMPA 2X42A 3EO0B 2IALB 4PRIA 5ESAA 1OTTD 2VR4A 4MAYC 4R96B 3F7RA 2VQUA 3TJHD 5CGTA 2ITCB 5FM4A 2R0KH 1Y0LA 4Y19A 3MRIA 3AXLA 4YBQC 3UPRA 1BM3L 3WS6A 4OQTL 3QI9D 1VEPA 4N0CD 4DEPC 5GS0D 3HZYA 3DRTB 3W0WB 1CFQA 5IHUH 4F58H 3I6GB 5I6XB 1JGEB 4LLQA 1KPVB 2D4FA 2J4WH 4NFDA 2OSLB 4GLRH 4K94L 1LMKA 1P84K 1R0AL 2WIIB 3HPJA 1Y18A 5JW4Q 1JK8B 5SX5K 5IMMA 2BRQA 1G7MB 4HZLA 3FO1A 4UB0H 3VXTB 3QIUA 5BJTB 4D8PA 4NHUA 5ESQA 2EYRB 2BOBB 3O8XD 1PZ5A 2UWEE 4M7LL 5FCUL 1MUJB 3FO2B 3T3PF 3DSUB 5JHDB 3BH9B 1JNHB 5HHOE 3PP3K 4QRUB 4NQEE 4F33B 3TO4B 3NN8B 4OLWL 1AQDA 4ORGA 4PRIE 2PCPA 5E4EB 1FE8L 2AV7A 1NH6A 2JJUA 3DI2B 1QLEL 3I3DA 5LGHL 1YEFL 5C2UB 4K7FA 4Y19E 2NNAB 3T8XB 5HXMA 4TVPE 1Q9LB 1IEBB 5F9DC 3MBEC 4QCIA 1UT9A 4H88H 3CSPA 3LAFA 4WY7L 4KKBD 2CXGA 2DI8A 4X9HA 5CD3B 4CGTA 2ORBL 3GM8A 2VQ1B 1B0GB 4PB0H 3VXNB 4IDLA 3Q3GA 5DD6A 4ENED 5SV3A 1RI8A 4BZ2L 3OAYK 4M76A 1NAMH 3EOAB 2H6PA 1FPPB 4RFNC 4LCUB 1IQWH 1P7QA 1SHMA 4PGJA 3W0WD 3L3IB 1X5IA 4MJ5A 5GJTH 4BFIA 1A02N 1RMFL 1D9KD 4HX1A 4LSDA 1CTOA 2NTFA 5FFLA 1MWAA 3RUGB 3WE6B 5F6IB 1FBIL 3WFEL 1XZ0A 1QPXA 1I7RB 1QFOA 1Q72L 4RA0C 5I1IL 2P45B 1EUUA 2DIBA 2I9TB 1AD9B 3F7YB 2VLMD 4YK4B 1LP9A 4G6KH 2ZSVA 2VDQH 1GAFH 5E4IA 2X40A 5JPMB 3MRGB 4ONHA 3SFXB 4ZXBA 1A6WL 2HVKB 3RTQD 4XMKL 1L7IL 4ZAKC 3WDJA 3CFDB 4QHKJ 5D2NC 1OPGH 3IB4A 3KGRA 4JKWA 1T4KB 3WFZA 3PL6D 5HVFB 5CD5D 4JKPL 4GRMB 1TQCB 1OLZA 1OSZB 3T4AB 5KSAD 4NM8L 4TOYL 4ZTPH 2XA8H 5JPNB 1QLRA 4FQ2L 2X70B 5BVJB 4G5ZH 1T1ZB 3Q0HA 2NY6C 3FJTA 3UZEA 4K94C 1MJ7H 2DMCA 3D69A 5DMIL 4PP1C 3TBVB 4H5SB 4HS8H 5D1XA 3KJ4C 4WTZA 1EVTC 4P3WA 4NRXA 2HMID 2OJEB 1U91A 1YQVH 3C8KA 3A0OA 3MROA 3PABB 4KHTH 1KTKE 4GG6F 1MFDH 2R23A 5EIVA 2D0FA 3TNNA 4KV5E 1J7VR 3LEYL 1LP9E 2IGFL 3L3GA 3V7MA 4XNYH 3CDFA 3LOWA 1ZLVH 4OF3A 2NY3C 3UZQA 4TNVK 3QFJD 4IRZL 1FC2D 1S9VB 4XPHH 2WSKA 2DQCL 4DZBB 4M02A 4NKIH 4UUJA 1NC4A 3WYRA 1U8PA 2C26A 3I6LD 1RULH 4FQQA 1PEWA 2EDQA 4XCFL 4IRJD 2GCYB 3NZHH 1F4WL 3B83A 1PJ9A 1TETH 4NHCL 3CH1A 1G7IA 5GGQL 4HH9B 5FO7A 2X41A 5D7KD 4F9PC 4R7DA 5HHPA 4PRAA 5F88A 4Y1AA 2DLFL 3WHE1 3KPQA 5EZJB 3SY0B 1MCJA 2DQEL 5F3HA 3RKPA 2VSCA 1H3UA 5CEZE 4R6UA 1N59B 5T1DL 1H0DA 3FKUS 5KTEH 1MVUB 1JUFA 3BWUC 4H25A 4HIJA 2O61B 5JW4N 1BQLL 5HHME 3C08L 2R4RL 3R8QA 1JPFA 3DX8A 5JZ7C 1QSFA 1UQSA 3DROA 1X5FA 3TLRA 4K9EH 3H2WA 3SDDA 3BQUB 3IJHA 4N68A 5E6ZA 3GSQA 3BKCL 4QOKB 1GZQB 4Z6AT 1IGML 4K3EL 1WZ1L 1CBVH 3NA9H 5CUSL 1HXYA 1XIWD 1UACH 2ADFH 2CXKA 1KBGH 4QXGH 1RZJH 1T1WB 4YDLC 1I9JH 1A7RH 3GBNL 3FT3B 7FABH 2UWEF 1AD0A 5I8EB 3ILPB 1TVBB 4P5MB 1XCTA 3U4BH 4HJJL 4U31A 4WI3A 1TENA 4Y1AE 4Z7NE 2R2CA 3BD3A 3MRBB 5EA0H 4ZH1A 1AJ7H 2J8UB 3LH2H 4XPFH 2DMKA 3D85A 5TDOB 4NN5B 1IQDA 1XR9B 5J1SC 1RUKL 5EIIB 5CBEB 1CI5A 1V05A 3IJYB 4TQEH 1YPZB 3MX0A 4RWYH 1TJIL 4LU5H 4P3CH 4APQD 3L3OB 1QSFE 5E2VH 4EDXB 1HXMB 1VPOL 2DQUL 1FGNH 4R96A 3X12B 4AEHH 2ITCA 4UTBL 2R69L 4B7IA 1MHEB 2VXUH 3SOBL 1DBKL 4GAJL 3O2DA 2F0YB 5BS0D 3OTTA 4J3OC 1A0QL 4JFDB 4XCCL 3BKJL 3V7AE 4P5KB 1CF8L 3SE4A 3DRTA 4WTZG 3D0VA 2CDFB 1M7DA 3I6GA 1JGEA 1KPVA 1JE6A 1CR9H 2J12B 3QULB 1A2YB 3SCMC 1AI1H 2NY1D 1FRGH 5K93A 1KN4L 1G7MA 3RVUC 3VXTA 3RDTD 5BJTA 2EYRA 5C6PB 4P9MH 1DBML 1X5GA 1IGFL 4NO5B 3IXTB 3FO2A 1FAKT 2NY2D 3QPQC 3KPMB 1JGLL 5JHDA 1JNHA 4N9OB 4OZFH 5E7BA 4QRUA 4F33A 3CLEL 3TO4A 3V52H 3NN8A 5EUKB 4OGAC 