4PUSA

Crystal structure of influenza a virus matrix protein m1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
HSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Matrix protein 1
publication title Crystal structures of influenza a virus matrix protein m1: variations on a theme.
pubmed doi rcsb
source organism Influenza a virus
total genus 54
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pusA02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4pusA01
4ITVA 1EA3A 3MD2A 4IQ4A 3VDXA 4D9JA 4PUSA 5CQEA 2Z16A 1AA7A
chains in the Genus database with same CATH superfamily
3JAMZ 4IJAA 2FMYA 4XRSG 4C2MJ 3BTLA 1FOWA 1FT9A 2ID3A 2YR2A 3ZGKA 4U0YA 3AG1H 2PJPA 2I10A 3HXLA 1BN5A 2GLOA 2J5OA 3SZTA 3J80Z 4V19K 3TEDA 1VQ8I 5E79C 1SD7A 1UMQA 2VBXA 1LE8B 3V7SA 4AC0A 4HDUA 5LHHA 4E7ZA 1R6RA 5TISC 3OYAA 4BKXA 3TW7A 2DAOA 3FF5A 1I1GA 2R7QA 3ISPA 1XSXA 5BOXA 3BR3A 3H9QA 2L4AA 2NVTJ 1TWAJ 2HTJA 1G3TA 1USTA 4HQEA 2BY3A 3K4KA 1R71A 1E3OC 2H6CA 1QO0D 2WAQA 3A01A 3LSIA 3HOZJ 5LD2C 3HOXJ 2ACJA 1ODDA 2EBIA 2ECCA 4JBAA 3U1DA 3QOEA 1DGWY 1QHHD 1HKSA 3WU0A 3HOVJ 5LGNA 2Z33A 3BR2A 2NNNA 3VYSB 3H9JA 4KIBA 4YELA 4W97A 3JRCA 1HW1A 1LJ9A 2HQAA 3HQAA 4XLFA 3L2RA 4G7OF 5DEQA 1BM9A 4JX4A 1HW5A 3BJOA 4NDLA 2BY1A 2R5ZB 2HU9A 4ENMA 3ABMH 4I0AA 4HNVA 2ZJ2A 3S3MA 4LFUA 1O3RA 2V6CA 2P4WA 1OYWA 1T98A 2L9VA 2TRTA 3U9GA 4A93J 2QENA 2X1DA 5FLXK 4CXFA 4UB6C 2BGCA 2V9KA 3QAHA 4KDPA 3BCAA 4KYWA 1IN6A 3I0TA 2ZJQF 1OQYA 1FZPB 1X1BA 2DA6A 3SEZA 2HEOA 2ELHA 3KZYA 4OU0A 1Z6TA 3S2HJ 5EEHA 4X0GA 3MAJA 4XBFA 3WU2C 1IDYA 2XRLA 4XK4A 3DPUA 1GLNA 3BPVA 2OCEA 1DPUA 4BE2A 2K4BA 3JSPA 3LSRA 3PFIA 1V55H 2B39A 2K85A 3S32A 3UNGC 5B1AH 1OR7A 4FE4A 3OS0A 4PK4A 4XICA 1FBSA 2EINH 3OMYA 2FQ4A 1EKEA 3QYEA 3HTUA 3VB2A 4ZYDA 4HF2A 5E18F 3J81Z 2A6HF 2ETHA 1UZCA 2Z3YA 4UV8A 2E7XA 2LBFB 4AYBN 3I4NJ 5D8LB 2JN6A 2R7VA 3V8KA 2ZCWA 1DU0A 1ZLKA 1J2XA 2HXIA 2MD0A 3E97A 4PSXA 2VASA 4XORA 4CICA 1FTTA 3K1NA 2VLAA 3KZIC 5IP6A 3S17J 2DFIA 3PSFA 1ZAOA 3H5AA 1I1SA 1OKRA 3I54A 1POGA 1T33A 1T0FC 3W2WA 1ACIA 1TNSA 3CCVI 3SDGA 3C2HA 3E7LA 4BQOA 4Q48A 4ZDPA 2IGKA 4A5NA 1ZYRF 3DWLE 4ZDLA 1K7AA 5CVUA 3F3XA 3GTJJ 1JKPC 1K78A 1ZREA 1U9NA 3PNYA 1A6IA 1FY7A 2CW8A 2FRHA 4MEYF 4LB6B 5FROA 3CDIA 1ZGAA 2X6XA 3SXYA 1ETKA 1I50J 2ZXWH 2XASA 2M34A 3KYCB 1I3AA 2V9VA 3G1MA 4NB5A 5E20A 4BL0B 5FLXZ 1MD0A 5DCMB 5E1XA 4UVCA 1F43A 1HQCA 1PP8F 1R00A 4F7ZA 2QUFA 4M9SA 1BI0A 1D5VA 3NARA 2KLOA 2X4HA 4DBQA 3GTKJ 2IA0A 4DOZA 2DODA 4CYCB 1GXQA 3BT9A 1L0OC 1Z77A 5K5OA 2M0MA 3PJRA 1USSA 3IRQA 3SYTA 3GMEA 3GFJA 3VFZA 4FX4A 1VTNC 4F3QA 2H1KA 3CO6C 1ETYA 4D5FA 3QP5A 2NS8A 2L7ZA 3R60A 4U88A 3TQNA 4EM2A 5JVGF 1JGSA 1GXPA 5D5XB 2BW3B 3VYRB 5IOZA 3OS2A 4ZYEA 3S1MJ 3RKXA 1VNDA 3OV8A 4M3EA 4HG2A 3PUFA 3G1OA 2JPCA 2MABA 3IWZA 1B1BA 2QA4I 2X6YA 2O3FA 1A36A 4WXDA 3K6GA 2EIMH 1WQ2A 3S16J 4AWXB 2ADUA 2P0WA 3OIOA 2CUEA 2XAFA 5J6XA 5C44J 4XRFA 2M5WA 1W36D 2FOWA 1YIJI 3AAFA 1CF7A 5C3EJ 2C6YA 5CVVA 3QPHA 1QGPA 1R7JA 1Z9CA 4RM3A 3VDXA 2HPIA 1S3JA 2Y0SN 4BHPA 4XM3A 2LF8A 4OIOF 1ZELA 2VODA 4R8HA 4Z6YA 4ANJA 5GTHC 3K4CA 2VT3A 2YPRA 1TWCJ 2EZKA 1DGRM 2DJIA 1DU6A 2ICWG 1TL8A 1YIOA 3QP6A 4ZTFA 1XX5A 1G8XA 3KLOA 5ICEA 4GYIA 1ON2A 1TQIA 2JT1A 5J47A 5DS9A 3JRIA 4ENNA 3CO7C 3OS1A 1SVOA 1NG6A 4XL9A 3IV5A 1MNDA 2AXTC 5ERIA 2VL8A 2P6SA 5L3DA 4E7HA 2OPTA 1K61A 1XGOA 2ZMEC 3CP2A 1N78A 4IL6C 3JR9A 1B72A 4HLXA 5L3BA 2RDPA 1U6GA 4Z2YA 1G4DA 5DD8A 5E3NA 1X3WB 2E5NA 2IGMA 3LNQA 2AS5F 3MZ8A 1Y0NA 1IO2A 2CG4A 4KMUX 3U1KA 5GAHJ 4L5IA 1J5YA 2WC2A 3JSOA 1W0TA 2VPLA 1P4XA 1D8KA 1HKQA 4MGRA 2V1UA 3V7RA 2XAHA 4BQNA 3QODA 1W36C 2JUGA 2XIGA 1Y0UA 3W6KB 2F6CA 2JVGA 5EEAA 3DXJF 1V5EA 4M6XA 4B3XA 3GUDA 3CUQC 3TW6A 4K2EA 1FP2A 2I5UA 3JTHA 1UHWA 5M5YJ 2CU7A 3FXQA 2MW8A 5K5QA 4OMZA 1SVLA 4LITA 4HBLA 9ANTA 2LF7A 1N25A 4NC7A 4XOPA 3TMOA 4X1EA 2VT2A 3JRHA 3VPRA 1W7PD 2K3PA 1S72I 4EEFG 5DV5A 4N0BA 1IZ1A 2GA1A 1S7AA 4IHXA 2DOEA 2ZC2A 3M9AA 5FFZA 5HLHA 4Y7NJ 2K9SA 1FOYA 4HV6A 3ABTA 1YG2A 1LFBA 3DEEA 2ID6A 4LK0F 2VKEA 2HYFA 4L9NA 5L3FA 2D45A 1MDMA 4A3DJ 1SAUA 2CJJA 1IGNA 2GOXB 5F64A 1VQ5I 4XNFA 2B7EA 3HL2A 2DFEA 2K27A 1KONA 4UV9A 3LSGA 5JPNB 2LH9A 5J8CA 5IYCJ 4I2OA 3LAJA 2FNPA 1P7JA 3Q0WA 4S05A 2IVMA 3G2BA 4M73A 1MGTA 3IH4A 1R4NB 4HOBA 2CUJA 2CYYA 3AL0C 1X4PA 2AO9A 1S7EA 3WGHA 1MJBA 4RB1A 1HOMA 3CCUI 1HW2A 2E2IJ 4A3LJ 3OWTA 1AKHB 4J01A 3FM5A 2MLGA 1R4MB 5CJ9A 1U78A 3W2AA 1BOBA 5E8GA 4OAYA 4B4CA 4MHGA 5LBQA 1YE9A 4CA0A 2W57A 5ILVA 4XR6A 2JJ7A 2EA4A 2QQBA 4FETA 5ICFA 2CRGA 3HB9A 4AIDA 3DU5A 2DT5A 3HPGA 1UHMA 1WKMA 2XF7A 1RPWA 1HA8A 3H92A 3LQRA 1JUPA 2KISA 2E2JJ 3AG3H 3BG3A 3W2VA 4UUVA 1UCRA 4BS9A 2OF7A 2RV8A 1XDUA 3WGIA 2DYSH 3TOBA 1T6SA 2WAFA 3ABKH 1B9MA 1R1TA 5HLIA 4LIVA 3BTIA 3F9KA 1IRZA 4I6ZA 3CU7A 3I58A 5B5EC 1BA5A 2R7ZJ 4ETSA 4U0VA 2H09A 3VWBA 3GZ5A 2KZVA 1WCMJ 3F0CA 2DW4A 4FHTA 2LOOA 1XS9A 2JPBA 2M0CA 3VODA 4HRIA 4ESFA 5A2QZ 4BACA 3OYFA 3QOPA 4XLAA 4DBRA 1PUFA 2STWA 3I59A 3PL8A 5EYRA 5HLGA 5FLVA 4Y33A 5ICGA 2GWRA 2HOEA 2AXLA 3DKWA 1ZN2A 3EYYA 3RKWA 2EFWA 4BQAA 5FKMA 3FDYA 2CFXA 3A03A 2M3AA 3GTGJ 5CQEA 1H88C 2V1NA 2BZTA 4NQWB 3MVPA 4A3BJ 2ZMEA 3H0GJ 2FMLA 4U87A 3N97A 3LA7A 4M71A 3M3YJ 1REPC 3BOQA 2ISZA 3JREA 3ASOH 4A3CJ 1RNLA 4JX5A 4X6AJ 3OYEA 2EA2A 4RGUA 2ZSIB 2Y0MA 4CSWA 3H35A 2V7FA 4XIDA 2P7VB 2NXNB 3Q3SA 2D2WA 1NK2P 2CQQA 3DEWA 1QZYA 3BZCA 1WGXA 4I7HA 2XB0X 4M3GA 4IRIA 3AFHA 1PYVA 3HG9A 2VXZA 4G7ZF 4A5MA 2DCEA 3CUQA 2P81A 3DPLC 1PJRA 3MKZA 4FTHA 2HYJA 3CDHA 3IHUA 2LVSA 1KU9A 3OYDA 4B43A 3FXOA 3F22A 1VF9A 4XLPF 2ESHA 4IEJA 4BAYA 4ESBA 4YIFA 1FP1D 3KYLA 4CUGA 2FD5A 1MBEA 3GZ6A 3I71A 4BDYA 1LVAA 4M3BA 3PQKA 2IA1A 4UY8I 3WTZA 5HDNA 1E0EA 3M4OJ 2VC1A 1X1AA 2PQ8A 3C2GA 2IXSA 1BC8C 2UWMA 3LSKA 4I0BA 2K9NA 1KU7A 3TL4X 2KIMA 2VQHA 4HWJA 3S15J 4N9IA 1RR7A 2UV1A 3L2UA 3SJMA 3MZHA 3E6DA 2ZO4A 3A2KA 1FNNA 4XLCA 5GADJ 2CV1A 3G73A 4LIUA 3KP7A 3Q0UA 4L0YB 4WB3A 3JRGA 3NAUA 2Q2EA 1N77A 2H8RA 2GXGA 3GTLJ 2YUSA 5JLXA 3ZQIA 3S1NJ 4KT5C 3VYUB 3T5XA 3ZQFA 2E5ZA 1WH5A 3J7ZI 2VONA 1YJWI 3O2PE 1R22A 1Q1HA 3ABUA 3E0JB 3GYHX 5M5WJ 1APLC 1MBKA 2A61A 1WVRA 1YI2I 4CHUA 3E5QA 4FASD 5EF6A 2Y2ZA 1BJAA 3DTKA 5D6FA 2DBBA 3IAM2 2Y9YA 4G6DA 2HKXA 1IC8A 1OCOH 2BHYA 1ULYA 4HA8A 2M7AA 3FHNA 5GPAA 3WG9A 3T8RA 3LQQA 1TZLA 4BDZA 2EK5A 2E7WA 2G7HA 2KRFA 1JT6A 4A69C 2JSPA 2VQGA 2HQRA 2KRCA 3KYDB 1Y6IA 2ECBA 1LNWA 2M1BA 4XLNF 1KYZA 4ZYAA 5C4JJ 1B8IA 2HOTA 4EJOA 2L54A 3CCMI 1MSEC 4HX4A 1K79A 4LGWA 3K10A 1ZGJA 2H8WA 2F5EA 1QA6A 2DA4A 4ZH4F 1IV6A 5F04A 5E3MA 1H8AC 3HKZN 4XLEA 1MKMA 3EETA 1JUMA 4LMYA 2VKVA 3D5RC 3MEXA 4P3BA 1OFCX 2JMWA 2Y31A 4CO8A 3CD6I 2RNJA 4G6TB 3WODF 3L9FA 4ENJA 2QLZA 2X1EA 1RZ4A 3IKTA 4OIQF 2V9PA 3HQBA 5L3GA 2M9HA 4E7JA 2P5LC 1MIJA 2E1CA 1U0JA 1QPMA 4XKBA 2F4OB 4KUMA 2L7KA 4BBRJ 5D5WB 2FU4A 5B4PB 3BQYA 4IRGA 2MSYA 2GAUA 4NUBA 1ZG3A 1G2HA 5JPMB 5IOYA 3BP8A 3VEPA 1YHQI 2DMTA 4WF2A 1EH8A 3HUGB 1IXSB 5B66C 2IBDA 1ZKGA 4YEJA 5F0HA 1S29A 5LHGA 4UUSB 4IZZA 2HOSA 3KLSA 1WI3A 1AOYA 3FWEA 1JE8A 4B09A 4YRVA 3VSLA 1VQ7I 2LY2A 5E17F 2K9MA 3BTCA 4A6DA 2JK3A 3S1QJ 1JHHA 1QVTA 1J0RA 4JP0A 5EG0A 4BY1J 2NVUB 3F8BA 3REOA 1LEBA 1HSJA 4PDKA 3RKYA 2M30A 1MMSA 2K9QA 1WH7A 2YS9A 3QYBA 2EFPA 1YTYA 1JTXA 1ON1A 3M8EA 2W84A 3H3VK 2DA5A 2X51A 4M74A 3DKXA 3FK7A 4M3DA 4WXHA 2M4GA 2WAEA 4BXUA 2VPRA 3RZDJ 2PJRA 5LRRA 5JVTA 1HDDC 4B47A 5HS8A 4UUTA 3L2QA 4EMSA 3KP5A 4L5JA 1CQTA 1ZLJA 1W5TA 1QHGA 2K86A 3OR1C 2CFOA 3J7AY 1ZK8A 3WG7H 1XGSA 4F93B 2P5KA 3TDZC 4I98B 1J75A 2QEXI 