4PUSA

Crystal structure of influenza a virus matrix protein m1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
b'HSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 1
publication title Crystal structures of influenza a virus matrix protein m1: variations on a theme.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 54
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pusA02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4pusA01
4D9JA 3MD2A 1AA7A 5CQEA 4ITVA 1EA3A 4IQ4A 4PUSA 3VDXA 2Z16A
chains in the Genus database with same CATH superfamily
1AKHA 2OCEA 1EA3A 2A5WA 3MZYA 3HTUA 4W1UA 2X1EA 2R93J 1EV7A 2LF8A 4XOPA 2XPWA 5F1JA 5FLMJ 2WB1N 2QUFA 3G3ZA 2V6CA 2ECBA 2H94A 3OR2C 3PSFA 1O3TA 1A04A 2L7KA 4PJNA 1FX7A 5IYDJ 2E60A 3CCMI 4FTHA 2O8KA 3GMEA 3CUQB 3IC7A 1Z6RA 4Q47A 9ANTA 4WB2A 4YELA 3TEDA 1SEUA 3RDIA 1MIJA 3CP2A 2LLKA 1P9QC 3DPUA 4NQWA 2PLYA 1BI3A 2M3AA 2MFZA 3TO6A 4P9FA 3WU0A 4XMYA 2A6HF 1KU9A 5TRDA 2EIMH 2MC4A 1Y8QB 1PJRA 3ZN1A 2R0QC 2KT0A 1XGNA 3MN2A 3OS0A 2XSDC 4D0PA 3ECHA 1D5YA 1NG6A 1YE9A 3PFIA 5F0CA 2L9RA 3FM5A 3I64A 4DZPA 3IH4A 4OIPF 2MSYA 4M72A 1RC9A 1YS7A 1WJEA 3RKXA 1WJAA 4XKCA 1WPKA 3R4KA 2LRDA 1WVRA 2VQHA 2H8RA 1O3QA 3GFMA 3L2UA 1TBXA 2A6EF 4EJOA 4RB3C 1BJAA 2ETHA 1XDUA 2EFWA 3WTYC 3CUQA 2LKSA 3TDUC 3S3MA 4P5OA 2ADUA 2FXAA 3DU6A 1Q1HA 2PI0A 4MTEA 1RKTA 3BCBA 4JX4A 4L5IA 2QSGX 3TOAA 1EJ9A 1YTYA 4B47A 2K9NA 2UXNA 4C2MJ 2VKEA 2O8XA 2XAHA 4GYIA 4FCYA 2KHMA 3K2AA 3G2BA 1SD4A 2XASA 2K9SA 3I9V2 4C3IJ 2NVTJ 1LDKB 5JI6A 1S7EA 1R1VA 5JHUA 3CLOA 2Y9ZA 2FX0A 4YFNF 3GVAA 2M34A 3LSKA 1YX5A 2E1MC 3ABMH 3P9CA 4HA8A 1ETOA 1VQNI 1H8AC 1D1CA 4XN0A 1GVJA 2E36A 2R4GA 1ETQA 1BW5A 4P39A 2W24A 2X6OA 1S9HA 3I59B 4I98B 3ZQ7A 4E7IA 