4WV1A 1FIEA 2WLZA 2PXYC 4POYA 4WI4A 1HKLH 1JN6B 5EU7E 2HKFL 2FBOJ 5C6TL 3WIFA 1CDJA 4M00A 1IEBA 1A3LL 1G0XA 3MOBH 3WIHA 1MRCL 5B8CC 4G9FD 2IC2A 5FOBB 3LS5H 4XXDA 5ITBL 4RGMC 5CD3A 4X7DC 4KJYB 5GS3A 5IFHL 4W4OC 5MP6L 2IWGA 5IMKA 1NEUA 1I3VA 1J1XL 1FSKB 4JHZA 3MRNB 3OPZH 3EOAA 3L7FA 4MQ7B 4R26L 3CC5B 4BM7A 2WBJB 3O2WH 3VH8A 3QNZB 5JHDE 5DHVB 3CPLA 2DN7A 2PYED 3L3IA 1YN6B 3NABH 1TMCB 3GK8H 2A83A 1NDGB 4U0RB 4YHOL 4Z0BL 3EFFB 1YY9C 4OLYL 2V2XA 3WE6A 2BRRL 4O5LH 4XAWL 3V7AG 1BBDH 3OX8B 3C6SB 4V2BA 1L7TH 4KV5F 1I7RA 3MCLH 3MV7D 4OFPA 2LAGB 5GS2D 1LP9F 5A2FA 3EYQC 4MA8L 5I16A 4XBEL 4S1RH 4BELD 4LPXA 4FQHA 1AD9A 4G6AC 3VDBA 3F7YA 2PKDA 2ZZUT 2V7HB 2BVOB 1GXOA 2HLFD 3HXCB 2Z8RA 2GY5A 3DUHA 4GMTH 5JPMA 3MRGA 3CDGB 4P2QD 2HVKA 2O5ZL 5TF1H 4KK5D 1JMZA 4OI8A 5C07A 4XP1H 1RK1B 1T4KA 4KKIA 2HTKC 1YNLH 3GRWA 1VB9A 3QQ9D 2GJ6B 3EJZC 4GRMA 4FMKA 1OSZA 3T4AA 2AJUL 1MSPA 4FFVD 5JPNA 1JYXA 4FG6C 1CXEA 2X70A 5BVJA 1T1ZA 4O2FB 1GCFA 5HPOA 4HW5A 1ROWA 4K3GA 4F7CB 2J8OA 4TTGA 2R8SH 3E30B 2QBWA 1FLRH 3Q6GH 4H5SA 1A1OB 5DT1H 3U4EB 4TULL 5DEZA 3LN9A 4M6MH 5DD0L 2VXSL 3VA2C 2WBJD 1RVFH 2FDBP 3PABA 4XNQB 4YX2L 4NWUL 4LVEA 3JVGC 1LWRA 1JRHL 3DYPA 5JW4M 5HHQB 3VD5A 1A7OH 4LSQL 2Q8BH 2R0LL 4RDQG 4YHPB 2Y6SD 3RA7H 1TCRA 3EDKA 5GHWH 5J11B 4H0GA 2F54A 1Q9WA 5C07E 3H3BC 1S9VA 5SWZD 3ARBC 5D7LB 4XP9L 5MENA 4Z8FL 1BEYH 2OLDA 4QRPA 4LCWB 3MLTB 3VGFA 4MJIA 4UNVA 2AABL 5JW3L 4OFVA 1INDH 3TESA 2DD8H 4Z7NF 2DQHH 3UTSB 2GCYA 1MLCA 1GPOL 1FDLL 2D0HA 3TM6A 3FO0H 2YUZA 4HH9A 1FH5H 2HJKB 4Y5VB 2WAHA 5HD8D 3WCYA 4EOWH 2H26B 1ZHNB 1I9RH 3MRRA 1HIML 3WNMA 5EZJA 1IC7L 4X7SH 1GOHA 4YHLH 2GJ6D 3ARXA 1DCLA 5INDA 3EYSL 1JIBA 1JBJA 1D6VH 1G6RL 4N0RA 2O61A 4QY8B 3CAFA 1T2JA 4AM0B 4ERSH 4NIKB 3P73A 1LO4H 1A7NL 1R24A 3CX5K 5JOFB 4MXWL 4GTVB 3VH8G 4XHQA 3D5RA 2F54E 4QOKA 1GZQA 2ICCA 1G9NL 5MENE 1F90L 4IIQB 1V3MA 4UNTA 4QRPE 3TVMB 4WEBH 2A6JB 4PBWD 1H15A 4MJIE 1UWGL 4MJ2A 3DV4B 3RIAK 1XGRB 4GQ9L 1T1WA 3U36B 1NFKA 3FT3A 5I8EA 1SM3L 2NXZD 3ILPA 5IGXL 4OLVL 4OCSL 4P5MA 1QSED 3O3UN 3OKOA 3IFLL 4KPHL 5D7LD 3QHZH 3D0LA 3K2UL 2WWMD 3T0BA 2CD0A 5TDOA 2J8UA 4BZ1L 1XR9A 1BQSA 5DHYB 3IJYA 3GFUA 2CIIA 2B4CC 4D4CA 5B4PB 2C3GA 2DWDB 1N4PB 2ZUYA 3H3KA 2HKHH 2X7LB 3CSYB 3GJFB 1HXMA 3WN5B 3X12A 1HH6A 2A9NL 4M5ZL 1YUHA 5EUOB 1MHEA 4QOKE 2VITB 2H3NA 3C5JA 4HCRH 5D93C 3DIFB 4JFDA 5C0GB 4P5KA 3ULVE 4V1SA 1T5WB 4RDQF 4LGPB 1NCAL 1AFVH 4JGUA 5C0CB 1A2YA 4JLRB 2YUXA 1F58L 2QR0B 1SVZA 3GMLB 2D9CA 3F7PC 2J8UE 1HHKB 2HTLC 2AEQH 5ACMA 3SJVA 4ZRPA 3KPMA 1U8OB 4F7MB 5T5FL 5CJBA 5E99H 4ZMAT 1BFVH 4RGNC 5EUKA 2EKJA 2VIRB 4LRNL 1AIFB 4P2CG 2CO7B 4YEEA 3QUZD 3IETB 4ZS7H 1JN6A 1DUZA 4OCXL 4XPTH 2ERJC 4HPYL 2FBJH 3P40A 2W0PA 4JFDE 1BQHB 4V1DD 4X9FA 2OTPA 5JQ6L 5DI8A 2P5WD 3MJ9L 5DUML 1S3KH 2MQ3A 1NANH 1I7TA 5HTSA 1BIIB 4JREB 2BXYA 4KJYA 3U46A 4PJAB 3QRGL 4QWWD 3GDBA 3L3DA 1JCRB 1PX4A 3O4LB 4LFHD 4DUWA 2DQTL 4MQ7A 4F37K 3CC5A 3DSVB 3DVIA 3MUZ1 2UZIH 4FQCL 3SJVE 2DL9A 3QNZA 1PFCA 5IB5B 2YD3A 5DHVA 5GGUB 1RUPL 3EO9L 1NDGA 1JFQH 1SJEB 2G75A 4F7PB 2OZ4L 5A2KH 1P4IH 3T0EB 4QGYA 4CMMB 5J06A 2D9QB 5T1KD 3U83A 2ITDA 1BMGA 2ILLA 3OX8A 3C6SA 1CU4L 4RISH 5ICYB 1CDYA 1MFNA 4F7TA 5H2BA 3T2OA 3V6BR 5L0QC 1RURL 5IV2B 3TWCH 5I71C 1BLNB 3VFOA 3VWKD 1KIPB 1J8HD 5DUBB 2X2YA 3O6KH 3KQ4A 2F58H 2FX8L 5C71A 2I26N 1IGJB 4NO0A 2V7HA 