4KA4A 3EUKL 3H5RA 2DLLA 2X9DA 3GVAA 4HW0A 4B3AA 2DXIA 1ETXA 3CCYA 1C0WA 5KHDA 4AM3A 4PUSA 1FTZA 4E7SA 4DGWB 3HGGA 1IUFA 5KVRA 2FEZA 4A3FJ 2JA2A 3CC2I 2FF4A 3HYIA 3K4JA 3OYKA 3S2DJ 4A3MJ 3TKYA 1VQPI 5IPAA 1UELB 1YW9A 4QTRA 2LC2A 3ZQHA 1DP3A 3LL7A 2L2OA 2M8EA 3SZPA 5D5VB 1IRGA 5C4XJ 2HDWA 2WADA 3E6MA 3KP4A 4XRSA 1P92A 3NRVA 4F52A 3SEQA 2B9SA 1F5TA 3M07A 3RCOA 3FISA 3RYPA 3HOWJ 2L7FP 1MH3A 4EVIA 1YW7A 1FEXA 4HV5A 5HNFA 1MBGA 3I55I 1I3QJ 3ZMDA 2KDZA 3GFMA 1LE8A 3X2QH 2JA7J 3RJPA 3UKGA 3RZOJ 1X1PA 2R92J 1Z67A 3ZQCA 1IUYA 4G7HF 3I4MJ 2KKOA 4II2A 2FBHA 3DF8A 1P4WA 4OINF 2M2EA 2X0LA 1B6AA 5LRSA 4A12A 2O8KA 2ZFWA 4HX8A 1J59A 1S6LA 1U5TB 2MBFA 4KIGA 1WJBA 3R0AA 4P96A 4E6KG 5LEJA 1UAAA 2HDCA 2R93J 2IP2A 2B63J 3CF5F 4C9YA 1VQOI 3C7JA 4E7IA 4BEHA 1RR8C 2EFNA 2LFBA 5EZGA 5EZHA 4D7NA 1HCRA 1TW2A 2DOFA 2K5CA 2WB1N 2R5ZA 4D1QA 3K9TA 1TTYA 1FOXA 4QLCU 2Y30A 1XG1A 3B6CA 1G3SA 3QPLA 3S93A 3VYTB 2EIJH 1YRNB 4FE7A 1UG0A 1TW3A 4ITVA 3LOCA 5DUIA 2Z2SB 3I5UA 3H0DA 3HM5A 3KFWX 4RDUA 3U21A 3BPXA 3M8JA 5EGOB 3VSKA 2HZTA 3CTAA 4G8XA 4JX6A 2OQRA 3WTVC 5CPRB 3MWMA 4D7MA 4IHSA 2DDAA 3FXUA 3P9KA 2XPVA 3R6SA 1QQIA 3SZGA 4RB0A 2MC4A 5EDNA 2A5WA 4IXAA 3WU1B 3RSNA 4HQMA 2F5CA 5JHUA 3HIFA 1F1ZA 4CCJA 1V54H 3ECOA 3ZMSA 3ZMTA 3SHFA 4RB2C 3E1SA 4IQJA 4S0HB 3A1YA 1KJSA 4C3HJ 2DO7A 2UXXA 2E1OA 1O7LA 4JQFA 3SQNA 1MZBA 3GWZA 2MGQA 4KICA 1ONVA 3AG2H 1MH4A 2JTVA 2L5QA 1OCPA 4WWCA 2CS3A 3QRFF 3OR2C 4J19A 1R1UA 2KMUA 3V8LA 2F2EA 1ITYA 4RB3C 2QSFX 1X3UA 4IF4A 5IYBJ 3P5JA 5IP7J 1YS7A 2M8GX 2YU3A 2R7OA 1MBJA 5BS6A 3DCFA 3WGGA 4BYYA 4HPQA 1PP7U 4EV0A 4B1RA 1I6XA 1OYIA 1KQ8A 1RETA 4YFKF 5TRDA 1HBXG 1B72B 2HVRA 2KRHA 4ENKA 3ZMVA 1KZHA 3M8FA 1P6RA 4LLLA 1MSFC 3WE3A 5J40A 1T38A 2D1VA 4CYDA 1SC7A 2GIZA 2LKSA 2VJ5A 4CCOA 3N4MA 3MMYB 1LFPA 5J3LA 1O3QA 1O4XA 3LSJA 1WJCA 2X85A 4AIJA 2ZXJA 2FNAA 2XGDA 2E1MB 3FHZA 1DPRA 2V1DA 3K0LA 1X4OA 2A3SA 2ELKA 2HWVA 3CJQB 4CYCA 2FBIA 3HGYA 5CVRA 3RQIA 1STZA 2L9RA 3BZKA 3KE2A 4W1UA 1IN4A 3ZMZA 1WJDA 2XHKA 1D1CA 3ML6A 2RVCA 3FMQA 1TWGJ 3WE2A 1EA3A 2BW3A 1W5CC 5FGMA 2QBYB 3PNVA 4XRMA 3OYBA 3T0YA 2HR3A 2OZ6A 2LKXA 1E2XA 2XC7A 4FX0A 4HLYA 4HF1A 5D6EA 3RPUD 4AU7A 4L18B 4Y17A 1R1VA 1XN7A 2K3FA 4KISA 4UNOA 3LSTA 3CLOA 1I6HJ 1G59A 3PO2J 1CFAA 3GTPJ 2OBPA 3LSPA 5DM7F 1MDMB 4Q5SF 2LREA 5K7HA 1KU3A 1BR4A 2N8GA 2Y9ZA 2HVSA 4C2UA 4HZFA 2XV4S 3MKYB 1RRJA 3HC7A 4CZCA 2MLKA 2JQ7A 1MNMC 3JRFA 1E17A 1I5ZA 3K1MA 1IN5A 1IRFA 1Z91A 3H9GA 5KCMA 5FO5A 3V4GA 2AQFA 1XSDA 3RPQA 4BJ5C 1T0FA 1IF1A 5FKKA 3D0SA 3O8HA 2W00A 1YJNI 1NG7A 2H94A 2ZJRF 4IVNA 4KNYA 2KHMA 4N4OB 5E3LA 4P3AA 2G0EA 1H0MA 2MYSA 2VOOA 4UHTA 5CLSA 4AIKA 3RKQA 2DTZA 1TC3C 4YG2F 3BCBA 2O61A 4ASNA 1QBJA 1TLHB 2KQRA 2HGCA 1IN8A 3K4LA 1I39A 2OQGA 3BC8A 2YX4A 1R9TJ 2NOGA 2HFHA 2XAQA 1F4KA 3KP3A 1XGMA 3DPTA 4UVBA 4JK1X 4FQGA 3OYIA 4BE1A 1JJ6C 1P7IA 2O0YA 2E36A 3CMEI 2RQQA 4XLHA 2DFFA 5JHFA 3WTTC 2Y75A 1X3ZB 1LUJB 3GTOJ 4OAZA 2DA2A 1VQNI 5LEKA 2DT6A 1B4AA 4QIWN 1ETOA 2DK8A 3DBHB 3BZ6A 4Y15A 2A05A 3KZZA 3O8GA 3E5XA 2BEOA 2L7MP 4RGXA 3OYJA 2XRNA 4JOMA 1HF0A 5FKOA 3BWGA 4BNCA 2VI6A 3ERMA 4H4KC 3S3OA 1XTAA 1R58A 4Y52J 4BJTA 1TWFJ 1YS6A 1FIPA 4DIQA 3ZQGA 2XPWA 3FMRA 2B0LA 3KCCA 3HOTA 3ONQA 3I59B 2L01A 4OOIA 4IO9F 2LY1A 2RQPA 1Y1VJ 3LA3A 1S8NA 2OU2A 2O7OA 2O6GE 3F8NA 1K4TA 1SFXA 3BJAA 4BHBA 4I99C 4EJVA 1MMDA 1BIBA 4MNUA 1FYKA 1A04A 4LLNA 1XCBA 1FYLA 1BI2A 4AYBA 2F48A 4D9JA 4AD9A 1KYWA 2RGVA 2W48A 5LFAA 5L3CA 1RKTA 3FMSA 1H9GA 1K4SA 1SFUA 3RYRA 2WAQN 1YW8A 2R4GA 3QU3A 1ORKA 3IP4B 2J5PA 5HLTA 5E3OA 3ASNH 3DEUA 2F5FA 1NH3A 2Z1DA 4V2GA 1LFUP 2AQEA 1SMTA 5IT9K 3GBGA 4GFBA 3A02A 3T1BA 4BBSJ 2VOPA 3ZN0A 1QU3A 3HBLA 1Z3YA 3IKVA 2WY8Q 5GAGJ 2QQ9A 3HZJA 4Y13A 4MO7A 1HC8A 4LLGF 2FE3A 2MFZA 2ESNA 4BQQA 5LLQA 3CMMA 1AKHA 2O9LA 2F4MB 2LSOA 3TO7A 3L2VA 2R5YA 1R23A 5J4VA 1LKXA 3K4BA 3WHCA 2L0KA 3R61A 4F91B 1NTCA 2ZNYA 2IT0A 5J1UA 1ETWA 4NBQA 2Z9OA 4B48A 3F8CA 1BJZA 1V5GA 3S3NA 2RC4A 2KPMA 2DI3A 5IYDJ 4BE0A 3LWFA 2OA4A 4DZPA 2CV2A 1D0ZA 1MJAA 2Z99A 3ZP5A 2IJLA 1ZR4A 5JR3A 4HDVA 3WTYC 2QZ8A 2V6EA 4IHYA 3LFUA 1J09A 2R3SA 1LEAA 4LD5A 4O3MA 3BR5A 2PLYA 5BMZA 1YQAA 3BG6A 3R0JA 4XKWA 4A3GJ 1O3TA 2PI0A 4C3IJ 4P9FA 3LAPA 3BG7A 1PUEE 1T95A 4IX7A 1QRYA 2L4MA 3H1CA 3IWFA 2P6TA 1RI7A 4HAMA 3T8TA 3TGNA 2BV6A 3PNTA 3K7AJ 4PGGA 3R4KA 1OCZH 4A3JJ 1BW6A 2ELJA 4IHTA 4HSRA 1IN7A 5EEGA 2Z16A 4B8XA 1K6YA 4CCLA 4MQ9F 3JCUC 4BU2A 2FSWA 2EZHA 1R36A 2R7DA 4KT6A 2HXOA 1RKWA 4E7LA 5GPCA 5CKTA 1VZ0A 2KFDA 2W4SA 2DMUA 1N75A 3RDIA 1DDNA 1EH7A 1AHDP 4G9YA 1WI9A 4FISA 4UVAA 5H6QA 2QQ8A 5GP9A 3DV8A 4JYKA 2DQLA 2NRAC 5IT9Z 5F6FA 4FCYA 3A0HC 4MFEA 1SD6A 2Y0SA 3BDDA 1GV5A 4QWQA 4XOTA 3G4SI 2Y48A 2FA5A 3DTIA 3HEFA 3RPUA 3K69A 5J8FA 3DP7A 2R7RA 3EPZA 1ZTRA 2KZGA 3TDUC 1FLIA 2LNBA 5AIQA 3FK6A 3AKZA 2O5RA 2EZLA 2CUFA 4BH9A 1FWZA 4P5OA 4YFNF 1VQ6I 4RAZA 1RC9A 3ESWB 2BVMA 3CZ6A 4PCQA 2WBMA 2OUMA 5KAIC 3KEYA 2NS7A 3BTJA 2CGPA 2DMPA 2OCCH 4I01A 3G1LA 2K9LA 2E34A 1SMYF 4A6EA 2JA5J 3HHHA 1UHSA 1W7PA 1BW5A 5K7ZA 1OISA 2UXNA 2EPFA 3SFZA 1U3EM 1MMGA 2BXYA 3OL3A 2EZIA 4ESJA 1WJ5A 1GVDA 2AHQA 3GF2A 3J80K 3TP3A 2XDVA 4KN7X 4M72A 4WXCA 2V1XA 1YITI 2A69F 3CJRB 3GLLA 2DYRH 4ABZA 3SDBA 2HKOA 2IA2A 3OIQA 2R7SA 2QQAA 4QSHA 4DZJA 2DT7B 1OR7C 3GO5A 5ICCA 3GLXA 1HLVA 4OWRB 3CDLA 1NK3P 1GT0C 4EJUA 2IS2A 3DBRB 2BYVE 2TCTA 1FC3A 2OV7A 3OY9A 3G6EI 2WWYA 1X2NA 4G12A 4A3IJ 3HRUA 4XONA 1K83J 1ETVA 3AG4H 1OCRH 5BPDA 5LHIA 4IHVA 1WPKA 3L1PA 2IEKA 2D5VA 2CQKA 1U8RA 5H2FC 2R0QC 1CGPA 1VFCA 4IOAF 2E71A 1YFHA 4MQVA 5E8IA 2NOJB 3A01B 2DK5A 2OD5A 2HQ5A 2E19A 3BG5A 3O3KA 3B73A 1W5SA 1MNEA 3GTMJ 3PQJA 1UB9A 1XMAA 4UB8C 4BGDA 1WRJA 2NVYJ 3HSFA 1Z05A 1IDZA 1A31A 1W0UA 1QNTA 1U5TC 1XGNA 1XCVA 2ZXHA 2VQLA 1S9HA 1S5LC 3MZYA 4EQQA 4MTEA 3ERED 3FZVA 1D3YA 4D5CA 3CP8A 4GCVA 3MKWB 2HI3A 1X2MA 2JVHA 2BVLA 2WY7Q 1Y1WJ 3NWSA 4M6VA 3C2BA 1LQ1A 4U0WA 2XAJA 4MEXF 1IG7A 4OMYA 3N05A 3WHBA 4LG0A 3UR3C 1XC5A 2HDDA 1LDKB 3LA2A 5JLWA 3F21A 3CUOA 1JHFA 3COAC 1X19A 3F8FA 2O8XA 3WTSC 2WTEA 2A68F 4LB5A 2PBIA 1ZARA 3PM1A 3J81K 4EGYA 4IOCF 2LK2A 3OL4A 2HOAA 4L5EA 3E6CC 4E7KA 1QPIA 2HVQA 4WB2A 1XD7A 4II3A 4N4NB 2MC3A 4I76A 3C3WA 5J4YA 2FUG2 2ZFUA 2JSCA 5JI6A 2XF5A 3V42A 4ZZLA 1OLTA 2CO5A 5DDGA 1FSEA 2R7FA 2H1LA 2LR8A 3M1EA 1TBXA 3ROUA 4FXGB 4R1HA 4L9VA 4RAGA 4HW5A 3DQVC 4BXFA 1T2KA 5FD6A 2X6OA 4MFDA 1MMAA 3HUGA 1XB4A 4UUSA 3BJ6A 1Y8QB 2R7WA 5IT3A 2VE9A 3H3ZA 4P9UA 2KDOA 2VC0A 1SFEA 4E4HA 3B02A 3BQZA 4DYQA 4XKCA 5CQGA 4EATA 3BR6A 5HODA 1XSVA 5HVQC 4GDFA 5GTIC 1PDNC 2JZYA 2YSRA 3HDDA 2KJBA 2ZNZA 2VXDA 4NC8A 5HDGA 4BEHB 2G9WA 3ZOBA 3EUHC 4CCMA 5HNHA 1TT5B 2FXAA 5K5RA 5FFXA 1HXDA 3S14J 1XPXA 2CQNA 4F55A 3D1NI 2HYGD 2EV5A 2PX9A 4Y3OA 3I9V2 4O5VA 4QPQA 3L2CA 2H6BA 4O6JA 2XGEA 1Y56A 3W6JB 1BR2A 3A0BC 2GA2A 3IL2A 4L0ZB 2HPMA 1VQ9I 1BI1A 1K78B 3M7GA 1FOKA 1Y39A 3FX3A 3BY6A 3SFIA 2E2HJ 2ZJPF 5H20A 2PN6A 2HTSA 4PFOA 5BQTA 2FX0A 4GYGA 3EDPA 5B1BH 1YX3A 3OOUA 2YX7A 4G6QA 4HF0A 3G3ZA 4RS8A 3IH3A 4YIRX 2VE8A 1G3WA 2NVXJ 3RQ4A 1FBUA 2CH0A 1KU2A 2EJRA 1WFXA 1YYVA 5DCFA 2VJ4A 3CCQI 1WJFA 1K6OA 2OZUA 3K1PA 1GVJA 3IRRA 4CCNA 1QVUA 2VN2A 4IHWA 1PVEA 2P7CB 1GUUA 4AVZA 3HTSB 3JRBA 3GCMA 5DUKA 3F23A 2UUZA 4NHJA 2IS6A 5E1ZB 4M9XA 2F5DA 2LKPA 3Q5FA 3BLYA 2BXZA 1R5ID 2E1MC 3W6VA 2HZDA 6PAXA 5DD4A 1W1WE 1DP7P 3KEQA 4N9HA 2IAIA 2R7UA 3LSMA 4HNTA 1AU7A 4PJNA 2NS0A 3GXOA 3FIWA 2L02A 2OC6A 2X1CA 2A07F 5KNLA 4KFCA 3CCEI 3Q9VA 2XROA 1WZ2A 4LG3A 2QYOA 1ETQA 2VBYA 1BL0A 1ZRFA 2F4IA 1EF4A 3PFYA 4C3JJ 