2LC2A 1WHUA 3TQNA 4KT6A 4BKXA 3A0BC 4L5EA 4IRGA 4GXOA 2XPVA 1DGRM 2M0MA 1T2KA 2V26A 5M3FJ 2W57A 2ID3A 2R7QA 3GX4X 3HSEA 1OR7C 1FPQA 1Y1VJ 2QSFX 3H9QA 1R1UA 2V7FA 1YRNB 2NVUB 4Y52J 2COMA 4UUSA 1CF7B 3TGNA 2NS7A 3HXLA 5K1YA 4RM2A 1F5TA 2K86A 3M07A 3S93A 4QPOA 4RAYA 3ABLH 4ZJZA 4S04A 3GTOJ 4HV6A 4ITVA 1AU7A 2QQ8A 3I5UA 5IY5H 3TO9A 4HDUA 3LSTA 1Y1WJ 5FLVA 3E97A 3PM1A 2BXZA 3F8FA 4BE2A 2ELKA 4BE0A 1V5EA 5KNLA 2E34A 2L7FP 1O7FA 1YJWI 4XKWA 1H88C 4JBAA 2VPLA 2GXGA 3CMYA 2Y0MA 2E5NA 3QU3A 1JT6A 2LYCA 3RKYA 4PDKA 2DT5A 2JA7J 5LHIA 2XIGA 1CQTA 2XAGA 1BOBA 2VXDA 4FE4A 2UUZA 2W4SA 4AVPA 4H0EA 3HRUA 2WAQN 4HOBA 1XCBA 4WK8F 3BOQA 3IRRA 2DU9A 3SJMA 4OOIA 3G71I 2FSWA 1YRNA 4D5FA 2M8EA 4II2A 5M3MJ 3I55I 4A3JJ 5JLWA 1B1BA 1REPC 2J5OA 3M9AA 5HLGA 1WFXA 1TT0A 3E5UA 2ZJQF 3HOYJ 3GBGA 2LTPA 2WADA 2VT3A 2IS6A 4IQJA 3I56I 3S2DJ 5JPNB 4A3BJ 2N8GA 3VOEA 1C5AA 4AIKA 3VWBA 1X4OA 2VKVA 2PEXA 3RKWA 4DJAA 5GAGJ 1BC7C 3BLYA 1V5GA 3JTGA 2L2OA 2DQRA 2EZKA 5F1RA 1Z67A 1R4NB 3WTXC 3RPUA 3E6CC 2BOLA 2IAIA 3O3KA 4I6ZA 1ZRDA 5AIQA 1P7IA 4A5MA 1ETKA 4G8XA 2WA0A 3K6GA 2HTJA 1W0UA 2KIQA 3OL3A 2MLKA 5IP9J 1HKTA 3CCEI 1PP8F 3LQRA 3M4OJ 3BROA 4CDGA 2ZMEB 1MNEA 2GA1A 2EIJH 5DV5A 3S3OA 3RI4A 3AG1H 5C4JJ 2JUGA 4LIUA 3AG4H 2WBMA 4HYEA 3DPTA 2ME0A 1ETYA 1I3AA 2JVHA 4B3XA 4I99C 3HOVJ 1BC8C 2G7UA 1G3YA 1S7OA 1V54H 4FXKB 1IUFA 4HEA2 2O61A 5GPAA 1IC8A 2XB5A 4BDZA 4G7OF 4L0YB 1POGA 3FXRA 3V4GA 4GO1A 3HL2A 2F6CA 3H3UA 1QZEA 1MBJA 3R0AA 2AHQA 2X9DA 2EZIA 3COAC 2Y0SN 5D5VB 4D1QA 2CS3A 5DM7F 1LPQA 2Y2ZA 3TL4X 2M2EA 4A3CJ 1R00A 2PX9A 3RPUD 1WCMJ 2MD0A 4RLFA 4EATA 4WXHA 1XSVA 1U5TB 3PNVA 1RUNA 5E79C 1SVLA 2V1XA 4AIJA 1P4AA 3R0JA 1HSJA 4YIIA 2XGCA 3CLQA 2ZMEA 3RCOA 3GYHX 2JWTA 1T38A 3I58A 3N05A 4LLLA 