4P23C 1KPUB 4H1LH 4PJCA 5TE7L 3CDGA 3E32B 4L9LB 1CFSA 1DSFH 3D3VB 4P4RB 3DXAA 5A3ID 4L4TD 5HHXH 1I1RA 3TIDB 3KLHC 1OF2B 5T3ZD 2NOJA 2YSSB 5I1KH 3Q78B 5BO1H 4GTRB 2P4AB 1JPTL 5DZLA 1PG7X 5AWNH 5EWIL 1AGBB 4HS3A 4HKXB 3LKQB 1Q0XL 4CL7A 3TJEH 4F7CA 1R5IB 1MCOL 1RJCA 4TUKL 4LDEB 1A1OA 3U4EA 5JTWA 2UZYB 3SBWC 4I2XA 5T3XL 2X89A 4M43H 2GITA 2Z93B 3QYCA 4XNQA 3OG6B 5K9JL 2ZISB 4UOW0 3HRZB 4UDTA 1FL6B 3RVXD 4HXAL 5EBLB 1A6UH 1PKOA 2QJDA 4Y4FB 1RZKL 4WGVB 4Y4KC 3C8DA 3U0PB 4O00A 4PJCE 4JO1L 4MAYB 4XWGL 3HRPA 5TE6L 2VDMH 2WQRA 4Z95H 1G7JB 3DXAE 3MLZH 3MLVL 4LSSH 3H6JA 4UI2A 4WFGE 3G5VB 1YEJL 1S7SB 1UXSB 5FXCH 4X98B 3ROLA 4LCWA 3MLTA 4DAGL 2V3NA 4HV8B 4R3SA 4GW1B 5CKAA 3UTSA 1OAKL 4WI7A 1S5IH 3GHEH 3SE9L 4Y5VA 1YJDL 1TNNA 1ONQB 3QEGH 2H26A 1ZHNA 3RGVA 2P5EB 1DL7L 3CDCA 5E2JA 4I2XE 1FQ9C 4WJ5B 2WIMA 1NBYB 3N9GH 1I9EA 1RV6X 2GSIB 4XAKD 4TPRH 4RMSA 4TN9A 4QY8A 3VG9C 4HIIB 1BOGA 3L7EB 4PY8J 4AM0A 2FO4B 1R3IL 4N90D 5JXED 1U8MB 2W91A 4HF5H 1XMWA 1RIUH 5CLWA 4PJFB 5JOFA 1A6ZB 3F58H 2K7PA 1RHFA 3ULVF 2MKLC 2V17L 4D0CB 4FQIL 2J6EL 3BN3B 4IIQA 5DD5L 3U1SL 3BMVA 3JV0A 1HSAB 1ZWIB 3TVMA 1KFAL 2A6JA 2AK4B 3SGKC 4LCWE 1C5CL 5F7HA 2D03H 1F8TH 3DV4A 4HJGB 4I77L 4M9PA 1RIVH 1IZKA 1XGRA 2NXYC 3O0RH 4HIXH 3UTSE 4X4MA 5EC2B 3SN6N 2J8UF 1Y6KR 5E6ID 4GRWH 3TA3C 3GMMB 2BERA 1QBMH 4G8FB 4I9WD 4QRQB 5DJCB 3ARGA 3OL2A 4YBQD 3RVTD 4QHLB 3T0DA 1IFHL 5IIEB 1KCRH 4X5LA 2V3PA 3MQIA 4G7YL 2IANA 4HWEH 4JAMB 3BKMH 3VJ6B 5DHYA 4CVZB 5LGJB 1RU9H 2DWDA 2XZQH 4ETQB 5GRVL 2GAZB 4Z77A 2EICA 4ONTA 4TVPD 4CADA 5C6WH 2EZ0C 3WN5A 4JDTH 3K4AA 3FMGL 5EUOA 5CCKH 1ED3B 2R0KL 5D96C 2WWKO 1F4YH 4PJGB 2ARWA 5C0IB 2M1KA 2F5BH 4JO2H 3DIFA 1BBJB 4NO2A 3NIDE 1T5WA 1EVUA 3L9RA 5IHUL 1DZBA 2J4WL 4N5ED 4X4ME 4YH6A 3IXAB 1O79A 5C0CA 3MV9D 2EDLA 4JLRA 4P2RD 2P7TA 5CEYA 4UB0L 4JO4H 2QR0A 5AEAA 5GS0H 4JE4B 3GMLA 2BVQA 1BIHA 3MV8B 3WO4B 4L3EB 4K8RC 1RHHB 3UDWA 2AK4D 3C2AL 3MBED 4J4PA 2APBA 2UUDH 4JFOA 1A4KA 2IANE 5H8DA 2OYPA 1U8OA 4MA7H 4F7MA 3RHWK 3L5XH 3LQZB 4DVBB 2I60H 4G3YH 1SBBA 5A16B 2NY6B 2VIRA 2Q7YB 4CUCA 3TP4A 4A2MA 1YJDC 3S3PA 3R0NA 1IAII 3KJ4B 3V6OA 5EUOE 3U7AA 3KLAB 4WUUB 3HR5B 5HGDB 1N6UA 3BGMB 4NCDA 1BQHA 2NX5B 1NMCB 2YWZA 2LQRA 1KLUA 4MQSB 5AG9A 4YHNB 2I5YH 4N8CH 4H88L 2P47B 1J0KA 4LCCC 4DQOL 5IWLA 4XTRC 1DQLH 3UJJH 5C0CE 4ODHH 1KEGH 1BIIA 3VMPA 2BEDB 4PB0L 3NPSC 2YUVA 4Z7UB 5L2JB 1BF2A 2Q6WA 1V8HA 1NAML 2DTSA 3O4LA 3HXBB 1OAUH 2EEBA 5IB5A 3OAZH 4UDUA 1BF8A 3HAEA 4JRXD 3CLFH 5GJTL 1X5HA 3WIIH 3PWPD 2X1OA 2DYPD 1SJEA 2KBGA 4F7PA 1YQ2A 4N1CA 1FNEA 3T0EA 4CMMA 2KDGA 3QEHA 5DLMH 4ZAKD 3V6OE 4BH7A 3S36X 3MV8D 1DEDA 5FUCC 4LQFH 3MRDB 1MNUH 3S34H 1QA9A 3FB6B 5IV2A 3QIWA 2LVCA 4PJCF 1KIPA 5DUBA 3NGBC 4L8CB 4N8PA 2NY6D 1PZUB 4G6KL 2VDQL 3CDYA 3HE6B 4MB3A 1KPUA 4AIZB 4M4RA 3RX8A 3D3VA 4P4RA 3I3BA 4WUUD 3BRDA 1OPGL 3RZCC 1SMOA 1OF2A 4HIEA 4POUB 2YSSA 5KZCB 3O4LE 4CJ0A 3AU1B 1N94B 1R5VB 2XKUA 3BIKB 4TNVF 3MMEB 5LKNA 3D25B 4U6VH 3VFVA 1XF2B 2OTWA 4HKXA 3LKQA 1OSPH 3T0EE 1MJ7L 1QFWI 4NCC2 4X6BB 1R5IA 3RPIB 2NY3D 2YC1B 4HS8L 3S35H 4NWTH 5IB2B 1YQVL 5ISZD 9CGTA 4KHTL 5DURB 5IVXB 3QR2A 1MFDL 4EN3B 2D7QA 3CFJB 4ZTOH 5D1ZC 3RBGA 1FL6A 5FUZH 5FV1L 5IJVB 1NCWH 3FONB 3DO7B 4YDJA 4Y4FA 3AMLA 3U0PA 3MR9B 4XNYL 4MAYA 4PP2A 2JJVA 3QXAB 3D3VE 2EDWA 4XVUC 4XPHL 3UEZA 2VZOA 5CJXC 1JL8A 4ODWB 2HA1A 4IJ3B 