4ZYGA 4U7BA 2LLKA 2KIFA 3HOSA 4PFPA 5M5XJ 4KN4X 2CV0A 1Y8RB 2DU9A 3S1RJ 1CF7B 2GZWA 1TQPA 2XGXA 3HRMA 1JGGA 2QCOA 1U5TA 2LBFA 3PSIA 1SFKA 4GRIA 1KA8A 2OTLI 3TOAA 3PUBA 2CSOA 3HRSA 3MCZA 3P7NA 2PG4A 3DKYA 2L3DA 3MQ0A 1MW7A 1DQUA 4EM1A 2VJIA 4PZJA 1FBQA 4CDGA 4RGSA 1D8JA 2IS1A 1YJ9I 2VUMJ 2HQNA 5KAFC 2JA8J 1A5JA 3ZMUA 4CH7A 4BXXJ 3KP6A 4LK1F 2VKHA 4HYEA 4PJJA 5D5UB 5FD5A 1KQ9A 4EJTA 1YRNA 1BI3A 4A0XA 3OYHA 1RUNA 4EGZA 1P2FA 1Q1VA 4RLFA 2XAGA 4AVPA 2LMDA 2DA1A 3IUOA 3CC4I 1KGSA 3NWTA 3FKIJ 1SD4A 5EGOA 3OYCA 3CCLI 1SVMA 3TBIA 1ZRCA 1LB2A 2MD5A 5J1YA 2E60A 1IW7F 3LFKA 2PMZA 4EM0B 2IGNA 3MN2A 1HKTA 2CWEA 2FBKA 2XB5A 1BC7C 2IGOA 3HKZA 3K4NA 3Q9SA 1LDDA 1IV8A 2DA3A 2F5VA 3QU6A 5DCMA 1M1EB 2I8DA 2HS5A 2DMQA 2WV0A 1IXRC 4FXKB 4UU9C 5H6RA 5FLMJ 3MKLA 5HS9A 3G71I 3A4CA 2MG4A 4PSWA 2DA7A 5J1RA 1OYYA 3IAS2 3EUAA 3O6BB 1F9NA 1VQ4I 3ZRGA 2LYCA 3QYFA 3EUHA 4M6YA 3E5UA 1TNTA 3BR0A 2PMHA 5DM6F 3EYIA 5K1YA 3E6BA 4MIMA 2A6EF 3GEZA 4LOCA 2LD5A 4QPOA 2CQXA 1O57A 1O7FA 4PJMA 4NNJA 1X1CA 4YIIA 1RUOA 4RMNA 3NQOA 2M87A 5FJ8J 2G7UA 4FT8A 3CCJI 2P5VA 4PJ0C 2K4JA 5F1RA 2Y69H 2DTRA 3RTRA 2FOKA 3Q0VA 2RAEA 5KK1A 4ZJZA 2TDXA 3NEUA 4IKFA 3OSGA 3WTXC 2V4JC 1V4RA 1UG2A 3GX4X 1X1DA 3I53A 1E3PA 2DPUA 2GXAA 4XKVA 2MH9A 4YFXF 2CMPA 2QSGX 4Q4ZF 3KPHA 2DOAA 3FXMA 1R49A 1KQ0A 2IW5A 1SD5A 4ZC3A 2ZSHB 2W1OA 2DDBA 2YU9J 1UFMA 1JTYA 2E35A 2A5YB 3FXKA 3BROA 1RIOH 3HHGA 4ZZDA 3MD2A 2RNGA 3E3VA 1IXCA 2VJJA 4HEA2 2A73B 1FX7A 2D1HA 1W4MA 3KETA 1ZGWA 3CMAI 1DUXC 5FKLA 3GTQJ 1NHAA 2WA0A 2NNYA 2M7BA 5IY5H 2BY2A 2ZB9A 2JWTA 3P9IA 5F0CA 3CQZJ 3PIPF 1ZQ3P 4GO1A 2QBYA 2QKMB 1VQMI 1X58A 5ILSA 5ILUA 5A2QK 1IAWA 1TP4A 3PO3J 4RA2A 1WJEA 1OPCA 1ENHA 1TWHJ 5F27A 1ZH5A 4RBOA 2RKHA 5TJJA 1D0YA 4A3EJ 2XGCA 3BR1A 1JKRC 1R5GA 3F72A 2KL4A 4MTDA 4L9JA 2W24A 4LJZF 4DYRA 1A6QA 1OMIA 4ZTJA 2KJCA 4I09A 5FKNA 3V7CA 5LGTA 4J00A 1D1AA 4A3KJ 1LPQA 2O03A 3DTEA 4XSXF 2W25A 1WJAA 4GXOA 2QGUA 3V8JA 2BHZA 1IRXA 5F08A 1JKOC 1TT0A 2GXBA 2GM4A 2PMUA 3HOUJ 1WHUA 4XQFA 3I3LA 1MBFA 3ECHA 1PUFB 1GHCA 1HSTA 4RAYA 5FB2A 1OCTC 1TQMA 2DJNA 1Z0XA 4Y4RA 3K2ZA 1JUSA 1T56A 3FBIB 3GFLA 3HSEA 2PEXA 3L00A 1B9NA 1A35A 3K2AA 2R5YB 2STTA 1WSUA 1EJ9A 3J7AO 2GIVA 2KIUA 1U2WA 1P4AA 3IH2A 4M9ZA 5HS7A 2KT0A 2Q0OA 2WV1A 2ZMEB 3F6OA 2FQ3A 1ZR2A 3MFKA 4OIPF 2K40A 3DU6A 1I27A 3OYGA 1H9TA 3DFGA 3CLQA 4KITB 1ERDA 3CJNA 3ZXSA 2EQRA 3FKJA 2BE5F 4F92B 3JRDA 3KEOA 2H27A 2E1NA 3QPSA 2WB1A 1MMNA 2NYXA 3ZR8X 4C2TA 4TV7A 2BY0A 2UZKA 2X6WA 2LTPA 4U7DA 3L7WA 5EJCA 1L3LA 1V5FA 1FJLA 1Z7LA 3LMMA 2QVOA 5JFRA 4H0EA 1YX5A 3CUQB 1P9QC 3ZCOA 2MA3A 2L9SA 1FMWA 2OAZA 1Z1DA 4DQ2A 3QPTA 1JXSA 2XKPA 4DNCA 3FXRA 3IC7A 5F1JA 2W7NA 3ZQLA 4IRHA 1G6NA 5HDKA 2V26A 4DYCA 1BIAA 4CGZA 3JW4A 2EWNA 1IJWC 1ZG1A 3ULQB 2EIKH 1JKQC 1MJ9A 3FBNB 1FYMA 2XAUA 2A6TA 2JUCA 2VIXA 3TO9A 4CCKA 3OOPA 2LDUA 3I56I 3H5NA 2KP6A 2XKOA 4XN0A 4P55A 1Z3XA 3DLLF 2Z5UA 2IS4A 3WTWC 5B3SH 3FM3A 3KP2A 4OIRF 3RIRA 4AIHA 5K7FA 2OTJI 1EH6A 2Q2EB 4HNUA 5BNGA 2LG4A 2DQRA 4M3FA 3S8PA 4WX9A 3GFIA 2ZXIA 2COBA 5CVJA 4B44A 3AL0B 3U2RA 1MBHA 4A2UA 1J9IA 4XN3A 3HPHA 1XMXA 4HSTA 1RESA 4RM2A 3KIOA 1HDPA 3JTGA 3D5SC 1YLFA 2VB6A 5D8KB 3OYLA 1Z21A 2L9NA 1D0XA 3GZNB 2XUBA 4KJZA 4P1WA 3P9CA 5AIPA 1AWCA 3C1DA 2VBWA 1O3SA 5FRMA 3H3UA 1D5YA 4GGGA 4NQWA 2NAZA 4BY7J 1W7PB 4WK8F 3HOYJ 3QWLA 3F8MA 2LRDA 1UJ8A 4PJLA 4AUXA 3B6AA 2XSJC 1BOAA 1JJ8C 4KMFA 2CW0F 2CQ7A 2M4KA 4ZDOA 4HX7A 3ELKA 3L2WA 1Z6RA 2EFQA 2DN0A 1YO5C 1SANA 1B8IB 2K7LA 2W85A 2VBZA 3K70D 1WWXA 3TP0A 1YOVB 5DTDA 4I6OA 5L3EA 5HOOA 2CW7A 2EB7A 3W3CA 4DJAA 3JRAA 3CC7I 2EH3A 3CMYA 1VI0A 2GBYA 5IP9J 2QWWA 1GDTA 2QSHX 5M3FJ 2GOMA 2QM3A 3VOEA 1FPQA 4BUPA 1SEUA 3ZPLA 5FRNA 2JRMA 5E1WA 2IRFG 3ZN1A 4DW6A 1ZRDA 2QKLB 2K02A 2COMA 1SAXA 2QF7A 2Q8KA 3HSRA 4RGRA 3CF2A 4BHCA 2XSDC 2EV0A 4KIFA 5DYMA 2V79A 3C18A 4V2FA 4PGHA 3OYNA 5ED4A 4L9TA 3CESA 1SFOJ 2XF6A 3J7YJ 4ON0A 4C30A 4A0ZA 3JAMK 4MLOA 1Z7UA 2EV6A 3GW2A 4CZZA 2DMNA 5BPIA 1FMVA 2MH2A 3M1CA 1EV7A 3FXJA 3EQLF 3FXLA 1F36A 1JI8A 3HJEA 3LSHA 1H89C 1R5HA 3KLNA 4BJ6C 1J7KA 1VQKI 2XPUA 2M45A 5TGTA 3K4MA 2KIQA 1V3FA 1QZZA 4I02A 3F6VA 2ZKZA 5F0FA 3I64A 2JA6J 1BR1A 3WTUC 2EFOA 3DLAA 5EG0B 1BBYA 5D4SA 3ZQQA 2W82A 2OJED 4RAFA 3QQAA 5LGUA 2VQCA 3CCRI 2FJ1A 4P39A 1U9OA 4Q47A 1XDSA 5GAEJ 2BOLA 3K70C 4RLQA 1G3YA 1LDJA 2P8TA 1T08B 2PMZN 1T39A 4NC6A 5AONA 1E3HA 3OIPA 1OCCH 2JRTA 2NVQJ 2GQQA 3KX2A 2RN7A 2PJRB 1XMKA 2Q1ZB 4LG0B 4R79A 1QZEA 2DFHA 4XMYA 2RREA 2LY9A 2DPDA 3DBLB 3TO6A 2ZBKA 4E70A 3L09A 2R7XA 4EJWA 2PFBA 1GV2A 2EILH 5CVIA 2HNHA 4ZYHA 1C5AA 3BG9A 1JT0A 3ZQ7A 1ZG5A 1D1BA 4S04A 4XSZF 2X48A 4D0PA 2LP0A 1T8IA 4WCGA 3OSFA 3CJTB 4A0YA 1VQLI 1FSHA 5CYVA 1ZHFA 3RI4A 1B59A 2ME6A 1U8BA 4IPAA 3OYMA 3ABLH 1LVKA 2XVCA 5M3MJ 3H36A 2IPQX 3S2WA 5D4RA 3HRTA 4IQ4A 3CCSI 2VKDA 2ISYA 3D5LA 2R7TA 3PIOF 4G94A 3I4PA 1OJLA 1S7OA 1FIAA 2CUZA 2BBYA 4UXNA 2ME0A 1AA7A
chains in the Genus database with same CATH topology
3BC8A 2LBFA 3PSIA 1SFKA 4GRIA 4CUGA 3KYLA 3ZGKA 3DPTA 4BDYA 3PUBA 3OYIA 4BE1A 3HXLA 3DKYA 2RQQA 4XLHA 5JHFA 1MW7A 1E0EA 1X1AA 3C2GA 1DQUA 2IXSA 4OAZA 2VJIA 2UWMA 2DT6A 3LSKA 4E7ZA 1R6RA 3TL4X 3OYAA 2VQHA 2IS1A 2R7QA 3H9QA 2UV1A 4CH7A 3OYJA 3L2UA 3A2KA 4JOMA 3K4KA 2VKHA 4XLCA 2CV1A 2WAQA 4PJJA 4LIUA 4H4KC 3LSIA 3S3OA 5LD2C 3OYHA 4BJTA 4RLFA 3QOEA 1DGWY 1QHHD 4DIQA 3IUOA 1N77A 3NWTA 3HOTA 3OYCA 3ONQA 3VYSB 3TBIA 3VYUB 2E5ZA 2LY1A 3H9JA 4YELA 2E60A 2PMZA 2HQAA 2IGNA 4XLFA 3L2RA 3E0JB 2IGOA 3HKZA 3K4NA 2F5VA 2HU9A 1MMDA 4FASD 2I8DA 3S3MA 3DTKA 3IAM2 2M7AA 2X1DA 3FHNA 4AYBA 4D9JA 3A4CA 4PSWA 2V9KA 3BCAA 5LFAA 1TZLA 3IAS2 3EUAA 4BDZA 1X1BA 3SEZA 3ZRGA 2LYCA 3QYFA 2R4GA 2JSPA 3IP4B 2VQGA 2KRCA 1Y6IA 5HLTA 4X0GA 2Z1DA 4ZYAA 2AQEA 3GBGA 4QPOA 1QU3A 3DPUA 1GLNA 1Z3YA 4NNJA 4PJMA 1X1CA 3K10A 2WY8Q 4BE2A 4RMNA 2MFZA 4BQQA 3CMMA 3S32A 3UNGC 4XLEA 3OS0A 3L2VA 4PK4A 1LKXA 3D5RC 3K4BA 3OMYA 3QYEA 3RTRA 4ZJZA 4F91B 4IKFA 2LBFB 4G6TB 2X1EA 2V4JC 2R7VA 4B48A 1X1DA 2MD0A 1V5GA 4PSXA 3S3NA 2VASA 4XORA 4E7JA 2KPMA 2VLAA 4XKVA 3PSFA 4BE0A 3H5AA 2CMPA 2CV2A 1D0ZA 1U0JA 4XKBA 2DOAA 2L7KA 3W2WA 1T0FC 2V6EA 4ZC3A 3LFUA 1J09A 3C2HA 4BQOA 2ZSHB 2W1OA 3BG6A 4ZDPA 4NUBA 4XKWA 2IGKA 5JPMB 3DWLE 4ZDLA 3MD2A 2RNGA 3HUGB 4IZZA 2VJJA 3BG7A 4YEJA 1T95A 4IX7A 4HEA2 4YRVA 3VSLA 2WA0A 3PNTA 2LY2A 2M7BA 3PNYA 2K9MA 2CW8A 2ELJA 5FROA 2X6XA 4HSRA 2Z16A 1K6YA 2QKMB 4CCLA 3QYBA 4BU2A 4BL0B 1WJEA 2X51A 3DKXA 4KT6A 4E7LA 2WAEA 2M4GA 1D0YA 5CKTA 1VZ0A 2W4SA 2KL4A 2PJRA 2KLOA 1N75A 4DBQA 4B47A 4DOZA 4ZTJA 3L2QA 3PJRA 2M0MA 4J00A 1D1AA 3SYTA 3J7AY 1QHGA 3OR1C 2CFOA 3DTEA 4F3QA 1WJAA 4F93B 1IRXA 2Y0SA 3EUKL 1TT0A 3H5RA 4XOTA 2DXIA 5KHDA 2BW3B 3VYRB 4XQFA 3I3LA 4PUSA 4E7SA 3OS2A 3DTIA 4DGWB 2R7RA 3EPZA 4HG2A 2MABA 4Y4RA 2JA2A 2X6YA 3AKZA 3K4JA 3OYKA 2O5RA 3FBIB 3K6GA 1UELB 2LC2A 2P0WA 4P5OA 1DP3A 3LL7A 2BVMA 2L2OA 3CZ6A 2WBMA 1W36D 2OUMA 3KEYA 2HDWA 2WADA 4F52A 3SEQA 3DU6A 3OYGA 4KITB 1ERDA 2K9LA 3RCOA 3ZXSA 3FKJA 4F92B 4RM3A 3VDXA 5HNFA 2HPIA 1MMGA 2WB1A 1MMNA 3ZR8X 3OL3A 4C2TA 4XM3A 2X6WA 1WJ5A 1ZELA 1V5FA 2XDVA 4ANJA 1Z7LA 3K4CA 3LMMA 3CJRB 1DGRM 2DJIA 1YX5A 4ZTFA 3SDBA 1P9QC 1G8XA 3OIQA 2R7SA 3ZCOA 4II2A 2DT7B 1OR7C 1FMWA 2L9SA 3OS1A 4OWRB 1NG6A 4XL9A 1MNDA 2VL8A 1WJBA 4E7HA 2IS2A 4E6KG 3CP2A 1UAAA 2W7NA 2OV7A 1N78A 3OY9A 4C9YA 2E5NA 2IGMA 2V26A 4E7IA 4BEHA 4XONA 2K5CA 3FBNB 4D1QA 2XAUA 2A6TA 2VPLA 2VIXA 4CCKA 4BQNA 3QODA 3H5NA 1W36C 2JUGA 2KP6A 3S93A 2F6CA 2JVGA 4XN0A 2NOJB 1Z3XA 3VYTB 2IS4A 1V5EA 1UG0A 4ITVA 