3CDHA 3X2QH 1F4KA 3S8PA 1Z3XA 4AYBA 3DEWA 2R7RA 3BZCA 5IOYA 5HVQC 2GLOA 3JRAA 1B72B 2H27A 3PO3J 2QM3A 1QZYA 1IF1A 1XMKA 1V3FA 2PQ8A 3HEFA 2DA1A 1TWGJ 5JVTA 1XMXA 3NEUA 4XLCA 3VYUB 4BJTA 2P5KA 3SZTA 3H5NA 2EILH 4XLEA 2G7HA 4DGWB 1FP1D 4CCOA 2OCCH 3CZ6A 1TLHB 4UXNA 3PQJA 3K69A 3I54A 2ESHA 1JKPC 2QGUA 2ZJ2A 4R79A 4C30A 2G0EA 1YFHA 1T56A 3FHZA 4OWRB 1VZ0A 3HHHA 3HSRA 4EVIA 1GHCA 2FOWA 3U21A 5B5EC 1WJBA 1H89C 1IGNA 2KRFA 2Y48A 5D8KB 4S05A 3Q0UA 2V9PA 3OYDA 1U5TA 4KUMA 3J80K 3CCSI 1ZARA 4A5NA 4A3DJ 2X1DA 1X1AA 1XS9A 2STWA 2X6YA 3WG7H 1K83J 2R7TA 5GPCA 1FP2A 2W84A 4HLYA 4BHCA 3V7CA 1YQAA 3RQIA 1OMIA 4U0YA 2IA0A 3K7AJ 3AKZA 3HHGA 1MJAA 1W0TA 5JFRA 2UXXA 3ELKA 4XRMA 1Y56A 2EIKH 3H0DA 3HRTA 1IN4A 1IDYA 2FQ3A 1E3OC 3ZQLA 1QGPA 5DD4A 2KISA 1XG1A 4Z6YA 2FD5A 2OZ6A 2F5VA 2F5DA 5EF6A 4X6AJ 3KYLA 1KJSA 2JT1A 5BNGA 4NNJA 4UY8I 4X0GA 3IHUA 5EZHA 4IXAA 1GXPA 4A3FJ 3S32A 2OPTA 4KDPA 3QOPA 1JI8A 3VDXA 2R7FA 1VTNC 2NAZA 3Q9SA 1RPWA 2KIUA 1I27A 4HW5A 3FZVA 3E6DA 4NDLA 1P2FA 3CCLI 4ON0A 4JOMA 5EYRA 2P6TA 1YW9A 2ZXIA 2R7VA 3OY9A 2EBIA 3CCVI 4BACA 5K7ZA 4ESJA 3JRIA 1ZRCA 3QQAA 3KP4A 1Z3YA 3QPSA 2BZTA 1R23A 4U87A 4EGYA 4L9JA 3ISPA 5AONA 3HTSB 3CUQC 1LE8B 1ZTRA 3V7RA 3BQYA 2VKHA 3MAJA 1WGXA 2B7EA 4HF0A 3K1PA 4ASNA 5JLXA 3M1EA 1BW6A 2Z99A 3CC4I 2KMUA 2V6EA 2VQGA 2ZNZA 2ELHA 1SFKA 2DOAA 1HOMA 4UV9A 1LFUP 2YUSA 3ZRGA 1YIJI 3GTQJ 1KQ9A 3V7SA 2EWNA 5M5XJ 4AM3A 3FF5A 5DEQA 4HRIA 3SXYA 2K9QA 3OYAA 2Y30A 3BG9A 3NAUA 3KLOA 3LAPA 2K3PA 1FOXA 1Z7LA 2ZJRF 1D0ZA 3VSKA 1ZLKA 5CLSA 2QZ8A 4A0XA 2MW8A 1N78A 4BQOA 3SFZA 2CV1A 1PUEE 2MGQA 3MCZA 5L3BA 4KICA 4I0BA 1IRXA 2HDWA 4WXDA 2LOOA 1TQPA 2GAUA 2K85A 3IAM2 2DTRA 4BJ6C 3KZZA 4MLOA 2CQNA 3CJQB 4BL0B 4BQQA 2AS5F 1VI0A 4F55A 1LE8A 