4NKIL 3P4NB 5HDOA 1C5AA 4Q9QH 1J86A 1GH7A 1UXSA 4CJ1A 4G6JH 4X98A 5ICXB 3BP6B 2FEDD 4Y1AD 3NZHL 4GW1A 1TETL 5JZ7D 4B5EA 3WLWD 5C7XH 4MQXC 3SCMB 1ONQA 4LCYB 1YDPB 2VISB 3Q5YA 2P5EA 3EAKA 1MPAL 3BDBA 2Z4QA 5KZCD 2W65B 4WJ5A 1NBYA 4V1RA 5GQBA 4ZNEA 4O2CB 5IFJB 3S35X 4KDWA 5KTEL 3QO0B 4PRPD 2GSIA 4I5BB 4PJHA 3PJSB 1RJYB 5ADPH 1MIEH 1N26A 3QP3A 3OR6A 2N4IA 3QXWA 4ZOCA 4ZD3H 2ZPKH 1RK0B 4HIIA 4MMXC 1U8MA 4YBLB 3NCMA 4GXUM 4JHWH 4WW1B 3LMJH 4K9EL 4X7EC 4PJFA 1GSMA 1A6ZA 1CD8A 4RA3A 4D94A 3HC3H 3NIDF 4D0CA 3HAEG 4D9LL 1CBVL 4XH2A 4JFED 2YBRA 2IFFH 5E56A 3NA9L 4WWKB 3RJDA 4PJ7B 1AHWA 1UACL 1EHXA 2ADFL 1N2RB 1KBGL 5K33A 4QXGL 4RMQA 3V9FA 4HJGA 1RZJL 4LGRB 1I9JL 3MLWH 1A7RL 4OCMC 1VGKB 5EC2A 3M17B 7FABL 4NC2B 3LIZH 5C1MB 3L5WB 4RGMB 1KLGB 4BOKA 4KKCC 3U4BL 4GAGH 4R9HA 5J89A 1I1FA 2P5EE 4G8FA 4NOBA 5IB3B 4QRQA 5DJCA 5EA0L 1AJ7L 3LH2L 4N0UA 4QHLA 4ZNEE 4JG0H 3QJFB 4PJHE 4JAMA 4S2SB 3HI5H 4TQEL 4CVZA 5EUOF 4LU5L 3ZYIA 4XB7A 3MYJB 5E1AA 5FGBA 5CMAA 3FQTB 3DJ9A 2EDYA 4NQVB 4PJFE 3X17A 4AEHL 5HGBB 2VXUL 1RZGA 2VLJA 3QXDA 4PJGA 1K8DA 4MHHI 3QPQD 1BBJA 4CNIB 1RJZB 1H8NA 5DHXB 4EDWH 4DUVA 4PRHB 3Q48A 4OGAD 3S37H 2BSED 5CIPA 3PWJB 1C12B 3IXAA 2AJXH 2XN9B 2PXYD 1AI1L 4HG4J 1FRGL 2H32H 3N85H 4MVBC 5FYKE 1YYLH 4FFWC 1P9MC 3DRAB 1KJSA 3E34B 4N0UE 4L3EA 4P9ML 3JWOH 1BZ7B 1RHHA 1FFOB 4OQTA 4RSVA 2FH6A 2V8KA 5HYFA 4LEXH 4JFPB 1MCKA 3LQZA 4KKLC 3V52L 4DVBA 3MUGA 5A16A 1JPST 2A9MH 1I3RB 3NMEA 3E0GA 4JCMA 3DHMA 4X0KB 3DV6B 3FOLB 2VLJE 1HKLL 3I6KB 5BZDA 3I50H 4LHQB 5HGDA 4PJGE 3L5JA 5DD3H 3PNWB 4HIHB 4YDIH 2NX5A 3MOBL 4KWUA 4YHNA 2OQJB 1SJVA 4JDZB 1CXHA 1YY9D 3VWJC 5GISH 4HGWB 1XCQB 3LS5L 3M8OH 3RP1A 5DJ2A 4QNPE 3S37X 1YC7A 4ACPA 4Z7UA 3KPSB 5L2JA 4R2GB 3ARBB 3EYQD 5JIHA 4L3EE 2FHFA 1EAJA 4RAHA 3O2WL 4U4BA 2D7TH 4G6AD 1MREH 4PRHD 4JR9H 3NABL 3RWDB 3GK8L 2ED8A 4IOIA 3BPOC 2VE6A 4HLZG 1N0XH 1UB6A 3TO2B 3MXWH 4GRLB 4ZUVA 3RWJB 4ZDHB 3C5ZC 5DEGB 4O5LL 1EEYB 2WUBH 4ODUA 1A7BA 5SWSD 1BBDL 3WNPA 1L7TL 5FYJL 5KG9B 1G0DA 3MCLL 3L95A 3MRDA 4OGZA 2DQJH 3PUCA 3EJZD 3HHRB 4S1RL 1MQKH 4Y4HC 1KCUH 2E3VA 2NX5E 3UAJC 1CFTB 4L8CA 4YDVA 1UYWH 1MFCH 4DJMA 2Z35B 3PWUA 3HE6A 5TH2B 2EDTA 3NAAL 5GS2H 3EFDH 2ENSA 4R4FL 5TF1L 5DWUH 1N9AB 3G04A 5EULV 3KR3H 4Z7UE 5AAWA 2XY2A 1YNLL 1H8SA 3AU1A 2AVGA 3FT4B 1R5VA 2G5BA 2ZUUA 4LVNC 3MMEA 3CVHH 3SKUD 4FQXD 1EZVY 2BJMH 3D25A 1A14H 4OZIA 4OT1H 5DMGC 2PW1B 1G84A 3MPCA 2KQMA 5CJQH 4BKLB 4WB2A 2R8SL 4X6BA 3S9DB 2YC1A 1FLRL 3Q6GL 5DT1L 2QHRH 1KZOB 3KPSD 1CXIA 2X1QA 4BZYA 1IGIH 2XTLA 5IB2A 1A6AB 3JTSB 5J12C 2YKLH 1B6UA 3IU3A 4EN3A 4Y16C 3CFJA 3TZVC 5IJVA 3FONA 4MXQC 3DO7A 3RPKA 3DSXB 4KQ3H 1A7OL 1S7RA 3HUJB 3SKOA 2GIYA 2Q8BL 3DI3B 3MR9A 1K9TA 3C60C 3RA7L 1RZ8A 4LLAA 3QXAA 5IBUB 2E8ZA 1UJ3C 1BJ8A 4MJID 1J88A 4XNMB 4ODWA 5I9QC 3DX6A 2AXFB 5D93B 1BEYL 1CGVA 4JFQB 4FQ1L 4OZIE 5ICXA 2VO5A 1A64A 1INDL 3BP6A 4KK8C 2DD8L 5FECA 2DQHL 2W0FB 1R3LB 2AP2A 4ZQKA 1WVZA 4RRPA 2I27N 2KQNA 3VFSB 5EN2A 4MHHG 1RZIA 3FO0L 1FH5L 2NY5C 3SCMA 4EOWL 4OFYA 4PJHF 3RIAF 1I9RL 1E4KA 2VISA 4ODVH 2EDFA 3AB0C 2R29H 4X7SL 3KPTA 4J6RH 5D7JC 3LVEA 4OIIL 1EXUA 1RZ7H 1MI5B 4X8JB 1UXWB 3R1GH 4WEUD 4I5BA 4PJFF 1D6VL 3VXUB 2WLYA 5HDLA 1FAIH 4ERSL 3D1MC 2ATPB 1LO4L 4FQJH 2PF6A 2X4QB 4FS0A 2ARJB 5GIRB 1D8DB 5GGSB 4WW1A 2NQCA 4LSUH 4W6YB 1AO7B 4DN4H 2HT4D 3PDOB 2QSCH 3U0WH 