4B3XA 2Z2SB 1MNEA 3H0DA 2Q2EB 4HNUA 2LG4A 3U21A 4BGDA 3M8JA 3VSKA 3S8PA 4LITA 2ZXIA 5CPRB 4NC7A 4B44A 3AL0B 4XOPA 3TMOA 2K3PA 4XN3A 2ZXHA 3HPHA 4HSTA 2VQLA 4RM2A 1S9HA 3D5SC 3SZGA 2VB6A 3OYLA 2MC4A 3CP8A 3MKWB 1Z21A 2L9NA 1D0XA 2JVHA 2BVLA 2WY7Q 3DEEA 2A5WA 3NWSA 3RSNA 3N05A 4CCJA 4KJZA 4P1WA 3UR3C 1LDKB 5FRMA 1SAUA 1X19A 3E1SA 4IQJA 2GOXB 4XNFA 3A1YA 2LRDA 4PJLA 2XSJC 3HL2A 3OL4A 1KONA 3LSGA 4E7KA 2LH9A 2M4KA 2HVQA 4ZDOA 3L2WA 4II3A 4JQFA 4N4NB 2FUG2 2ZFUA 3G2BA 2XF5A 3V42A 3K70D 1OLTA 2L5QA 5HOOA 2CW7A 2CUJA 2CS3A 3W3CA 4DJAA 1X4PA 3AL0C 3OR2C 2KMUA 4FXGB 3DQVC 2GOMA 4BXFA 3OWTA 4BUPA 4J01A 5FRNA 1MMAA 2R7OA 3W2AA 1BOBA 4OAYA 1YE9A 2QKLB 4HPQA 4CA0A 2R7WA 4XR6A 4FETA 2KDOA 4E4HA 3CF2A 4XKCA 5CQGA 4EATA 3DU5A 3HPGA 3OYNA 2XF7A 2HVRA 3CESA 2KRHA 2XF6A 5HVQC 1HA8A 4C30A 2VXDA 4NC8A 4BEHB 4CCMA 3EUHC 4MLOA 5HNHA 3W2VA 2VJ5A 4CCOA 3MMYB 1LFPA 4BS9A 1FMVA 4F55A 3M1CA 2WAFA 1JI8A 4Y3OA 1WJCA 3I9V2 4QPQA 2X85A 3LSHA 4LIVA 3F9KA 1Y56A 4BJ6C 2E1MB 1BR2A 1X4OA 2HPMA 3CJQB 3VWBA 5TGTA 3K4MA 2KZVA 4PFOA 2LOOA 1WJDA 4HRIA 1D1CA 1BR1A 1YX3A 3OOUA 3DLAA 3ZQQA 2W82A 1EA3A 2BW3A 3OYFA 4BACA 2VQCA 3PNVA 4XLAA 3RQ4A 4DBRA 3OYBA 3PL8A 2CH0A 1WFXA 2VJ4A 1WJFA 2BOLA 3K70C 4RLQA 4Y33A 2XC7A 4CCNA 3OIPA 3RPUD 4AU7A 3FDYA 4KISA 3KX2A 4AVZA 2PJRB 2M3AA 2Q1ZB 1G59A 5CQEA 2UUZA 4R79A 2IS6A 2V1NA 4XMYA 2RREA 2LREA 2HVSA 1BR4A 4NQWB 3BLYA 4C2UA 2E1MC 2HZDA 4U87A 3MKYB 3HC7A 4CZCA 2R7XA 2HNHA 2R7UA 3OYEA 3LSMA 4HNTA 3H9GA 4PJNA 1D1BA 5KCMA 2ZSIB 2AQFA 3H35A 4CSWA 2V7FA 4BJ5C 2OC6A 2X1CA 5KNLA 2W00A 1NG7A 3OYMA 4LG3A 1LVKA 2KHMA 4N4OB 3AFHA 2F4IA 1PYVA 2MYSA 3PFYA 3HG9A 2VXZA 4U7BA 2DCEA 4IQ4A 3DPLC 2VKDA 3HOSA 4PFPA 1PJRA 3MKZA 3BCBA 3D5LA 2R7TA 2CV0A 3OYDA 4B43A 2KQRA 2CUZA 3K4LA 1AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITV A;  1EA3 A;  3MD2 A;  4IQ4 A;  3VDX A;  4D9J A;  4PUS A;  5CQE A;  2Z16 A;  1AA7 A; 
#chains in the Genus database with same CATH topology
 3JAM Z;  4IJA A;  2FMY A;  4XRS G;  4C2M J;  3BTL A;  1FOW A;  1FT9 A;  2ID3 A;  2YR2 A;  3ZGK A;  4U0Y A;  3AG1 H;  2PJP A;  2I10 A;  3HXL A;  1BN5 A;  2GLO A;  2J5O A;  3SZT A;  3J80 Z;  4V19 K;  3TED A;  1VQ8 I;  5E79 C;  1SD7 A;  1UMQ A;  2VBX A;  1LE8 B;  3V7S A;  4AC0 A;  4HDU A;  5LHH A;  4E7Z A;  1R6R A;  5TIS C;  3OYA A;  4BKX A;  3TW7 A;  2DAO A;  3FF5 A;  1I1G A;  2R7Q A;  3ISP A;  1XSX A;  5BOX A;  3BR3 A;  3H9Q A;  2L4A A;  2NVT J;  1TWA J;  2HTJ A;  1G3T A;  1UST A;  4HQE A;  2BY3 A;  3K4K A;  1R71 A;  1E3O C;  2H6C A;  1QO0 D;  2WAQ A;  3A01 A;  3LSI A;  3HOZ J;  5LD2 C;  3HOX J;  2ACJ A;  1ODD A;  2EBI A;  2ECC A;  4JBA A;  3U1D A;  3QOE A;  1DGW Y;  1QHH D;  1HKS A;  3WU0 A;  3HOV J;  5LGN A;  2Z33 A;  3BR2 A;  2NNN A;  3VYS B;  3H9J A;  4KIB A;  4YEL A;  4W97 A;  3JRC A;  1HW1 A;  1LJ9 A;  2HQA A;  3HQA A;  4XLF A;  3L2R A;  4G7O F;  5DEQ A;  1BM9 A;  4JX4 A;  1HW5 A;  3BJO A;  4NDL A;  2BY1 A;  2R5Z B;  2HU9 A;  4ENM A;  3ABM H;  4I0A A;  4HNV A;  2ZJ2 A;  3S3M A;  4LFU A;  1O3R A;  2V6C A;  2P4W A;  1OYW A;  1T98 A;  2L9V A;  2TRT A;  3U9G A;  4A93 J;  2QEN A;  2X1D A;  5FLX K;  4CXF A;  4UB6 C;  2BGC A;  2V9K A;  3QAH A;  4KDP A;  3BCA A;  4KYW A;  1IN6 A;  3I0T A;  2ZJQ F;  1OQY A;  1FZP B;  1X1B A;  2DA6 A;  3SEZ A;  2HEO A;  2ELH A;  3KZY A;  4OU0 A;  1Z6T A;  3S2H J;  5EEH A;  4X0G A;  3MAJ A;  4XBF A;  3WU2 C;  1IDY A;  2XRL A;  4XK4 A;  3DPU A;  1GLN A;  3BPV A;  2OCE A;  1DPU A;  4BE2 A;  2K4B A;  3JSP A;  3LSR A;  3PFI A;  1V55 H;  2B39 A;  2K85 A;  3S32 A;  3UNG C;  5B1A H;  1OR7 A;  4FE4 A;  3OS0 A;  4PK4 A;  4XIC A;  1FBS A;  2EIN H;  3OMY A;  2FQ4 A;  1EKE A;  3QYE A;  3HTU A;  3VB2 A;  4ZYD A;  4HF2 A;  5E18 F;  3J81 Z;  2A6H F;  2ETH A;  1UZC A;  2Z3Y A;  4UV8 A;  2E7X A;  2LBF B;  4AYB N;  3I4N J;  5D8L B;  2JN6 A;  2R7V A;  3V8K A;  2ZCW A;  1DU0 A;  1ZLK A;  1J2X A;  2HXI A;  2MD0 A;  3E97 A;  4PSX A;  2VAS A;  4XOR A;  4CIC A;  1FTT A;  3K1N A;  2VLA A;  3KZI C;  5IP6 A;  3S17 J;  2DFI A;  3PSF A;  1ZAO A;  3H5A A;  1I1S A;  1OKR A;  3I54 A;  1POG A;  1T33 A;  1T0F C;  3W2W A;  1ACI A;  1TNS A;  3CCV I;  3SDG A;  3C2H A;  3E7L A;  4BQO A;  4Q48 A;  4ZDP A;  2IGK A;  4A5N A;  1ZYR F;  3DWL E;  4ZDL A;  1K7A A;  5CVU A;  3F3X A;  3GTJ J;  1JKP C;  1K78 A;  1ZRE A;  1U9N A;  3PNY A;  1A6I A;  1FY7 A;  2CW8 A;  2FRH A;  4MEY F;  4LB6 B;  5FRO A;  3CDI A;  1ZGA A;  2X6X A;  3SXY A;  1ETK A;  1I50 J;  2ZXW H;  2XAS A;  2M34 A;  3KYC B;  1I3A A;  2V9V A;  3G1M A;  4NB5 A;  5E20 A;  4BL0 B;  5FLX Z;  1MD0 A;  5DCM B;  5E1X A;  4UVC A;  1F43 A;  1HQC A;  1PP8 F;  1R00 A;  4F7Z A;  2QUF A;  4M9S A;  1BI0 A;  1D5V A;  3NAR A;  2KLO A;  2X4H A;  4DBQ A;  3GTK J;  2IA0 A;  4DOZ A;  2DOD A;  4CYC B;  1GXQ A;  3BT9 A;  1L0O C;  1Z77 A;  5K5O A;  2M0M A;  3PJR A;  1USS A;  3IRQ A;  3SYT A;  3GME A;  3GFJ A;  3VFZ A;  4FX4 A;  1VTN C;  4F3Q A;  2H1K A;  3CO6 C;  1ETY A;  4D5F A;  3QP5 A;  2NS8 A;  2L7Z A;  3R60 A;  4U88 A;  3TQN A;  4EM2 A;  5JVG F;  1JGS A;  1GXP A;  5D5X B;  2BW3 B;  3VYR B;  5IOZ A;  3OS2 A;  4ZYE A;  3S1M J;  3RKX A;  1VND A;  3OV8 A;  4M3E A;  4HG2 A;  3PUF A;  3G1O A;  2JPC A;  2MAB A;  3IWZ A;  1B1B A;  2QA4 I;  2X6Y A;  2O3F A;  1A36 A;  4WXD A;  3K6G A;  2EIM H;  1WQ2 A;  3S16 J;  4AWX B;  2ADU A;  2P0W A;  3OIO A;  2CUE A;  2XAF A;  5J6X A;  5C44 J;  4XRF A;  2M5W A;  1W36 D;  2FOW A;  1YIJ I;  3AAF A;  1CF7 A;  5C3E J;  2C6Y A;  5CVV A;  3QPH A;  1QGP A;  1R7J A;  1Z9C A;  4RM3 A;  3VDX A;  2HPI A;  1S3J A;  2Y0S N;  4BHP A;  4XM3 A;  2LF8 A;  4OIO F;  1ZEL A;  2VOD A;  4R8H A;  4Z6Y A;  4ANJ A;  5GTH C;  3K4C A;  2VT3 A;  2YPR A;  1TWC J;  2EZK A;  1DGR M;  2DJI A;  1DU6 A;  2ICW G;  1TL8 A;  1YIO A;  3QP6 A;  4ZTF A;  1XX5 A;  1G8X A;  3KLO A;  5ICE A;  4GYI A;  1ON2 A;  1TQI A;  2JT1 A;  5J47 A;  5DS9 A;  3JRI A;  4ENN A;  3CO7 C;  3OS1 A;  1SVO A;  1NG6 A;  4XL9 A;  3IV5 A;  1MND A;  2AXT C;  5ERI A;  2VL8 A;  2P6S A;  5L3D A;  4E7H A;  2OPT A;  1K61 A;  1XGO A;  2ZME C;  3CP2 A;  1N78 A;  4IL6 C;  3JR9 A;  1B72 A;  4HLX A;  5L3B A;  2RDP A;  1U6G A;  4Z2Y A;  1G4D A;  5DD8 A;  5E3N A;  1X3W B;  2E5N A;  2IGM A;  3LNQ A;  2AS5 F;  3MZ8 A;  1Y0N A;  1IO2 A;  2CG4 A;  4KMU X;  3U1K A;  5GAH J;  4L5I A;  1J5Y A;  2WC2 A;  3JSO A;  1W0T A;  2VPL A;  1P4X A;  1D8K A;  1HKQ A;  4MGR A;  2V1U A;  3V7R A;  2XAH A;  4BQN A;  3QOD A;  1W36 C;  2JUG A;  2XIG A;  1Y0U A;  3W6K B;  2F6C A;  2JVG A;  5EEA A;  3DXJ F;  1V5E A;  4M6X A;  4B3X A;  3GUD A;  3CUQ C;  3TW6 A;  4K2E A;  1FP2 A;  2I5U A;  3JTH A;  1UHW A;  5M5Y J;  2CU7 A;  3FXQ A;  2MW8 A;  5K5Q A;  4OMZ A;  1SVL A;  4LIT A;  4HBL A;  9ANT A;  2LF7 A;  1N25 A;  4NC7 A;  4XOP A;  3TMO A;  4X1E A;  2VT2 A;  3JRH A;  3VPR A;  1W7P D;  2K3P A;  1S72 I;  4EEF G;  5DV5 A;  4N0B A;  1IZ1 A;  2GA1 A;  1S7A A;  4IHX A;  2DOE A;  2ZC2 A;  3M9A A;  5FFZ A;  5HLH A;  4Y7N J;  2K9S A;  1FOY A;  4HV6 A;  3ABT A;  1YG2 A;  1LFB A;  3DEE A;  2ID6 A;  4LK0 F;  2VKE A;  2HYF A;  4L9N A;  5L3F A;  2D45 A;  1MDM A;  4A3D J;  1SAU A;  2CJJ A;  1IGN A;  2GOX B;  5F64 A;  1VQ5 I;  4XNF A;  2B7E A;  3HL2 A;  2DFE A;  2K27 A;  1KON A;  4UV9 A;  3LSG A;  5JPN B;  2LH9 A;  5J8C A;  5IYC J;  4I2O A;  3LAJ A;  2FNP A;  1P7J A;  3Q0W A;  4S05 A;  2IVM A;  3G2B A;  4M73 A;  1MGT A;  3IH4 A;  1R4N B;  4HOB A;  2CUJ A;  2CYY A;  3AL0 C;  1X4P