1RIOH 4ZYDA 4BBRJ 1ZGWA 1SVMA 3HKZA 4LB5A 3BPVA 3SEZA 2UWMA 2IGNA 1IRZA 1OYIA 1U8RA 2M7AA 3OSFA 2DA4A 2DMQA 4ZYEA 2K7LA 1MSFC 3E5XA 1W5CC 4XNFA 3OOPA 5K7HA 1QHGA 5F27A 2G9WA 4FT8A 2YPRA 4FASD 3FKJA 3LSRA 2HZTA 2RREA 3JR9A 3E6BA 3TDZC 1GV2A 3GCMA 2HQRA 3OS2A 5E8GA 2JA5J 3FWEA 4OU0A 2WY7Q 4HPQA 3WTTC 4FHTA 4A3GJ 3WTWC 1ZAOA 2PJRB 2ZXWH 3C7JA 2PMZN 4ZYAA 3KZYA 4C2TA 1B8IB 4OMZA 1TQIA 3S1RJ 3CQZJ 3OYJA 1Q1VA 4XRFA 3KETA 4HQMA 4DYQA 3IWFA 1A31A 3R60A 5EEHA 5C4XJ 1YOVB 2LDUA 4EM1A 2M45A 4ZC3A 2XHKA 3WGHA 4F7ZA 2MYSA 2DQLA 1X58A 1G3TA 3DTKA 2AQEA 3F6VA 1Z77A 2MG4A 3PO2J 2DA6A 4A0YA 2ISZA 4QPQA 5LGNA 5F6FA 4IHWA 2KKOA 2HPMA 2HOTA 3KEQA 2DA3A 4A3EJ 3PUFA 1QU3A 1W4MA 4LIVA 2QBYB 4TV7A 4B3AA 2EV0A 4XONA 2VASA 5J1UA 5HODA 2Q8KA 1IXSB 4PJJA 2CQKA 5D4SA 3L7WA 4MEYF 4IHXA 4PSXA 2X85A 5ILVA 3JCUC 2KDZA 5A2QK 4Y4RA 1GXQA 5LEJA 4FXGB 1IDZA 2FBKA 3S16J 1VQPI 2PJRA 3F72A 4LITA 2LF7A 2Z9OA 4U7DA 3CESA 2X51A 1NK3P 4C3HJ 3DU5A 1XGMA 4JQFA 2XDVA 2K9LA 1IV6A 3S2WA 1AKHB 2LNBA 2XAUA 4IOAF 2DPDA 2E35A 5HS7A 3DTEA 4L5JA 3OYEA 4XLFA 2DFEA 4LFUA 5E3LA 1U2WA 4N9IA 1D0YA 2HOAA 1MSEC 5FD5A 3DBRB 3ZMTA 1FSHA 4ZZDA 3CU7A 1X1CA 3HOUJ 2CG4A 3ASOH 3LA3A 3CCJI 1WH7A 2QBYA 2CYYA 3KP2A 4IJAA 3EUKL 5FKKA 3PJRA 3S2HJ 2GBYA 1M1EB 2IPQX 4HV5A 2GIVA 4NQWB 4ZDLA 1C0WA 4M73A 2HPIA 3V42A 2Z5UA 1BI0A 1HXDA 4GRIA 1ZH5A 5BS6A 4AC0A 1UZCA 1BI2A 4P1WA 2VT2A 2CQQA 1UG0A 2EPFA 2DMNA 1HBXG 2CFXA 3HOXJ 1RESA 2DA2A 3BG6A 4B4CA 3FDYA 1LKXA 3HIFA 5HDGA 1SANA 2QENA 2VQLA 3LSJA 1S29A 5IPAA 2NVQJ 1ZN2A 2VXZA 5KAFC 1E3PA 2QF7A 4RAZA 1XTAA 1QNTA 5CJ9A 4BUPA 3E7LA 2ZMEC 1Y0UA 2Q1ZB 2FA5A 2F2EA 4M3BA 2CGPA 1RR7A 5FJ8J 2RVCA 2WAEA 1MW7A 3BR5A 3OYMA 3CDLA 2MABA 1MNDA 2D1HA 3GF2A 4DW6A 1N25A 3WG9A 4MFEA 4ANJA 