1JF1B 4MCYB 3QWRA 3ZKSD 4AYFA 4WWKA 5HDBE 4JZJC 2YA0A 4WEBL 1N2RA 4TSCH 2V6HA 1G6RB 1JWSB 2W0KA 5FYLE 5T1MB 4E41D 1T3FB 1TNOB 4WI2A 4Q6IC 2V9RA 5IFAH 4MZ3A 3M17A 5ERWB 4ZOBA 5DFWH 3S8WA 1KLGA 3SE8H 4WGWB 1QNZH 1ZT7B 3UYRH 1LEGB 4W4OA 2X1XR 5IB3A 1U3ZA 3QHZL 1Q1JL 5J0BA 3BMWA 4Z78B 5F7LB 2RAMA 3QJFA 4KY1H 4S2SA 3W9DA 1OHQA 4WHTB 3TN0B 3VFNA 3SE3C 1NUDA 4N8VA 4U1MB 4CBPA 1ADQH 4PJGF 2B2XH 2HKHL 2FX7H 5EO1B 3FQTA 3ZKQD 5DQDL 1F6LL 1N3NB 4NQVA 5MEOB 5HGBA 1FL3A 2HTLD 5DQ9B 5F1NA 1TITA 3IDIB 3EJJX 1H3AA 3BISA 5IMOB 1S9KC 4S0TD 1X4ZA 4CNIA 3UCRA 1RJZA 1KUMA 4QNPF 4RGND 1WBYA 3RWCB 4DKEH 2JJSA 3PWJA 4P23B 2WUCH 1C12A 1AFVL 4L4VD 1I8LA 1II4E 1B88A 2FGZA 4PY7B 5D8JH 4WIQA 2DQFA 2OTUB 1WFOA 3MGOA 5IQ9B 2AEQL 2HJFB 1BZ7A 1FFOA 2L0DA 4C4KT 3ARWA 4M1CC 1SEBB 2FL5A 1DE4B 5TFSH 2IPTH 4F37F 3R8BB 1KACB 4PTUB 5E8OB 2BP3A 2PTTB 3NVQA 4WI6A 3FOLA 2NPLX 2QTEA 4QHNA 4ZS7L 3I6KA 4HAFA 1B4JH 1KELH 4XPTL 1S7VB 2VZSA 2FBJL 2ZCKH 5GRWA 5GS1A 3BJLA 5KSVB 3PNWA 1GIGH 2G9HB 4HIHA 2MHAB 2VZUA 4WUKH 1VKXA 4K23H 4Z7UF 4JDZA 5B21A 5ACZB 3X11A 1S3KL 1XCQA 1M1SA 5F7WC 4BQ6A 4PBVC 5D70L 1QFUH 1QQDB 1A7PH 2XFXB 4PJ9C 5JDSA 3ARBA 2ZKHH 1PG7L 1YEDB 3SGDH 3PDDA 1KXTB 4C56B 1ACYH 2UZIL 3GJFH 4AEEA 1MOEA 4O02H 3QUXC 3RWDA 1W2KT 2LV4A 4YLQT 4R97C 1AGFB 1DCEB 1NGQH 2ZOKB 4JM2B 2IPKB 1P4IL 4GRLA 4PGCB 1DBBH 3RWJA 4ZDHA 5DEGA 1N5AA 1EEYA 3KLHD 1E27A 4OTXH 3CFBA 4MAUH 1IBGH 3O45B 5KG9A 4UBDD 3ZE0E 2HFGH 4KKNA 4NO0D 4D9QE 3HR6A 3TWCL 4EI5A 3FO9B 3O6KL 2F58L 2RHEA 3UO1H 4AG4H 3G08B 1R6VA 2YEZB 4XPBL 3VG9B 1GL4B 3DXAD 1QFHA 3K4ZA 4QO1A 4ELKB 5TH2A 2WM0A 2EO1A 3OXRB 2CRMA 5MEQB 4PYGA 3UROR 1DSFL 3V4PH 5IR1A 4NNPH 4WU5B 5HHXL 4OZIF 4LRIA 3BHBB 1LO2H 3K80A 4JGMA 2Y06H 4WFEE 2A2QT 5I1KL 2BX5A 4ZYKB 5BO1L 2Z9TA 1A1NA 2Q20A 4N8VG 1ZXQA 5AWNL 1JRHI 4Y4KD 2A73A 1BX2A 3IJSA 2PW1A 1T21A 3LRSB 1FYTB 2NXYB 1UH4A 4YFLI 3WO3B 5T3ZH 4NJAH 4KI5C 4P3AA 4OSUH 3TJEL 3O6FD 4BKLA 5SX4H 3TA3B 5E8EB 1PAMA 3SDYH 4XT1C 1FO0A 2ADIB 1A6AA 3JTSA 5JNYB 4M43L 1UC6A 3PWVB 5DR5L 4OLXL 5MERB 2VWEE 1CLYH 1LD9B 1A6UL 2O5YH 3WS3B 1DFBH 4JEGB 3HUJA 4J8RB 4HKBB 4ELMB 4ZFGH 1I1CA 1G7HB 4K71B 5HDBF 2K1MA 3ARTA 2ZSWB 2VDML 4XI5D 4AIXA 4Z95L 1CGYA 3I3EA 3MLZL 3W5MA 3ZSSA 3ZT7A 4LSSL 3I2CL 1SBSL 3AY4C 4XNMA 2OK0H 4EBQH 4XMLH 4M9OA 2ZNWA 2VDPH 1J0JA 4JFQA 5AGDA 4Z7QE 2W0FA 5HYEA 1R3LA 4I18B 1NFIA 5CJ8A 1S5IL 4NKDB 1H3BA 3GHEL 1U8LB 3QEGL 4DTGH 2ZJSH 2CMRH 2QQLH 3E33B 5EH1A 3N9GL 4GSDH 4X8JA 1MI5A 5FA3A 2FJHA 5E6YA 1G7LB 1UM6H 5GGRA 4TPRL 1QFPA 4LKXB 1JWUB 4WB3A 3HUJE 3UTTD 2NW3B 3WXVH 4YIQB 2GTZB 2X4QA 2QLVB 4HF5L 5GIRA 1RIUL 5GGSA 3FT2B 1T0NB 1AO7A 3F58L 5H37G 4O51B 3PDOA 4JQXA 1ZLVK 1JF1A 3FQUA 4MCYA 3GB7B 4ZNCD 1YMMB 1HSBB 4OGXH 2XZAL 4HLJA 5T33L 2D03L 1YA5A 5CGYD 1G6RA 1F8TL 1JWSA 5IHBA 4YO0B 4DZ8B 4LCCB 5JHLH 4UMGA 1TTFA 1RIVL 4HIXL 3O0RL 1FLTX 2YD4A 1FORL 4NZRL 4DVRH 2ICEA 5ERWA 4FOMA 3ROOB 4OZHB 1FPTH 1QBML 1ZT7A 4AEIH 5I73C 1LEGA 4K7PY 4U3CA 3AREB 4G6ML 5L9DH 2R2HB 4U49A 1MI5E 3PGCA 1OAXH 4HWEL 1T6VN 2IBGA 3BKML 1HHGB 1NEZA 4JHAH 3VE0B 4WHTA 4UU9C 1RU9L 3T3ME 3TN0A 3A6CH 2XZQL 3OKEB 2GEEA 4U1MA 2BNRB 4HUMB 2JK5B 4D0BB 5KJRH 3HG1A 3OR7B 1I8MB 5EO1A 2HWZH 3RHWF 2Z31C 4JDTL 1M05B 1N3NA 1AO7E 5MEOA 5CCKL 1MJUL 2HVJB 5HVHB 4K8RD 1KCKA 1F4YL 2DAVA 3OB0H 5DQ9A 3IDIA 3H0TB 5F7YC 2F5BL 5IROA 5EOQH 5IMOA 