A;  2AO9 A;  1S7E A;  3WGH A;  1MJB A;  4RB1 A;  1HOM A;  3CCU I;  1HW2 A;  2E2I J;  4A3L J;  3OWT A;  1AKH B;  4J01 A;  3FM5 A;  2MLG A;  1R4M B;  5CJ9 A;  1U78 A;  3W2A A;  1BOB A;  5E8G A;  4OAY A;  4B4C A;  4MHG A;  5LBQ A;  1YE9 A;  4CA0 A;  2W57 A;  5ILV A;  4XR6 A;  2JJ7 A;  2EA4 A;  2QQB A;  4FET A;  5ICF A;  2CRG A;  3HB9 A;  4AID A;  3DU5 A;  2DT5 A;  3HPG A;  1UHM A;  1WKM A;  2XF7 A;  1RPW A;  1HA8 A;  3H92 A;  3LQR A;  1JUP A;  2KIS A;  2E2J J;  3AG3 H;  3BG3 A;  3W2V A;  4UUV A;  1UCR A;  4BS9 A;  2OF7 A;  2RV8 A;  1XDU A;  3WGI A;  2DYS H;  3TOB A;  1T6S A;  2WAF A;  3ABK H;  1B9M A;  1R1T A;  5HLI A;  4LIV A;  3BTI A;  3F9K A;  1IRZ A;  4I6Z A;  3CU7 A;  3I58 A;  5B5E C;  1BA5 A;  2R7Z J;  4ETS A;  4U0V A;  2H09 A;  3VWB A;  3GZ5 A;  2KZV A;  1WCM J;  3F0C A;  2DW4 A;  4FHT A;  2LOO A;  1XS9 A;  2JPB A;  2M0C A;  3VOD A;  4HRI A;  4ESF A;  5A2Q Z;  4BAC A;  3OYF A;  3QOP A;  4XLA A;  4DBR A;  1PUF A;  2STW A;  3I59 A;  3PL8 A;  5EYR A;  5HLG A;  5FLV A;  4Y33 A;  5ICG A;  2GWR A;  2HOE A;  2AXL A;  3DKW A;  1ZN2 A;  3EYY A;  3RKW A;  2EFW A;  4BQA A;  5FKM A;  3FDY A;  2CFX A;  3A03 A;  2M3A A;  3GTG J;  5CQE A;  1H88 C;  2V1N A;  2BZT A;  4NQW B;  3MVP A;  4A3B J;  2ZME A;  3H0G J;  2FML A;  4U87 A;  3N97 A;  3LA7 A;  4M71 A;  3M3Y J;  1REP C;  3BOQ A;  2ISZ A;  3JRE A;  3ASO H;  4A3C J;  1RNL A;  4JX5 A;  4X6A J;  3OYE A;  2EA2 A;  4RGU A;  2ZSI B;  2Y0M A;  4CSW A;  3H35 A;  2V7F A;  4XID A;  2P7V B;  2NXN B;  3Q3S A;  2D2W A;  1NK2 P;  2CQQ A;  3DEW A;  1QZY A;  3BZC A;  1WGX A;  4I7H A;  2XB0 X;  4M3G A;  4IRI A;  3AFH A;  1PYV A;  3HG9 A;  2VXZ A;  4G7Z F;  4A5M A;  2DCE A;  3CUQ A;  2P81 A;  3DPL C;  1PJR A;  3MKZ A;  4FTH A;  2HYJ A;  3CDH A;  3IHU A;  2LVS A;  1KU9 A;  3OYD A;  4B43 A;  3FXO A;  3F22 A;  1VF9 A;  4XLP F;  2ESH A;  4IEJ A;  4BAY A;  4ESB A;  4YIF A;  1FP1 D;  3KYL A;  4CUG A;  2FD5 A;  1MBE A;  3GZ6 A;  3I71 A;  4BDY A;  1LVA A;  4M3B A;  3PQK A;  2IA1 A;  4UY8 I;  3WTZ A;  5HDN A;  1E0E A;  3M4O J;  2VC1 A;  1X1A A;  2PQ8 A;  3C2G A;  2IXS A;  1BC8 C;  2UWM A;  3LSK A;  4I0B A;  2K9N A;  1KU7 A;  3TL4 X;  2KIM A;  2VQH A;  4HWJ A;  3S15 J;  4N9I A;  1RR7 A;  2UV1 A;  3L2U A;  3SJM A;  3MZH A;  3E6D A;  2ZO4 A;  3A2K A;  1FNN A;  4XLC A;  5GAD J;  2CV1 A;  3G73 A;  4LIU A;  3KP7 A;  3Q0U A;  4L0Y B;  4WB3 A;  3JRG A;  3NAU A;  2Q2E A;  1N77 A;  2H8R A;  2GXG A;  3GTL J;  2YUS A;  5JLX A;  3ZQI A;  3S1N J;  4KT5 C;  3VYU B;  3T5X A;  3ZQF A;  2E5Z A;  1WH5 A;  3J7Z I;  2VON A;  1YJW I;  3O2P E;  1R22 A;  1Q1H A;  3ABU A;  3E0J B;  3GYH X;  5M5W J;  1APL C;  1MBK A;  2A61 A;  1WVR A;  1YI2 I;  4CHU A;  3E5Q A;  4FAS D;  5EF6 A;  2Y2Z A;  1BJA A;  3DTK A;  5D6F A;  2DBB A;  3IAM 2;  2Y9Y A;  4G6D A;  2HKX A;  1IC8 A;  1OCO H;  2BHY A;  1ULY A;  4HA8 A;  2M7A A;  3FHN A;  5GPA A;  3WG9 A;  3T8R A;  3LQQ A;  1TZL A;  4BDZ A;  2EK5 A;  2E7W A;  2G7H A;  2KRF A;  1JT6 A;  4A69 C;  2JSP A;  2VQG A;  2HQR A;  2KRC A;  3KYD B;  1Y6I A;  2ECB A;  1LNW A;  2M1B A;  4XLN F;  1KYZ A;  4ZYA A;  5C4J J;  1B8I A;  2HOT A;  4EJO A;  2L54 A;  3CCM I;  1MSE C;  4HX4 A;  1K79 A;  4LGW A;  3K10 A;  1ZGJ A;  2H8W A;  2F5E A;  1QA6 A;  2DA4 A;  4ZH4 F;  1IV6 A;  5F04 A;  5E3M A;  1H8A C;  3HKZ N;  4XLE A;  1MKM A;  3EET A;  1JUM A;  4LMY A;  2VKV A;  3D5R C;  3MEX A;  4P3B A;  1OFC X;  2JMW A;  2Y31 A;  4CO8 A;  3CD6 I;  2RNJ A;  4G6T B;  3WOD F;  3L9F A;  4ENJ A;  2QLZ A;  2X1E A;  1RZ4 A;  3IKT A;  4OIQ F;  2V9P A;  3HQB A;  5L3G A;  2M9H A;  4E7J A;  2P5L C;  1MIJ A;  2E1C A;  1U0J A;  1QPM A;  4XKB A;  2F4O B;  4KUM A;  2L7K A;  4BBR J;  5D5W B;  2FU4 A;  5B4P B;  3BQY A;  4IRG A;  2MSY A;  2GAU A;  4NUB A;  1ZG3 A;  1G2H A;  5JPM B;  5IOY A;  3BP8 A;  3VEP A;  1YHQ I;  2DMT A;  4WF2 A;  1EH8 A;  3HUG B;  1IXS B;  5B66 C;  2IBD A;  1ZKG A;  4YEJ A;  5F0H A;  1S29 A;  5LHG A;  4UUS B;  4IZZ A;  2HOS A;  3KLS A;  1WI3 A;  1AOY A;  3FWE A;  1JE8 A;  4B09 A;  4YRV A;  3VSL A;  1VQ7 I;  2LY2 A;  5E17 F;  2K9M A;  3BTC A;  4A6D A;  2JK3 A;  3S1Q J;  1JHH A;  1QVT A;  1J0R A;  4JP0 A;  5EG0 A;  4BY1 J;  2NVU B;  3F8B A;  3REO A;  1LEB A;  1HSJ A;  4PDK A;  3RKY A;  2M30 A;  1MMS A;  2K9Q A;  1WH7 A;  2YS9 A;  3QYB A;  2EFP A;  1YTY A;  1JTX A;  1ON1 A;  3M8E A;  2W84 A;  3H3V K;  2DA5 A;  2X51 A;  4M74 A;  3DKX A;  3FK7 A;  4M3D A;  4WXH A;  2M4G A;  2WAE A;  4BXU A;  2VPR A;  3RZD J;  2PJR A;  5LRR A;  5JVT A;  1HDD C;  4B47 A;  5HS8 A;  4UUT A;  3L2Q A;  4EMS A;  3KP5 A;  4L5J A;  1CQT A;  1ZLJ A;  1W5T A;  1QHG A;  2K86 A;  3OR1 C;  2CFO A;  3J7A Y;  1ZK8 A;  3WG7 H;  1XGS A;  4F93 B;  2P5K A;  3TDZ C;  4I98 B;  1J75 A;  2QEX I;  4KA4 A;  3EUK L;  3H5R A;  2DLL A;  2X9D A;  3GVA A;  4HW0 A;  4B3A A;  2DXI A;  1ETX A;  3CCY A;  1C0W A;  5KHD A;  4AM3 A;  4PUS A;  1FTZ A;  4E7S A;  4DGW B;  3HGG A;  1IUF A;  5KVR A;  2FEZ A;  4A3F J;  2JA2 A;  3CC2 I;  2FF4 A;  3HYI A;  3K4J A;  3OYK A;  3S2D J;  4A3M J;  3TKY A;  1VQP I;  5IPA A;  1UEL B;  1YW9 A;  4QTR A;  2LC2 A;  3ZQH A;  1DP3 A;  3LL7 A;  2L2O A;  2M8E A;  3SZP A;  5D5V B;  1IRG A;  5C4X J;  2HDW A;  2WAD A;  3E6M A;  3KP4 A;  4XRS A;  1P92 A;  3NRV A;  4F52 A;  3SEQ A;  2B9S A;  1F5T A;  3M07 A;  3RCO A;  3FIS A;  3RYP A;  3HOW J;  2L7F P;  1MH3 A;  4EVI A;  1YW7 A;  1FEX A;  4HV5 A;  5HNF A;  1MBG A;  3I55 I;  1I3Q J;  3ZMD A;  2KDZ A;  3GFM A;  1LE8 A;  3X2Q H;  2JA7 J;  3RJP A;  3UKG A;  3RZO J;  1X1P A;  2R92 J;  1Z67 A;  3ZQC A;  1IUY A;  4G7H F;  3I4M J;  2KKO A;  4II2 A;  2FBH A;  3DF8 A;  1P4W A;  4OIN F;  2M2E A;  2X0L A;  1B6A A;  5LRS A;  4A12 A;  2O8K A;  2ZFW A;  4HX8 A;  1J59 A;  1S6L A;  1U5T B;  2MBF A;  4KIG A;  1WJB A;  3R0A A;  4P96 A;  4E6K G;  5LEJ A;  1UAA A;  2HDC A;  2R93 J;  2IP2 A;  2B63 J;  3CF5 F;  4C9Y A;  1VQO I;  3C7J A;  4E7I A;  4BEH A;  1RR8 C;  2EFN A;  2LFB A;  5EZG A;  5EZH A;  4D7N A;  1HCR A;  1TW2 A;  2DOF A;  2K5C A;  2WB1 N;  2R5Z A;  4D1Q A;  3K9T A;  1TTY A;  1FOX A;  4QLC U;  2Y30 A;  1XG1 A;  3B6C A;  1G3S A;  3QPL A;  3S93 A;  3VYT B;  2EIJ H;  1YRN B;  4FE7 A;  1UG0 A;  1TW3 A;  4ITV A;  3LOC A;  5DUI A;  2Z2S B;  3I5U A;  3H0D A;  3HM5 A;  3KFW X;  4RDU A;  3U21 A;  3BPX A;  3M8J A;  5EGO B;  3VSK A;  2HZT A;  3CTA A;  4G8X A;  4JX6 A;  2OQR A;  3WTV C;  5CPR B;  3MWM A;  4D7M A;  4IHS A;  2DDA A;  3FXU A;  3P9K A;  2XPV A;  3R6S A;  1QQI A;  3SZG A;  4RB0 A;  2MC4 A;  5EDN A;  2A5W A;  4IXA A;  3WU1 B;  3RSN A;  4HQM A;  2F5C A;  5JHU A;  3HIF A;  1F1Z A;  4CCJ A;  1V54 H;  3ECO A;  3ZMS A;  3ZMT A;  3SHF A;  4RB2 C;  3E1S A;  4IQJ A;  4S0H B;  3A1Y A;  1KJS A;  4C3H J;  2DO7 A;  2UXX A;  2E1O A;  1O7L A;  4JQF A;  3SQN A;  1MZB A;  3GWZ A;  2MGQ A;  4KIC A;  1ONV A;  3AG2 H;  1MH4 A;  2JTV A;  2L5Q A;  1OCP A;  4WWC A;  2CS3 A;  3QRF F;  3OR2 C;  4J19 A;  1R1U A;  2KMU A;  3V8L A;  2F2E A;  1ITY A;  4RB3 C;  2QSF X;  1X3U A;  4IF4 A;  5IYB J;  3P5J A;  5IP7 J;  1YS7 A;  2M8G X;  2YU3 A;  2R7O A;  1MBJ A;  5BS6 A;  3DCF A;  3WGG A;  4BYY A;  4HPQ A;  1PP7 U;  4EV0 A;  4B1R A;  1I6X A;  1OYI A;  1KQ8 A;  1RET A;  4YFK F;  5TRD A;  1HBX G;  1B72 B;  2HVR A;  2KRH A;  4ENK A;  3ZMV A;  1KZH A;  3M8F A;  1P6R A;  4LLL A;  1MSF C;  3WE3 A;  5J40 A;  1T38 A;  2D1V A;  4CYD A;  1SC7 A;  2GIZ A;  2LKS A;  2VJ5 A;  4CCO A;  3N4M A;  