1DP7P 3KLSA 4BS9A 2TCTA 3QYEA 2DLLA 3SYTA 1NG7A 1U3EM 1HKSA 2XGEA 1OCOH 1W5TA 2DBBA 5TJJA 4Y15A 1P4XA 4Q48A 2M87A 3WHCA 3DLAA 2VBYA 4ZYGA 4WF2A 5TGTA 3S1QJ 4E7SA 3C2BA 1OCRH 1AHDP 2NS0A 3SFIA 1R22A 4HSRA 1DPRA 1TW2A 2X1CA 3DWLE 4RB0A 5J4YA 6PAXA 1P6RA 2BVMA 2XF7A 1TZLA 2JN6A 3K1NA 4M6XA 5FO5A 2WY8Q 4F3QA 1WSUA 2QCOA 2WB1A 1R6RA 2IVMA 2O0YA 4BXFA 5HLTA 2O5RA 1GDTA 1R5GA 2E1CA 5A2QZ 3K2ZA 3OYNA 1U5TC 5IT3A 3W6VA 4IRHA 5HDKA 5HLHA 1J59A 3GXOA 3U1KA 4C2UA 4CUGA 2VBZA 3LFKA 2XF5A 3PL8A 2GQQA 4RA2A 1VQOI 4I09A 1UAAA 3JAMK 3JRFA 3L2RA 2KRHA 2VKDA 1FYMA 4BNCA 3GWZA 2FNPA 3BWGA 1P7JA 2DMUA 3BJ6A 4U0VA 2FF4A 1MMNA 5F0FA 1H9TA 1MMGA 4I2OA 2XC7A 2F4IA 1ZR2A 3ZQFA 1D5VA 1O7LA 3VEPA 3WODF 5EDNA 4HLXA 2XGDA 1LJ9A 1ZHFA 4UUSB 3F22A 4DZJA 2ECCA 2HKOA 3WHBA 3WTSC 5KAIC 2DT6A 2W25A 2STTA 4LMYA 1R71A 2Z3YA 5HS9A 3PIPF 3QPHA 2HR3A 4XN3A 3GFJA 2DFFA 2FU4A 3ESWB 4KNYA 3HB9A 4E7ZA 3QU6A 5LGUA 3M7GA 5GTIC 3T0YA 1MGTA 3ZQGA 3F8NA 3ZXSA 1QA6A 2A3SA 3KEOA 3KP6A 4Y7NJ 2X0LA 4CZCA 1DU6A 2E7WA 2DK5A 2DMTA 3VSLA 1FEXA 3DTIA 3G1MA 3IKTA 5L3GA 1QHHD 1BR1A 1ON1A 2KFDA 4LG0A 4IVNA 3PIOF 4G7ZF 2A6TA 5CQEA 1MJ9A 5FB2A 1JHFA 4YRVA 5LBQA 4G6QA 2DCEA 3AL0B 3SDGA 3ZQQA 4M9XA 3L00A 1Z9CA 2ZXHA 1I3QJ 1IN8A 3BQZA 3NARA 4A3MJ 3S17J 3N4MA 4ZTJA 3CUOA 4V2FA 3IKVA 5E3NA 2LD5A 2L01A 2HVSA 3E0JB 4F91B 3BG5A 1Y0NA 2GWRA 2HU9A 2KQRA 2L4MA 4ENJA 3J7AY 1QPMA 4HX7A 4M6VA 3FIWA 2JQ7A 5IP7J 1FMVA 3KP7A 3HPHA 3O8GA 2H6BA 2Q0OA 2IGKA 1YI2I 4JX5A 4DBQA 4FX0A 3UKGA 2E2JJ 3H92A 3RQ4A 4LJZF 1RI7A 2P81A 2W7NA 2NXNB 4OAYA 3DKWA 2ISYA 3OL4A 4XSZF 4ZTFA 2A05A 3ZN0A 2MD5A 1ETVA 2VJ5A 5GAEJ 1MNMC 3E6MA 2IW5A 4DYRA 4XICA 2M30A 2D2WA 1TC3C 1MH4A 2XRLA 5M5WJ 1FWZA 2L4AA 3TKYA 1O4XA 2O3FA 3IP4B 4PZJA 2JSPA 4D9JA 