2A74B 4JO2L 1XF4B 4TVPH 1VDGA 5JOPD 2IFGA 3DMMA 3S3SA 4P23A 2X4OB 3BSZL 2F53B 3FQRB 4PY7A 1KIQB 3TYGH 1MHPH 4JO4L 4LHJB 5GS0L 4UQ3B 3N1MC 2ZOLA 1REIA 1QOKA 4NYLB 1F4AA 1WEJH 5IQ9A 2HJFA 4MA7L 1JGDB 3DUSB 3L5XL 3SDXB 1K5NA 2I60L 3QJHA 3ISWA 3S36L 1ZVSB 2E7BA 4G3YL 3ZE0F 3P0YH 2NMSA 3HG1E 4UOW1 3B8YA 2EKSA 4RX4A 1EAPA 5E8OA 1LILA 1GVIA 5D1QB 4PJ5D 4PD4J 4HD9A 5KVGL 1CE6B 1S7VA 3HC4H 5HYJA 5D9SB 3WUWB 1OB1B 5KSVA 1YMHA 5D1ZB 2MHAA 4B0MM 3ULUD 2I5YL 2GT9B 4N8CL 5HYSG 1EFXA 2BNRD 1UA6H 5D7IB 5ACZA 5B3JE 4P9HC 1HE7A 4ODHL 1KEGL 1K4DB 2X10A 3BZEA 1I7ZA 4XPAH 3Q5OA 1QQDA 2XFXA 4J2XA 4QRRB 2HH0H 1A22B 1PDKA 3BAEH 3V5DB 3ZZ1A 2QQQA 4EXPX 3MRMB 4JKLA 3TF7C 5HI4D 5TJWK 1LEKB 4L8SC 3WIIL 4CMHC 1AGFA 3MJ9A 5J57B 4S11A 2F53D 1CDGA 1H3PH 2IPKA 2ZOKA 4JM2A 5JOEA 5DLML 1SY6A 2VXTH 4MJ4A 3RZCD 2CLZA 1U8JA 2OXGA 4LQFL 3LY6A 3O45A 1U93A 1NAMB 1MNUL 3ARSA 3S34L 3TT1L 4HMDA 5AZ2H 1M71B 3VFUB 3FO9A 3FQWB 4PJ8C 3QEUB 1IKNC 3GMOB 1FN4B 2WK2A 2CPCA 2F5AH 1F3RB 1DQQA 3G08A 1HH9B 2YEZA 1YECH 3BX7C 3P9LB 2OZ4A 5DJAA 1DLFH 3OXRA 4MNHB 3L1OH 3F7VA 5MEQA 2WQ8A 1XAUA 3BHBA 1NEZG 3GSNH 4G80B 4LBEB 3NZ8B 3MJ8B 4Z7QF 3ZL4H 1EZVX 3U30C 5E8DH 5HBBA 1TJGH 1AXTH 4LK4A 3MFGB 1ZHBB 4EHMB 3RFZC 1FYTA 5FCUH 1OSPL 3LHPH 1X7QB 4KK9C 3H3PH 1T7ZA 4XVUD 2P24B 3S35L 4NWTL 1WICA 2FLRT 2Z8SA 5E5UB 4C83B 4XMPH 3K1KC 5C0BB 2ADIA 3HUJF 4OF7A 1OW0A 1KZPB 5DC4B 1EGJH 3GSWB 2IG2H 2FX9H 4TSAH 2NTSP 4ZTOL 5MERA 1T7WA 5DZNA 5FUZL 1T66C 5LGHH 1NCWL 4FQPA 4IMLB 3WS3A 3SEPA 1IL1B 5L8KB 2VABA 4J8RA 4ELMA 4MQXD 3O8XC 1WJ3A 2ZP0T 5DRZB 1G7HA 2CQVA 3PZ1B 3RL1B 2ZSWA 1J9CT 4ODBD 5DDHB 5M95B 1AGCB 4OM0H 4YFLF 2BVYA 1XR8B 5IKCB 4YGAB 4Z7WB 3QIBC 2XPGA 4GAFB 1SYVB 4JANB 3B6SB 2Y25A 1FYTE 4PYHA 4I18A 5F9OH 1M4KA 3B5TA 2ID5A 2YPLD 1RJLB 2MKWA 5C7XL 4ZODA 4NKDA 1U8LA 4FMFA 5DK0B 4LPUA 1LO3H 1JPSH 1QZ1A 2V5RA 4NQXB 3V5KB 4GO6B 3T3MF 4KKBC 4HWJA 2NLJB 5TQ0L 1G7LA 3R06B 2H1PH 4BFBD 1MQ8A 4IMKC 1MIEL 5ADPL 1JWUA 1KYOJ 3OB8A 3DVNB 4ZD3L 4ELME 2ZPKL 5I1IH 2NW3A 3SGJA 4PJIB 5AZEH 4JHWL 5IVOA 3LMJL 4CW1B 3ARZA 3FT2A 1T0NA 4I3GA 3KPRB 2VMFA 5IW6A 5BW7A 5T3XE 4M62H 5FEBA 2IFFL 5DJZA 5BV7C 4MDJB 1YMMA 3AM8C 2ZUSA 1NC2A 4QYOB 2D7NA 4YO0A 3QBTB 2BVUA 3KNBB 4ZUUB 3MLWL 3QDGB 3VWJB 3FB8B 3LIZL 4DGVH 3ECBA 2DM2A 2EDBA 4P46D 5IP4A 4GAGL 4OZHA 1OTSD 1VHPA 4FQ2H 4NP4H 3AREA 2R2HA 1X5YA 1EEUA 2C3HA 4MCZA 3T0AA 4JG0L 5DMIH 2G5RA 5CLTA 3CZJA 2FIKB 3RTQC 3HI5L 1YZZA 1AH1A 3GI9H 1YNTB 3VE0A 1U8IA 3BPOB 3BDYH 3OKEA 4S0SD 4NN7B 3CU7A 3BO8B 4D0BA 3OR7A 2DI9A 4GLRI 2AJSL 4MVBD 2H8PB 3FRUA 4NFBA 4FFWD 3DGCR 2VQTA 2HVJA 2VXQH 3H0TA 4OIAA 5E94A 5B3JF 1YMME 2A74A 1K4CB 2V9QA 1XF4A 2PW2A 1FNGB 4KKLD 3KPOA 3CFEB 2AJ3A 4LKCA 1CGUA 3S37L 5C0FB 2WINB 2QHLA 5ENWB 2UY7A 1MCWW 5DJYB 2AJXL 2X4OA 5J56B 1J12A 4OZHE 1KIQA 3N85L 1YYLL 3VXQB 2JJTA 5EDXA 4OB5H 5IG7A 1U95A 2BSSB 1A9EB 5DK2B 3JWOL 4NYLA 5J6HB 2ZG3A 5GGQH 5EORH 1OARH 3DYMA 4LEXL 3DUSA 2VLLB 3SDXA 3G6DH 2VUYA 5I1LB 5CBAA 4ZFOB 2VDOH 2A9ML 2I07B 3VD9A 4QHKI 2EECA 3ZYJA 5D1QA 1X9QA 5FUCE 4KROC 3VD4A 3I50L 1URLA 4UOJA 1CE6A 5J12B 4UTAH 4IRJC 5D9SA 5DD3L 1NFDB 1X3DA 1OB1A 1JTOA 4Y16B 3VFRA 4YDIL 5D1ZA 5ETUB 4F2MB 2GT9A 4OZFB 1J18A 2Y36H 4K3EH 5GISL 1OCWH 3CGTA 1XGUB 1YEEH 5D7IA 5J9PB 3C5ZD 3M8OL 5I8KH 4G43B 1K4DA 3C60B 2Q87A 2FIRT 3QDJB 4JRYD 2N7AA 5DC9B 1KJVB 1UJ3B 4HQQH 