3MMY B;  1LFP A;  5J3L A;  1O3Q A;  1O4X A;  3LSJ A;  1WJC A;  2X85 A;  4AIJ A;  2ZXJ A;  2FNA A;  2XGD A;  2E1M B;  3FHZ A;  1DPR A;  2V1D A;  3K0L A;  1X4O A;  2A3S A;  2ELK A;  2HWV A;  3CJQ B;  4CYC A;  2FBI A;  3HGY A;  5CVR A;  3RQI A;  1STZ A;  2L9R A;  3BZK A;  3KE2 A;  4W1U A;  1IN4 A;  3ZMZ A;  1WJD A;  2XHK A;  1D1C A;  3ML6 A;  2RVC A;  3FMQ A;  1TWG J;  3WE2 A;  1EA3 A;  2BW3 A;  1W5C C;  5FGM A;  2QBY B;  3PNV A;  4XRM A;  3OYB A;  3T0Y A;  2HR3 A;  2OZ6 A;  2LKX A;  1E2X A;  2XC7 A;  4FX0 A;  4HLY A;  4HF1 A;  5D6E A;  3RPU D;  4AU7 A;  4L18 B;  4Y17 A;  1R1V A;  1XN7 A;  2K3F A;  4KIS A;  4UNO A;  3LST A;  3CLO A;  1I6H J;  1G59 A;  3PO2 J;  1CFA A;  3GTP J;  2OBP A;  3LSP A;  5DM7 F;  1MDM B;  4Q5S F;  2LRE A;  5K7H A;  1KU3 A;  1BR4 A;  2N8G A;  2Y9Z A;  2HVS A;  4C2U A;  4HZF A;  2XV4 S;  3MKY B;  1RRJ A;  3HC7 A;  4CZC A;  2MLK A;  2JQ7 A;  1MNM C;  3JRF A;  1E17 A;  1I5Z A;  3K1M A;  1IN5 A;  1IRF A;  1Z91 A;  3H9G A;  5KCM A;  5FO5 A;  3V4G A;  2AQF A;  1XSD A;  3RPQ A;  4BJ5 C;  1T0F A;  1IF1 A;  5FKK A;  3D0S A;  3O8H A;  2W00 A;  1YJN I;  1NG7 A;  2H94 A;  2ZJR F;  4IVN A;  4KNY A;  2KHM A;  4N4O B;  5E3L A;  4P3A A;  2G0E A;  1H0M A;  2MYS A;  2VOO A;  4UHT A;  5CLS A;  4AIK A;  3RKQ A;  2DTZ A;  1TC3 C;  4YG2 F;  3BCB A;  2O61 A;  4ASN A;  1QBJ A;  1TLH B;  2KQR A;  2HGC A;  1IN8 A;  3K4L A;  1I39 A;  2OQG A;  3BC8 A;  2YX4 A;  1R9T J;  2NOG A;  2HFH A;  2XAQ A;  1F4K A;  3KP3 A;  1XGM A;  3DPT A;  4UVB A;  4JK1 X;  4FQG A;  3OYI A;  4BE1 A;  1JJ6 C;  1P7I A;  2O0Y A;  2E36 A;  3CME I;  2RQQ A;  4XLH A;  2DFF A;  5JHF A;  3WTT C;  2Y75 A;  1X3Z B;  1LUJ B;  3GTO J;  4OAZ A;  2DA2 A;  1VQN I;  5LEK A;  2DT6 A;  1B4A A;  4QIW N;  1ETO A;  2DK8 A;  3DBH B;  3BZ6 A;  4Y15 A;  2A05 A;  3KZZ A;  3O8G A;  3E5X A;  2BEO A;  2L7M P;  4RGX A;  3OYJ A;  2XRN A;  4JOM A;  1HF0 A;  5FKO A;  3BWG A;  4BNC A;  2VI6 A;  3ERM A;  4H4K C;  3S3O A;  1XTA A;  1R58 A;  4Y52 J;  4BJT A;  1TWF J;  1YS6 A;  1FIP A;  4DIQ A;  3ZQG A;  2XPW A;  3FMR A;  2B0L A;  3KCC A;  3HOT A;  3ONQ A;  3I59 B;  2L01 A;  4OOI A;  4IO9 F;  2LY1 A;  2RQP A;  1Y1V J;  3LA3 A;  1S8N A;  2OU2 A;  2O7O A;  2O6G E;  3F8N A;  1K4T A;  1SFX A;  3BJA A;  4BHB A;  4I99 C;  4EJV A;  1MMD A;  1BIB A;  4MNU A;  1FYK A;  1A04 A;  4LLN A;  1XCB A;  1FYL A;  1BI2 A;  4AYB A;  2F48 A;  4D9J A;  4AD9 A;  1KYW A;  2RGV A;  2W48 A;  5LFA A;  5L3C A;  1RKT A;  3FMS A;  1H9G A;  1K4S A;  1SFU A;  3RYR A;  2WAQ N;  1YW8 A;  2R4G A;  3QU3 A;  1ORK A;  3IP4 B;  2J5P A;  5HLT A;  5E3O A;  3ASN H;  3DEU A;  2F5F A;  1NH3 A;  2Z1D A;  4V2G A;  1LFU P;  2AQE A;  1SMT A;  5IT9 K;  3GBG A;  4GFB A;  3A02 A;  3T1B A;  4BBS J;  2VOP A;  3ZN0 A;  1QU3 A;  3HBL A;  1Z3Y A;  3IKV A;  2WY8 Q;  5GAG J;  2QQ9 A;  3HZJ A;  4Y13 A;  4MO7 A;  1HC8 A;  4LLG F;  2FE3 A;  2MFZ A;  2ESN A;  4BQQ A;  5LLQ A;  3CMM A;  1AKH A;  2O9L A;  2F4M B;  2LSO A;  3TO7 A;  3L2V A;  2R5Y A;  1R23 A;  5J4V A;  1LKX A;  3K4B A;  3WHC A;  2L0K A;  3R61 A;  4F91 B;  1NTC A;  2ZNY A;  2IT0 A;  5J1U A;  1ETW A;  4NBQ A;  2Z9O A;  4B48 A;  3F8C A;  1BJZ A;  1V5G A;  3S3N A;  2RC4 A;  2KPM A;  2DI3 A;  5IYD J;  4BE0 A;  3LWF A;  2OA4 A;  4DZP A;  2CV2 A;  1D0Z A;  1MJA A;  2Z99 A;  3ZP5 A;  2IJL A;  1ZR4 A;  5JR3 A;  4HDV A;  3WTY C;  2QZ8 A;  2V6E A;  4IHY A;  3LFU A;  1J09 A;  2R3S A;  1LEA A;  4LD5 A;  4O3M A;  3BR5 A;  2PLY A;  5BMZ A;  1YQA A;  3BG6 A;  3R0J A;  4XKW A;  4A3G J;  1O3T A;  2PI0 A;  4C3I J;  4P9F A;  3LAP A;  3BG7 A;  1PUE E;  1T95 A;  4IX7 A;  1QRY A;  2L4M A;  3H1C A;  3IWF A;  2P6T A;  1RI7 A;  4HAM A;  3T8T A;  3TGN A;  2BV6 A;  3PNT A;  3K7A J;  4PGG A;  3R4K A;  1OCZ H;  4A3J J;  1BW6 A;  2ELJ A;  4IHT A;  4HSR A;  1IN7 A;  5EEG A;  2Z16 A;  4B8X A;  1K6Y A;  4CCL A;  4MQ9 F;  3JCU C;  4BU2 A;  2FSW A;  2EZH A;  1R36 A;  2R7D A;  4KT6 A;  2HXO A;  1RKW A;  4E7L A;  5GPC A;  5CKT A;  1VZ0 A;  2KFD A;  2W4S A;  2DMU A;  1N75 A;  3RDI A;  1DDN A;  1EH7 A;  1AHD P;  4G9Y A;  1WI9 A;  4FIS A;  4UVA A;  5H6Q A;  2QQ8 A;  5GP9 A;  3DV8 A;  4JYK A;  2DQL A;  2NRA C;  5IT9 Z;  5F6F A;  4FCY A;  3A0H C;  4MFE A;  1SD6 A;  2Y0S A;  3BDD A;  1GV5 A;  4QWQ A;  4XOT A;  3G4S I;  2Y48 A;  2FA5 A;  3DTI A;  3HEF A;  3RPU A;  3K69 A;  5J8F A;  3DP7 A;  2R7R A;  3EPZ A;  1ZTR A;  2KZG A;  3TDU C;  1FLI A;  2LNB A;  5AIQ A;  3FK6 A;  3AKZ A;  2O5R A;  2EZL A;  2CUF A;  4BH9 A;  1FWZ A;  4P5O A;  4YFN F;  1VQ6 I;  4RAZ A;  1RC9 A;  3ESW B;  2BVM A;  3CZ6 A;  4PCQ A;  2WBM A;  2OUM A;  5KAI C;  3KEY A;  2NS7 A;  3BTJ A;  2CGP A;  2DMP A;  2OCC H;  4I01 A;  3G1L A;  2K9L A;  2E34 A;  1SMY F;  4A6E A;  2JA5 J;  3HHH A;  1UHS A;  1W7P A;  1BW5 A;  5K7Z A;  1OIS A;  2UXN A;  2EPF A;  3SFZ A;  1U3E M;  1MMG A;  2BXY A;  3OL3 A;  2EZI A;  4ESJ A;  1WJ5 A;  1GVD A;  2AHQ A;  3GF2 A;  3J80 K;  3TP3 A;  2XDV A;  4KN7 X;  4M72 A;  4WXC A;  2V1X A;  1YIT I;  2A69 F;  3CJR B;  3GLL A;  2DYR H;  4ABZ A;  3SDB A;  2HKO A;  2IA2 A;  3OIQ A;  2R7S A;  2QQA A;  4QSH A;  4DZJ A;  2DT7 B;  1OR7 C;  3GO5 A;  5ICC A;  3GLX A;  1HLV A;  4OWR B;  3CDL A;  1NK3 P;  1GT0 C;  4EJU A;  2IS2 A;  3DBR B;  2BYV E;  2TCT A;  1FC3 A;  2OV7 A;  3OY9 A;  3G6E I;  2WWY A;  1X2N A;  4G12 A;  4A3I J;  3HRU A;  4XON A;  1K83 J;  1ETV A;  3AG4 H;  1OCR H;  5BPD A;  5LHI A;  4IHV A;  1WPK A;  3L1P A;  2IEK A;  2D5V A;  2CQK A;  1U8R A;  5H2F C;  2R0Q C;  1CGP A;  1VFC A;  4IOA F;  2E71 A;  1YFH A;  4MQV A;  5E8I A;  2NOJ B;  3A01 B;  2DK5 A;  2OD5 A;  2HQ5 A;  2E19 A;  3BG5 A;  3O3K A;  3B73 A;  1W5S A;  1MNE A;  3GTM J;  3PQJ A;  1UB9 A;  1XMA A;  4UB8 C;  4BGD A;  1WRJ A;  2NVY J;  3HSF A;  1Z05 A;  1IDZ A;  1A31 A;  1W0U A;  1QNT A;  1U5T C;  1XGN A;  1XCV A;  2ZXH A;  2VQL A;  1S9H A;  1S5L C;  3MZY A;  4EQQ A;  4MTE A;  3ERE D;  3FZV A;  1D3Y A;  4D5C A;  3CP8 A;  4GCV A;  3MKW B;  2HI3 A;  1X2M A;  2JVH A;  2BVL A;  2WY7 Q;  1Y1W J;  3NWS A;  4M6V A;  3C2B A;  1LQ1 A;  4U0W A;  2XAJ A;  4MEX F;  1IG7 A;  4OMY A;  3N05 A;  3WHB A;  4LG0 A;  3UR3 C;  1XC5 A;  2HDD A;  1LDK B;  3LA2 A;  5JLW A;  3F21 A;  3CUO A;  1JHF A;  3COA C;  1X19 A;  3F8F A;  2O8X A;  3WTS C;  2WTE A;  2A68 F;  4LB5 A;  2PBI A;  1ZAR A;  3PM1 A;  3J81 K;  4EGY A;  4IOC F;  2LK2 A;  3OL4 A;  2HOA A;  4L5E A;  3E6C C;  4E7K A;  1QPI A;  2HVQ A;  4WB2 A;  1XD7 A;  4II3 A;  4N4N B;  2MC3 A;  4I76 A;  3C3W A;  5J4Y A;  2FUG 2;  2ZFU A;  2JSC A;  5JI6 A;  2XF5 A;  3V42 A;  4ZZL A;  1OLT A;  2CO5 A;  5DDG A;  1FSE A;  2R7F A;  2H1L A;  2LR8 A;  3M1E A;  1TBX A;  3ROU A;  4FXG B;  4R1H A;  4L9V A;  4RAG A;  4HW5 A;  3DQV C;  4BXF A;  1T2K A;  5FD6 A;  2X6O A;  4MFD A;  1MMA A;  3HUG A;  1XB4 A;  4UUS A;  3BJ6 A;  1Y8Q B;  2R7W A;  5IT3 A;  2VE9 A;  3H3Z A;  4P9U A;  2KDO A;  2VC0 A;  1SFE A;  4E4H A;  3B02 A;  3BQZ A;  4DYQ A;  4XKC A;  5CQG A;  4EAT A;  3BR6 A;  5HOD A;  1XSV A;  5HVQ C;  4GDF A;  5GTI C;  1PDN C;  2JZY A;  2YSR A;  3HDD A;  2KJB A;  2ZNZ A;  2VXD A;  4NC8 A;  5HDG A;  4BEH B;  2G9W A;  3ZOB A;  3EUH C;  4CCM A;  5HNH A;  1TT5 B;  2FXA A;  5K5R A;  5FFX A;  1HXD A;  3S14 J;  1XPX A;  2CQN A;  4F55 A;  3D1N I;  2HYG D;  2EV5 A;  2PX9 A;  4Y3O A;  3I9V 2;  4O5V A;  4QPQ A;  3L2C A;  2H6B A;  4O6J A;  2XGE A;  1Y56 A;  3W6J B;  1BR2 A;  3A0B C;  2GA2 A;  3IL2 A;  4L0Z B;  2HPM A;  