1P7KB 3SDAC 4QRRA 4LSTL 1BD2A 1XGQB 4UILL 1JZ5A 4XWOD 4Y4HD 5I9QB 3VD3A 3JBG7 4KVCH 3MRCB 4JM2F 3OBAA 3UAJD 3J7HA 4NPYB 1MREL 3E6HB 2YD1A 3MRMA 1IAMA 4JR9L 3SDXE 1LEKA 1NCNA 2Q8AH 2EE3A 1N0XL 1OP9A 3MXWL 4PV9B 3IVKA 1GSZA 3U4AA 1NCBH 1LO5B 2CLRB 3EJYC 1A6TB 1ZGLP 2WUBL 1DANU 3AB0B 1TJIH 5D7JB 4I3SH 2DQJL 1JWMB 1AC0A 1MQKL 3RWGB 4FTVB 3V2AR 1M71A 1KCUL 3FQWA 3KVQA 3QEUA 2R69H 4X9IA 2NCMA 3GMOA 1VENA 5DMGD 1HH9A 1UYWL 1V3KA 2B7DT 2Q1EA 1MFCL 3P9LA 5D7IE 3RL2B 3EFDL 4GTPB 3BKJH 3NCCB 1ZVYA 5HGHB 5CHNB 5DRWB 3KR3L 4QRRE 4E42B 1BD2E 1Q94B 4G80A 2OJZH 4LBEA 3NZ8A 1R76A 1H3CA 1FVDB 3TZVD 4APQC 5ITFB 3CVHL 2BJML 4UIMB 3GRWH 1A14L 35C8L 3CD4A 4KTDH 4NO3B 3G5ZB 1P69B 1UCBH 4OT1L 4PG2C 1ZHBA 4Q6IB 5CJQL 3C60D 3QZWA 1MCSA 1R3JB 4NQDB 5JDJA 1X7QA 3MRLA 5IQ7H 1JGLH 2QHRL 2P24A 4I3RH 4MDIB 3OF6A 1IGIL 1FFNB 4C83A 3M07A 5C0BA 3W39B 2YKLL 4ELMF 3GSWA 2BHYA 1DDHB 1C08B 3BOVA 5DJXB 4FXGB 2AEIT 3TT3L 4KK8D 5I0ZA 1MHHA 3ZDZE 4IMLA 1CXKA 4JB9H 4Y5YC 4X83A 1CFVH 4I0PA 1ZANH 3RDTC 1HYSC 3GMQB 2VL5A 4S1SH 5HDQH 2V5SA 1S78D 1F4XH 3RL1A 2NY2C 2IPUK 5DDHA 1H5BB 3HPLB 4NUJB 5FYLD 3OJVC 5I8CB 4FTVD 4OQ1A 5IKCA 4Z7WA 3UZVB 3EUUA 4EUPH 2B20A 3ULSB 1KC5H 4RIRB 1SYVA 1U92A 4JANA 4K7PH 4OFYD 1J1XH 3B6SA 5EO0A 5DZOA 4ZG1A 3V4VH 1ZGLM 4PG9B 1ZKAA 1UFUA 4ODVL 4WTWA 4NQXA 1KB9K 2R29L 5C0BE 3V5KA 4XP6H 1SA4B 2VDRH 3VI4E 1RZ7L 3LPWA 4YC2C 1QACA 3R06A 3R1GL 4FZ8L 5A2LH 4PRBA 3P4MB 1FAIL 3IF1B 4NQDD 1T89A 4FQJL 3U0TA 4PJIA 4LSUL 1SEQH 4CW1A 3SDCA 5F71A 4DN4L 3KPRA 2JJWA 4TNWK 2QSCL 4OKVB 3U0WL 2Y5EA 4Z7WE 3BZFA 4QYOA 4WW2B 4MA3B 4TSCL 5IT2H 4OZHF 4JPWH 1X5JA 3VWJA 4ZUUA 3QDGA 3FB8A 4LPYA 2GQHA 2UVFA 3DBXA 4BA8A 5IFAL 1KXVC 2IMNA 4K7PX 3HZVA 3SE8L 3DOSA 1QNZL 4PFEA 3UYRL 5EU6D 4LAJH 2B4CH 1JF5A 4XZUB 1I8KB 1PD6A 4JO3H 1KB5H 2HLFC 2SEBA 1R5WB 4NKQB 2FIKA 3QUXB 1FVEA 1XGPB 4KK5C 3BRFA 5B22A 4ALAH 1ADQL 2B2XL 4PJIE 2FX7L 2OP4H 3BO8A 5FM8A 4GTMB 1RUQL 1H3TA 3PV7A 3SO3C 4OD1H 3KPRE 4D4DA 5KVDH 3LRHA 4FFVC 2R0LH 4Q58C 3RNQB 3FB7B 5GSRB 1K4CA 1FCCA 3QZWG 2V5YA 4M1CD 3CFEA 4L8DB 1H3GA 4DKEL 2F74A 3VFTB 4H0HB 3K7UA 3QDGE 4LEOB 5C0FA 1D5XB 4KH2A 2WUCL 5ALBH 2JE8A 4NQCD 5DJYA 5FA4B 4CN6A 4Z8FH 4YNYB 3PHQB 4Z76B 3AS2A 3BIBX 5D8JL 2A1WH 3SDXF 5J3HC 2BSSA 1A9EA 3C9NB 1DTUA 5DK2A 5J6HA 1OAZH 3O3AB 3IDYC 2VLLA 5I1LA 3CZFA 5TFSL 4L1HA 3G5YB 2IPTL 3L3KB 4KGJA 3VFMB 4BK5A 2I07A 3C6LC 1RUAH 3EYSH 2IBBA 4PJ9D 3BI9X 1P84J 1B4JL 3VW3H 4MD4A 2N7BA 5DJ0B 4L8BB 5D7IF 2ZCKL 1KJ2H 3AS1A 3HE7D 3LDBC 3OJMB 1PW3A 1GIGL 2ZCHH 5ETUA 5HD8C 1T5XA 4F2MA 3DSTB 4WUKL 4OZFA 4HBCL 2M2DA 2D7MA 3OAUH 4YPGB 2VLKD 2YMXH 2I25N 1V3JA 5J9PA 2GYSA 5C9KA 3D48R 3PGDA 4LPCA 4U1IB 4PLOB 1A21A 3WFCH 4F9LC 3MNZB 1QFUL 3BW9B 1A7PL 1KJVA 1UJ3A 1VFOA 1P7KA 4XGZB 2ZKHL 3M45A 3B5HA 1FHGA 1HOCA 4D9RD 5E9DA 1OGTA 1NI1B 3MRCA 3MA7B 1ACYL 5B38B 4OLVH 5IGXH 3JWDC 1WGOA 3E6HA 3BZ4A 4O02L 4AENB 3M1BA 1GHQA 2H9GA 4EI6B 1NGQL 4X6FB 4PV9A 3BUTA 3W81A 1DBBL 4KHXH 2ESVD 1LO5A 2CLRA 2ZUWA 1A6TA 4G8IB 1FNAA 4OTXL 4MAUL 3ZDZF 1IBGL 3NBNA 1ORQB 4AJ0A 2IADB 2N1KA 5D7JA 2AV1B 2X4RB 4I48B 5D2LB 3RWGA 3SKMB 3UO1L 4XX1E 4AG4L 3MJ6A 2J88H 4M1GL 1I3UA 4KI5D 3BP5A 3RL2A 1PLGH 3UYOD 3QDAA 1FV1A 5ID0A 3V4PL 5CHNA 1CE1H 1L6ZA 4NZDA 1WBZA 4QLRA 5D6DA 4NNPL 1ZV5A 3VRIA 4WVRA 1PQZB 1LO2L 2Y06L 3MLUH 4IRSC 1NGXB 2DJSA 3ARDB 3QHTC 5E9DE 1IC1A 5I17B 5F1IB 3LKSA 2EE6A 5CS7A 1FVDA 1Q38A 2HT2D 4NO3A 3OAZK 4J3UA 1J0ZA 2Y1VA 5T3ZL 4NJAL 1W8OA 4OSUL 4H1LB 3VI4F 4JVUA 4UV7H 5F93C 3SDYL 4MDIA 5I73B 4MJ6B 5KSBB 5BRZA 3FZUC 2JELH 4U1SA 2RJMA 5T1LB 1P5VA 3HNSH 3QDMB 3L3HB 2DF3A 5CZXC 2P44B 1DDHA 1C08A 5DJXA 1IE5A 4FXGA 3OXSB 4WHDA 3CXHK 1ZLUK 2NZ9C 2O5YL 3B9KA 1DFBL 4UU9B 4ZFGL 2J8HA 3LRGA 4JCLA 4Q9RH 1L0QA 4Z7WF 6CGTA 2Z31B 5JLZB 2AERT 4HFWA 1H5BA 4WI5A 5F3BB 4X99A 3QCTH 2OK0L 4EBQL 1N8ZB 3WL9B 3QEQD 3QQ3B 2C3XA 3JSSA 2VDPL 5JORB 4RIRA 3BPLC 4HXBL 3LQAH 4PB9H 2PO6C 3TBWA 2P8MB 1MCEA 1N7MH 1QKZH 2VAAB 4HUKB 2ZJSL 1ZHLB 2CMRL 3IYLW 5BRZE 2QQLL 4XX1G 4IDJH 4OZFG 3P4OA 4U0QB 4GSDL 5DFVC 4IHOA 1WZMA 4PJIF 1UM6L 5HGAB 4J3VA 1TFHA 4OD2B 3KPNB 5C09B 3P4MA 3NH7H 4POZC 3SGEI 3IF1A 4QWWC 3HI6L 5LGKA 3WXVL 4M6OH 4RGOH 1WZLA 1T80A 1O6HA 4M7JH 1R3HB 3MOQA 4M93C 3TYFB 3UTPE 2FX8H 4HK0B 4JFYA 3D2UD 2DWEB 4OKVA 3QDMD 2A77H 5T5NG 2X9XA 1AGDA 5E70A 4XCYB 3IFNH 4OGXL 4U6XA 4LLWA 4WW2A 4JVWA 5JHLL 5IJKC 1OGAB 2BY2A 4AK1A 1P7HL 1BGXH 1ZAGA 1CVSC 3GJEB 2A6KB 1FPTL 3KWWB 4HUWB 1UB5B 4AEIL 3FFCB 3H9SA 4XZUA 5L9DL 1I8KA 1Q0XH 3PHSA 1P4LB 2XQBH 1OAXL 2G02A 1U3HA 4AIOA 3CFKB 1QSJA 1ETZB 3WUZA 3QUXA 4JHAL 4L8SB 4Y2DA 5A3IC 1XGPA 3MO1B 3A6CL 4CMHB 1Q0YH 4R4BB 4P4KA 4GRWB 3GKZA 2HWZL 2BB5A 4HXAH 1AP2B 1X5KA 1IM9B 4ZPTB 1M7XA 5MI0B 1KOAA 3I02B 1B0RB 3HN3A 4OV6F 1CS6A 4X6EA 3RNQA 2IBZY 5GSRA 5EOQL 3GSXB 1FZOB 2ATKB 4TVPL 1WISA 3REWB 1WC7A 2VLRA 5C09D 3MLVH 4URTB 1IAKB 1U41A 4LEOA 4K8RH 1D5XA 1OT1A 1YEJH 5FA4A 3FL7A 4YNYA 3JUZA 4HG4K 4HFUH 3TYGL 1HZFA 1MHPL 2VERN 1FT2B 3H9SE 2JCCB 3PQYD 4L3CB 5EOTA 2OXHA 2GSGB 1OAKH 1WEJL 4HCRA 3U30B 1F00I 3EZ8A 4MMZC 3FFDB 3SE9H 1YJDH 3IAQA 4HW6A 2VDLH 5J1AB 1DL7H 1VA9A 3NA4A 4NQTA 3G5YA 3L3KA 3P0YL 3VFMA 2BY0A 5HYJD 1XEDA 5ANMB 4KZDL 3FFCD 3QI9B 4QRTA 3TH2T 2AI0H 4U7KA 3QT2A 1CG9B 5DJ0A 1EFXD 4ODTH 3KLSA 3GHBL 1F3DH 2XWTA 2CDEB 2VLRE 3WFDH 2VH5H 4KC3B 4RMRA 1UA6L 3LN4A 3HXDB 5A2JH 5C0ND 1T1XB 3RY5A 5E1HB 3U1SH 5GRYA 3O8XB 4U1IA 1SMAA 4KFZC 4M6NH 1UEMA 3GSVB 3EIFA 4XPAL 3MNZA 4O4YH 2OR8A 1Q8MA 5T5NF 3ULUH 2HH0L 4LQ1A 4GBXC 1KEMH 4J1UA 4PJ8D 3MA7A 4GTQB 2J7LA 4P2OD 3UX9B 1BECA 1Z9LA 4JY4A 1MJJA 4X7TB 4W6XB 4DK6A 3HAEH 1IFHH 4X6FA 1H3PL 4YXKL 1NJ9B 4OCNC 3RKDC 4XC1H 5FHBH 3GIVB 5HHNB 1ORQA 2IADA 1HINH 2AV1A 3MGAA 1QUNA 4I48A 1HN1A 5AZ2L 3VMNA 3WLBB 3SKMA 5E6IC 1I75A 4HWBH 1F3DJ 4U1LB 3FMGH 5J13C 2F5AL 1S7UB 4PIRF 3FQXB 2EO9A 1CICA 1YECL 3RVTC 1MCIA 3PF2A 4KK9D 1UH2A 1DLFL 2ARJQ 1BP3B 1AR2A 3L1OL 3CXDH 4XB8A 5LXGH 5CILH 1PQZA 3GSNL 1NGXA 1BJ1J 3ZL4L 4PGBB 3ARDA 1D9KB 5I17A 2I24N 5F1IA 4OI7A 1T66D 4YE4H 5E8DL 3RWHA 1TJGL 1Q9KA 1O6RA 1AXTL 4KRMB 4PY8I 2V5TA 2HAZA 2VR9A 1U9KA 1TNUB 3C2AH 2XTJE 3LHPL 3ZDXE 4H1LA 5KSUB 4PUBH 3H3PL 5HVGB 3Q1SH 4E9LA 1W72H 3DSNA 4XMPL 5KSBA 3VXRA 3QIBD 1L6XA 1EGJL 5T1LA 2IG2L 2FX9L 4N5EC 4TSAL 3QIUC 4FFYL 3L3HA 1OY3B 3OSKA 4IS6A 1CIUA 1D6EB 2PTVA 1LE9B 3RTQB 1FZJA 4WI8A 4WFFE 4UAOC 3G9AB 1HQ4B 1EEZB 3PL6B 4XCEB 1N4XH 2Z31A 5JLZA 4DQOH 4OM0L 1JGVH 5KSAB 5F3BA 2PR4L 2UYLB 5EO9B 1N8ZA 3WL9A 5GZNC 4PTTB 3VRJB 4JJ5A 1INQB 5JORA 5C70A 3LPGA 4G7VH 5F9OL 2P8MA 3GNMH 2BNUB 4HMEA 3PG2A 4RMWA 3ARFA 5DUPH 4LHUA 1LO3L 1JPSL 4U1JB 1JNNH 1ZHLA 1OQOA 5KSBE 4M3KB 3VXRE 4NFCA 4HGMA 5DRXA 4G8EB 3MGTB 5MEPA 2D4DA 3SQCA 2NYYC 4Y2OA 3OKLA 2XXCB 5C2BH 4RWHA