1VQ9 I;  1BI1 A;  1K78 B;  3M7G A;  1FOK A;  1Y39 A;  3FX3 A;  3BY6 A;  3SFI A;  2E2H J;  2ZJP F;  5H20 A;  2PN6 A;  2HTS A;  4PFO A;  5BQT A;  2FX0 A;  4GYG A;  3EDP A;  5B1B H;  1YX3 A;  3OOU A;  2YX7 A;  4G6Q A;  4HF0 A;  3G3Z A;  4RS8 A;  3IH3 A;  4YIR X;  2VE8 A;  1G3W A;  2NVX J;  3RQ4 A;  1FBU A;  2CH0 A;  1KU2 A;  2EJR A;  1WFX A;  1YYV A;  5DCF A;  2VJ4 A;  3CCQ I;  1WJF A;  1K6O A;  2OZU A;  3K1P A;  1GVJ A;  3IRR A;  4CCN A;  1QVU A;  2VN2 A;  4IHW A;  1PVE A;  2P7C B;  1GUU A;  4AVZ A;  3HTS B;  3JRB A;  3GCM A;  5DUK A;  3F23 A;  2UUZ A;  4NHJ A;  2IS6 A;  5E1Z B;  4M9X A;  2F5D A;  2LKP A;  3Q5F A;  3BLY A;  2BXZ A;  1R5I D;  2E1M C;  3W6V A;  2HZD A;  6PAX A;  5DD4 A;  1W1W E;  1DP7 P;  3KEQ A;  4N9H A;  2IAI A;  2R7U A;  3LSM A;  4HNT A;  1AU7 A;  4PJN A;  2NS0 A;  3GXO A;  3FIW A;  2L02 A;  2OC6 A;  2X1C A;  2A07 F;  5KNL A;  4KFC A;  3CCE I;  3Q9V A;  2XRO A;  1WZ2 A;  4LG3 A;  2QYO A;  1ETQ A;  2VBY A;  1BL0 A;  1ZRF A;  2F4I A;  1EF4 A;  3PFY A;  4C3J J;  4ZYG A;  4U7B A;  2LLK A;  2KIF A;  3HOS A;  4PFP A;  5M5X J;  4KN4 X;  2CV0 A;  1Y8R B;  2DU9 A;  3S1R J;  1CF7 B;  2GZW A;  1TQP A;  2XGX A;  3HRM A;  1JGG A;  2QCO A;  1U5T A;  2LBF A;  3PSI A;  1SFK A;  4GRI A;  1KA8 A;  2OTL I;  3TOA A;  3PUB A;  2CSO A;  3HRS A;  3MCZ A;  3P7N A;  2PG4 A;  3DKY A;  2L3D A;  3MQ0 A;  1MW7 A;  1DQU A;  4EM1 A;  2VJI A;  4PZJ A;  1FBQ A;  4CDG A;  4RGS A;  1D8J A;  2IS1 A;  1YJ9 I;  2VUM J;  2HQN A;  5KAF C;  2JA8 J;  1A5J A;  3ZMU A;  4CH7 A;  4BXX J;  3KP6 A;  4LK1 F;  2VKH A;  4HYE A;  4PJJ A;  5D5U B;  5FD5 A;  1KQ9 A;  4EJT A;  1YRN A;  1BI3 A;  4A0X A;  3OYH A;  1RUN A;  4EGZ A;  1P2F A;  1Q1V A;  4RLF A;  2XAG A;  4AVP A;  2LMD A;  2DA1 A;  3IUO A;  3CC4 I;  1KGS A;  3NWT A;  3FKI J;  1SD4 A;  5EGO A;  3OYC A;  3CCL I;  1SVM A;  3TBI A;  1ZRC A;  1LB2 A;  2MD5 A;  5J1Y A;  2E60 A;  1IW7 F;  3LFK A;  2PMZ A;  4EM0 B;  2IGN A;  3MN2 A;  1HKT A;  2CWE A;  2FBK A;  2XB5 A;  1BC7 C;  2IGO A;  3HKZ A;  3K4N A;  3Q9S A;  1LDD A;  1IV8 A;  2DA3 A;  2F5V A;  3QU6 A;  5DCM A;  1M1E B;  2I8D A;  2HS5 A;  2DMQ A;  2WV0 A;  1IXR C;  4FXK B;  4UU9 C;  5H6R A;  5FLM J;  3MKL A;  5HS9 A;  3G71 I;  3A4C A;  2MG4 A;  4PSW A;  2DA7 A;  5J1R A;  1OYY A;  3IAS 2;  3EUA A;  3O6B B;  1F9N A;  1VQ4 I;  3ZRG A;  2LYC A;  3QYF A;  3EUH A;  4M6Y A;  3E5U A;  1TNT A;  3BR0 A;  2PMH A;  5DM6 F;  3EYI A;  5K1Y A;  3E6B A;  4MIM A;  2A6E F;  3GEZ A;  4LOC A;  2LD5 A;  4QPO A;  2CQX A;  1O57 A;  1O7F A;  4PJM A;  4NNJ A;  1X1C A;  4YII A;  1RUO A;  4RMN A;  3NQO A;  2M87 A;  5FJ8 J;  2G7U A;  4FT8 A;  3CCJ I;  2P5V A;  4PJ0 C;  2K4J A;  5F1R A;  2Y69 H;  2DTR A;  3RTR A;  2FOK A;  3Q0V A;  2RAE A;  5KK1 A;  4ZJZ A;  2TDX A;  3NEU A;  4IKF A;  3OSG A;  3WTX C;  2V4J C;  1V4R A;  1UG2 A;  3GX4 X;  1X1D A;  3I53 A;  1E3P A;  2DPU A;  2GXA A;  4XKV A;  2MH9 A;  4YFX F;  2CMP A;  2QSG X;  4Q4Z F;  3KPH A;  2DOA A;  3FXM A;  1R49 A;  1KQ0 A;  2IW5 A;  1SD5 A;  4ZC3 A;  2ZSH B;  2W1O A;  2DDB A;  2YU9 J;  1UFM A;  1JTY A;  2E35 A;  2A5Y B;  3FXK A;  3BRO A;  1RIO H;  3HHG A;  4ZZD A;  3MD2 A;  2RNG A;  3E3V A;  1IXC A;  2VJJ A;  4HEA 2;  2A73 B;  1FX7 A;  2D1H A;  1W4M A;  3KET A;  1ZGW A;  3CMA I;  1DUX C;  5FKL A;  3GTQ J;  1NHA A;  2WA0 A;  2NNY A;  2M7B A;  5IY5 H;  2BY2 A;  2ZB9 A;  2JWT A;  3P9I A;  5F0C A;  3CQZ J;  3PIP F;  1ZQ3 P;  4GO1 A;  2QBY A;  2QKM B;  1VQM I;  1X58 A;  5ILS A;  5ILU A;  5A2Q K;  1IAW A;  1TP4 A;  3PO3 J;  4RA2 A;  1WJE A;  1OPC A;  1ENH A;  1TWH J;  5F27 A;  1ZH5 A;  4RBO A;  2RKH A;  5TJJ A;  1D0Y A;  4A3E J;  2XGC A;  3BR1 A;  1JKR C;  1R5G A;  3F72 A;  2KL4 A;  4MTD A;  4L9J A;  2W24 A;  4LJZ F;  4DYR A;  1A6Q A;  1OMI A;  4ZTJ A;  2KJC A;  4I09 A;  5FKN A;  3V7C A;  5LGT A;  4J00 A;  1D1A A;  4A3K J;  1LPQ A;  2O03 A;  3DTE A;  4XSX F;  2W25 A;  1WJA A;  4GXO A;  2QGU A;  3V8J A;  2BHZ A;  1IRX A;  5F08 A;  1JKO C;  1TT0 A;  2GXB A;  2GM4 A;  2PMU A;  3HOU J;  1WHU A;  4XQF A;  3I3L A;  1MBF A;  3ECH A;  1PUF B;  1GHC A;  1HST A;  4RAY A;  5FB2 A;  1OCT C;  1TQM A;  2DJN A;  1Z0X A;  4Y4R A;  3K2Z A;  1JUS A;  1T56 A;  3FBI B;  3GFL A;  3HSE A;  2PEX A;  3L00 A;  1B9N A;  1A35 A;  3K2A A;  2R5Y B;  2STT A;  1WSU A;  1EJ9 A;  3J7A O;  2GIV A;  2KIU A;  1U2W A;  1P4A A;  3IH2 A;  4M9Z A;  5HS7 A;  2KT0 A;  2Q0O A;  2WV1 A;  2ZME B;  3F6O A;  2FQ3 A;  1ZR2 A;  3MFK A;  4OIP F;  2K40 A;  3DU6 A;  1I27 A;  3OYG A;  1H9T A;  3DFG A;  3CLQ A;  4KIT B;  1ERD A;  3CJN A;  3ZXS A;  2EQR A;  3FKJ A;  2BE5 F;  4F92 B;  3JRD A;  3KEO A;  2H27 A;  2E1N A;  3QPS A;  2WB1 A;  1MMN A;  2NYX A;  3ZR8 X;  4C2T A;  4TV7 A;  2BY0 A;  2UZK A;  2X6W A;  2LTP A;  4U7D A;  3L7W A;  5EJC A;  1L3L A;  1V5F A;  1FJL A;  1Z7L A;  3LMM A;  2QVO A;  5JFR A;  4H0E A;  1YX5 A;  3CUQ B;  1P9Q C;  3ZCO A;  2MA3 A;  2L9S A;  1FMW A;  2OAZ A;  1Z1D A;  4DQ2 A;  3QPT A;  1JXS A;  2XKP A;  4DNC A;  3FXR A;  3IC7 A;  5F1J A;  2W7N A;  3ZQL A;  4IRH A;  1G6N A;  5HDK A;  2V26 A;  4DYC A;  1BIA A;  4CGZ A;  3JW4 A;  2EWN A;  1IJW C;  1ZG1 A;  3ULQ B;  2EIK H;  1JKQ C;  1MJ9 A;  3FBN B;  1FYM A;  2XAU A;  2A6T A;  2JUC A;  2VIX A;  3TO9 A;  4CCK A;  3OOP A;  2LDU A;  3I56 I;  3H5N A;  2KP6 A;  2XKO A;  4XN0 A;  4P55 A;  1Z3X A;  3DLL F;  2Z5U A;  2IS4 A;  3WTW C;  5B3S H;  3FM3 A;  3KP2 A;  4OIR F;  3RIR A;  4AIH A;  5K7F A;  2OTJ I;  1EH6 A;  2Q2E B;  4HNU A;  5BNG A;  2LG4 A;  2DQR A;  4M3F A;  3S8P A;  4WX9 A;  3GFI A;  2ZXI A;  2COB A;  5CVJ A;  4B44 A;  3AL0 B;  3U2R A;  1MBH A;  4A2U A;  1J9I A;  4XN3 A;  3HPH A;  1XMX A;  4HST A;  1RES A;  4RM2 A;  3KIO A;  1HDP A;  3JTG A;  3D5S C;  1YLF A;  2VB6 A;  5D8K B;  3OYL A;  1Z21 A;  2L9N A;  1D0X A;  3GZN B;  2XUB A;  4KJZ A;  4P1W A;  3P9C A;  5AIP A;  1AWC A;  3C1D A;  2VBW A;  1O3S A;  5FRM A;  3H3U A;  1D5Y A;  4GGG A;  4NQW A;  2NAZ A;  4BY7 J;  1W7P B;  4WK8 F;  3HOY J;  3QWL A;  3F8M A;  2LRD A;  1UJ8 A;  4PJL A;  4AUX A;  3B6A A;  2XSJ C;  1BOA A;  1JJ8 C;  4KMF A;  2CW0 F;  2CQ7 A;  2M4K A;  4ZDO A;  4HX7 A;  3ELK A;  3L2W A;  1Z6R A;  2EFQ A;  2DN0 A;  1YO5 C;  1SAN A;  1B8I B;  2K7L A;  2W85 A;  2VBZ A;  3K70 D;  1WWX A;  3TP0 A;  1YOV B;  5DTD A;  4I6O A;  5L3E A;  5HOO A;  2CW7 A;  2EB7 A;  3W3C A;  4DJA A;  3JRA A;  3CC7 I;  2EH3 A;  3CMY A;  1VI0 A;  2GBY A;  5IP9 J;  2QWW A;  1GDT A;  2QSH X;  5M3F J;  2GOM A;  2QM3 A;  3VOE A;  1FPQ A;  4BUP A;  1SEU A;  3ZPL A;  5FRN A;  2JRM A;  5E1W A;  2IRF G;  3ZN1 A;  4DW6 A;  1ZRD A;  2QKL B;  2K02 A;  2COM A;  1SAX A;  2QF7 A;  2Q8K A;  3HSR A;  4RGR A;  3CF2 A;  4BHC A;  2XSD C;  2EV0 A;  4KIF A;  5DYM A;  2V79 A;  3C18 A;  4V2F A;  4PGH A;  3OYN A;  5ED4 A;  4L9T A;  3CES A;  1SFO J;  2XF6 A;  3J7Y J;  4ON0 A;  4C30 A;  4A0Z A;  3JAM K;  4MLO A;  1Z7U A;  2EV6 A;  3GW2 A;  4CZZ A;  2DMN A;  5BPI A;  1FMV A;  2MH2 A;  3M1C A;  1EV7 A;  3FXJ A;  3EQL F;  3FXL A;  1F36 A;  1JI8 A;  3HJE A;  3LSH A;  1H89 C;  1R5H A;  3KLN A;  4BJ6 C;  1J7K A;  1VQK I;  2XPU A;  2M45 A;  5TGT A;  3K4M A;  2KIQ A;  1V3F A;  1QZZ A;  4I02 A;  3F6V A;  2ZKZ A;  5F0F A;  3I64 A;  2JA6 J;  1BR1 A;  3WTU C;  2EFO A;  3DLA A;  5EG0 B;  1BBY A;  5D4S A;  3ZQQ A;  2W82 A;  2OJE D;  4RAF A;  3QQA A;  5LGU A;  2VQC A;  3CCR I;  2FJ1 A;  4P39 A;  1U9O A;  4Q47 A;  1XDS A;  5GAE J;  2BOL A;  3K70 C;  4RLQ A;  1G3Y A;  1LDJ A;  2P8T A;  1T08 B;  2PMZ N;  1T39 A;  4NC6 A;  5AON A;  1E3H A;  3OIP A;  1OCC H;  2JRT A;  2NVQ J;  2GQQ A;  3KX2 A;  2RN7 A;  2PJR B;  1XMK A;  2Q1Z B;  4LG0 B;  4R79 A;  1QZE A;  2DFH A;  4XMY A;  2RRE A;  2LY9 A;  2DPD A;  3DBL B;  3TO6 A;  2ZBK A;  4E70 A;  3L09 A;  2R7X A;  4EJW A;  2PFB A;  1GV2 A;  2EIL H;  5CVI A;  2HNH A;  4ZYH A;  1C5A A;  3BG9 A;  1JT0 A;  3ZQ7 A;  1ZG5 A;  1D1B A;  4S04 A;  4XSZ F;  2X48 A;  4D0P A;  2LP0 A;  1T8I A;  4WCG A;  3OSF A;  3CJT B;  4A0Y A;  1VQL I;  1FSH A;  5CYV A;  1ZHF A;  3RI4 A;  1B59 A;  2ME6 A;  1U8B A;  4IPA A;  3OYM A;  3ABL H;  1LVK A;  2XVC A;  5M3M J;  3H36 A;  2IPQ X;  3S2W A;  5D4R A;  3HRT A;  4IQ4 A;  3CCS I;  2VKD A;  2ISY A;  3D5L A;  2R7T A;  3PIO F;  4G94 A;  3I4P A;  1OJL A;  1S7O A;  1FIA A;  2CUZ A;  2BBY A;  4UXN A;  2ME0 A;  1AA7 A; 
#chains in the Genus database with same CATH homology
 3BC8 A;  2LBF A;  3PSI A;  1SFK A;  4GRI A;  4CUG A;  3KYL A;  3ZGK A;  3DPT A;  4BDY A;  3PUB A;  3OYI A;  4BE1 A;  3HXL A;  3DKY A;  2RQQ A;  4XLH A;  5JHF A;  1MW7 A;  1E0E A;  1X1A A;  3C2G A;  1DQU A;  2IXS A;  4OAZ A;  2VJI A;  2UWM A;  2DT6 A;  3LSK A;  4E7Z A;  1R6R A;  3TL4 X;  3OYA A;  2VQH A;  2IS1 A;  2R7Q A;  3H9Q A;  2UV1 A;  4CH7 A;  3OYJ A;  3L2U A;  3A2K A;  4JOM A;  3K4K A;  2VKH A;  4XLC A;  2CV1 A;  2WAQ A;  4PJJ A;  4LIU A;  4H4K C;  3LSI A;  3S3O A;  5LD2 C;  3OYH A;  4BJT A;  4RLF A;  3QOE A;  1DGW Y;  1QHH D;  4DIQ A;  3IUO A;  1N77 A;  3NWT A;  3HOT A;  3OYC A;  3ONQ A;  3VYS B;  3TBI A;  3VYU B;  2E5Z A;  2LY1 A;  3H9J A;  4YEL A;  2E60 A;  2PMZ A;  2HQA A;  2IGN A;  4XLF A;  3L2R A;  3E0J B;  2IGO A;  3HKZ A;  3K4N A;  2F5V A;  2HU9 A;  1MMD A;  4FAS D;  2I8D A;  3S3M A;  3DTK A;  3IAM 2;  2M7A A;  2X1D A;  3FHN A;  4AYB A;  4D9J A;  3A4C A;  4PSW A;  2V9K A;  3BCA A;  5LFA A;  1TZL A;  3IAS 2;  3EUA A;  4BDZ A;  1X1B A;  3SEZ A;  3ZRG A;  2LYC A;  3QYF A;  2R4G A;  2JSP A;  3IP4 B;  2VQG A;  2KRC A;  1Y6I A;  5HLT A;  4X0G A;  2Z1D A;  4ZYA A;  2AQE A;  3GBG A;  4QPO A;  1QU3 A;  3DPU A;  1GLN A;  1Z3Y A;  4NNJ A;  4PJM A;  1X1C A;  3K10 A;  2WY8 Q;  4BE2 A;  4RMN A;  2MFZ A;  4BQQ A;  3CMM A;  3S32 A;  3UNG C;  4XLE A;  3OS0 A;  3L2V A;  4PK4 A;  1LKX A;  3D5R C;  3K4B A;  3OMY A;  3QYE A;  3RTR A;  4ZJZ A;  4F91 B;  4IKF A;  2LBF B;  4G6T B;  2X1E A;  2V4J C;  2R7V A;  4B48 A;  1X1D A;  2MD0 A;  1V5G A;  4PSX A;  3S3N A;  2VAS A;  4XOR A;  4E7J A;  2KPM A;  2VLA A;  4XKV A;  3PSF A;  4BE0 A;  3H5A A;  2CMP A;  2CV2 A;  1D0Z A;  1U0J A;  4XKB A;  2DOA A;  2L7K A;  3W2W A;  1T0F C;  2V6E A;  4ZC3 A;  3LFU A;  1J09 A;  3C2H A;  4BQO A;  2ZSH B;  2W1O A;  3BG6 A;  4ZDP A;  4NUB A;  4XKW A;  2IGK A;  5JPM B;  3DWL E;  4ZDL A;  3MD2 A;  2RNG A;  3HUG B;  4IZZ A;  2VJJ A;  3BG7 A;  4YEJ A;  1T95 A;  4IX7 A;  4HEA 2;  4YRV A;  3VSL A;  2WA0 A;  3PNT A;  2LY2 A;  2M7B A;  3PNY A;  2K9M A;  2CW8 A;  2ELJ A;  5FRO A;  2X6X A;  4HSR A;  2Z16 A;  1K6Y A;  2QKM B;  4CCL A;  3QYB A;  4BU2 A;  4BL0 B;  1WJE A;  2X51 A;  3DKX A;  4KT6 A;  4E7L A;  2WAE A;  2M4G A;  1D0Y A;  5CKT A;  1VZ0 A;  2W4S A;  2KL4 A;  2PJR A;  2KLO A;  1N75 A;  4DBQ A;  4B47 A;  4DOZ A;  4ZTJ A;  3L2Q A;  3PJR A;  2M0M A;  4J00 A;  1D1A A;  3SYT A;  3J7A Y;  1QHG A;  3OR1 C;  2CFO A;  3DTE A;  4F3Q A;  1WJA A;  4F93 B;  1IRX A;  2Y0S A;  3EUK L;  1TT0 A;  3H5R A;  4XOT A;  2DXI A;  5KHD A;  2BW3 B;  3VYR B;  4XQF A;  3I3L A;  4PUS A;  4E7S A;  3OS2 A;  3DTI A;  4DGW B;  2R7R A;  3EPZ A;  4HG2 A;  2MAB A;  4Y4R A;  2JA2 A;  2X6Y A;  3AKZ A;  3K4J A;  3OYK A;  2O5R A;  3FBI B;  3K6G A;  1UEL B;  2LC2 A;  2P0W A;  4P5O A;  1DP3 A;  3LL7 A;  2BVM A;  2L2O A;  3CZ6 A;  2WBM A;  1W36 D;  2OUM A;  3KEY A;  2HDW A;  2WAD A;  4F52 A;  3SEQ A;  3DU6 A;  3OYG A;  4KIT B;  1ERD A;  2K9L A;  3RCO A;  3ZXS A;  3FKJ A;  4F92 B;  4RM3 A;  3VDX A;  5HNF A;  2HPI A;  1MMG A;  2WB1 A;  1MMN A;  3ZR8 X;  3OL3 A;  4C2T A;  4XM3 A;  2X6W A;  1WJ5 A;  1ZEL A;  1V5F A;  2XDV A;  4ANJ A;  1Z7L A;  3K4C A;  3LMM A;  3CJR B;  1DGR M;  2DJI A;  1YX5 A;  4ZTF A;  3SDB A;  1P9Q C;  1G8X A;  3OIQ A;  2R7S A;  3ZCO A;  4II2 A;  2DT7 B;  1OR7 C;  1FMW A;  2L9S A;  3OS1 A;  4OWR B;  1NG6 A;  4XL9 A;  1MND A;  2VL8 A;  1WJB A;  4E7H A;  2IS2 A;  4E6K G;  3CP2 A;  1UAA A;  2W7N A;  2OV7 A;  1N78 A;  3OY9 A;  4C9Y A;  2E5N A;  2IGM A;  2V26 A;  4E7I A;  4BEH A;  4XON A;  2K5C A;  3FBN B;  4D1Q A;  2XAU A;  2A6T A;  2VPL A;  2VIX A;  4CCK A;  4BQN A;  3QOD A;  3H5N A;  1W36 C;  2JUG A;  2KP6 A;  3S93 A;  2F6C A;  2JVG A;  4XN0 A;  2NOJ B;  1Z3X A;  3VYT B;  2IS4 A;  1V5E A;  1UG0 A;  4ITV A;  4B3X A;  2Z2S B;  1MNE A;  3H0D A;  2Q2E B;  4HNU A;  2LG4 A;  3U21 A;  4BGD A;  3M8J A;  3VSK A;  3S8P A;  4LIT A;  2ZXI A;  5CPR B;  4NC7 A;  4B44 A;  3AL0 B;  4XOP A;  3TMO A;  2K3P A;  4XN3 A;  2ZXH A;  3HPH A;  4HST A;  2VQL A;  4RM2 A;  1S9H A;  3D5S C;  3SZG A;  2VB6 A;  3OYL A;  2MC4 A;  3CP8 A;  3MKW B;  1Z21 A;  2L9N A;  1D0X A;  2JVH A;  2BVL A;  2WY7 Q;  3DEE A;  2A5W A;  3NWS A;  3RSN A;  3N05 A;  4CCJ A;  4KJZ A;  4P1W A;  3UR3 C;  1LDK B;  5FRM A;  1SAU A;  1X19 A;  3E1S A;  4IQJ A;  2GOX B;  4XNF A;  3A1Y A;  2LRD A;  4PJL A;  2XSJ C;  3HL2 A;  3OL4 A;  1KON A;  3LSG A;  4E7K A;  2LH9 A;  2M4K A;  2HVQ A;  4ZDO A;  3L2W A;  4II3 A;  4JQF A;  4N4N B;  2FUG 2;  2ZFU A;  3G2B A;  2XF5 A;  3V42 A;  3K70 D;  1OLT A;  2L5Q A;  5HOO A;  2CW7 A;  2CUJ A;  2CS3 A;  3W3C A;  4DJA A;  1X4P A;  3AL0 C;  3OR2 C;  2KMU A;  4FXG B;  3DQV C;  2GOM A;  4BXF A;  3OWT A;  4BUP A;  4J01 A;  5FRN A;  1MMA A;  2R7O A;  3W2A A;  1BOB A;  4OAY A;  1YE9 A;  2QKL B;  4HPQ A;  4CA0 A;  2R7W A;  4XR6 A;  4FET A;  2KDO A;  4E4H A;  3CF2 A;  4XKC A;  5CQG A;  4EAT A;  3DU5 A;  3HPG A;  3OYN A;  2XF7 A;  2HVR A;  3CES A;  2KRH A;  2XF6 A;  5HVQ C;  1HA8 A;  4C30 A;  2VXD A;  4NC8 A;  4BEH B;  4CCM A;  3EUH C;  4MLO A;  5HNH A;  3W2V A;  2VJ5 A;  4CCO A;  3MMY B;  1LFP A;  4BS9 A;  1FMV A;  4F55 A;  3M1C A;  2WAF A;  1JI8 A;  4Y3O A;  1WJC A;  3I9V 2;  4QPQ A;  2X85 A;  3LSH A;  4LIV A;  3F9K A;  1Y56 A;  4BJ6 C;  2E1M B;  1BR2 A;  1X4O A;  2HPM A;  3CJQ B;  3VWB A;  5TGT A;  3K4M A;  2KZV A;  4PFO A;  2LOO A;  1WJD A;  4HRI A;  1D1C A;  1BR1 A;  1YX3 A;  3OOU A;  3DLA A;  3ZQQ A;  2W82 A;  1EA3 A;  2BW3 A;  3OYF A;  4BAC A;  2VQC A;  3PNV A;  4XLA A;  3RQ4 A;  4DBR A;  3OYB A;  3PL8 A;  2CH0 A;  1WFX A;  2VJ4 A;  1WJF A;  2BOL A;  3K70 C;  4RLQ A;  4Y33 A;  2XC7 A;  4CCN A;  3OIP A;  3RPU D;  4AU7 A;  3FDY A;  4KIS A;  3KX2 A;  4AVZ A;  2PJR B;  2M3A A;  2Q1Z B;  1G59 A;  5CQE A;  2UUZ A;  4R79 A;  2IS6 A;  2V1N A;  4XMY A;  2RRE A;  2LRE A;  2HVS A;  1BR4 A;  4NQW B;  3BLY A;  4C2U A;  2E1M C;  2HZD A;  4U87 A;  3MKY B;  3HC7 A;  4CZC A;  2R7X A;  2HNH A;  2R7U A;  3OYE A;  3LSM A;  4HNT A;  3H9G A;  4PJN A;  1D1B A;  5KCM A;  2ZSI B;  2AQF A;  3H35 A;  4CSW A;  2V7F A;  4BJ5 C;  2OC6 A;  2X1C A;  5KNL A;  2W00 A;  1NG7 A;  3OYM A;  4LG3 A;  1LVK A;  2KHM A;  4N4O B;  3AFH A;  2F4I A;  1PYV A;  2MYS A;  3PFY A;  3HG9 A;  2VXZ A;  4U7B A;  2DCE A;  4IQ4 A;  3DPL C;  2VKD A;  3HOS A;  4PFP A;  1PJR A;  3MKZ A;  3BCB A;  3D5L A;  2R7T A;  2CV0 A;  3OYD A;  4B43 A;  2KQR A;  2CUZ A;  3K4L A;  1AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...