2LSOA 2OA4A 2DFHA 3LSHA 5J8FA 2HVQA 3JAMZ 4LK0F 1S3JA 3BR2A 4KN7X 2D45A 1R7JA 2EZHA 3AFHA 1W1WE 4I76A 1J5YA 1VQ6I 3TP0A 4XK4A 2QWWA 1XPXA 1FOWA 3HDDA 1IXRC 5J8CA 3OR1C 1P92A 3P9IA 4HW0A 1JUSA 1MD0A 2V1DA 2VODA 4QSHA 3H5AA 3HOZJ 2F48A 2QEXI 3PQKA 1SVOA 3DP7A 3JSOA 4RMNA 4ZH4F 2E5ZA 1XSDA 2X6XA 2Y69H 3CCUI 2R7UA 3BTLA 2ZJPF 2WAQA 2HZDA 3LAJA 1BA5A 1K61A 1GUUA 4UUVA 2CFOA 2M9HA 3DKXA 5LRRA 1USSA 1T95A 2R7WA 3I71A 5FKLA 1YG2A 5JR3A 4FISA 2L0KA 4CCNA 3U1DA 2JA2A 5E1WA 1HLVA 2OC6A 3KFWX 1X2MA 2V79A 1JE8A 2FMYA 3ZP5A 3WU2C 4MHGA 2JVGA 3OSGA 4KISA 2RQPA 1J09A 4MTDA 2KLOA 3C2GA 1X4PA 2P6SA 1XGSA 3ZPLA 1B9NA 1LEBA 5J3LA 1CGPA 2XF6A 2L5QA 1UB9A 3C3WA 1T8IA 3WU1B 1X1PA 4OINF 2XAJA 2V4JC 4MO7A 2JPCA 2VL8A 2KZVA 5B66C 1ZGAA 4CCMA 2DI3A 1NHAA 2QQ9A 3I0TA 4IO9F 3CJNA 1NH3A 2K9MA 3QPLA 2F4MB 4I0AA 3W2AA 1FNNA 4HZFA 4WCGA 5L3DA 4AWXB 5C44J 2EFPA 4QLCU 3MKYB 4DNCA 5LGTA 2F4OB 4CCKA 4GYGA 5CPRB 2YX4A 4HSTA 1D0XA 1FJLA 3ZMUA 1HW1A 3WTZA 2FMLA 2KRCA 2H1KA 1FTZA 3K4LA 3FXUA 2IGOA 1BI1A 2WV0A 2R7DA 3B73A 5EEAA 2P5LC 3DBLB 5L3CA 1X3UA 3FKIJ 2Y0SA 4O3MA 1D8JA 2ZSIB 2K3FA 3S1MJ 1JGSA 3LWFA 3N97A 3BR3A 3HOSA 3RZOJ 5CVIA 3BZKA 2NRAC 3NWSA 4KN4X 2IA1A 4FE7A 3KE2A 3REOA 1KGSA 4ZDOA 2BY3A 4RDUA 1DDNA 4ABZA 4XL9A 5BPDA 5E20A 3CDIA 3F8BA 2DPUA 3CF2A 2Y31A 5J4VA 3M8FA 1ODDA 1FIAA 4R8HA 4BU2A 3ZQCA 1FBUA 3S14J 3RJPA 3JRGA 3GEZA 3H36A 1DU0A 1Z05A 4RAFA 3HYIA 2WWYA 3TO7A 5TISC 4ZZLA 5CVUA 3MEXA 2O03A 3P9KA 1B4AA 4EV0A 1FMWA 2KPMA 4CA0A 1LDDA 2GZWA 4Y3OA 2UV1A 3MFKA 3H1CA 1STZA 5HLIA 3GTLJ 1RR8C 1ZELA 4GCVA 5E1ZB 1U9NA 2CQ7A 4BYYA 3M8EA 4RGSA 3GZNB 1W36D 3W2WA 2HI3A 4E7JA 1SFOJ 2M4KA 5LLQA 1LNWA 5IT9K 3B02A 2CW0F 3BJAA 3HRMA 1R5ID 2PFBA 3ABKH 4DIQA 5DTDA 3KPHA 1H0MA 5B1AH 1QVTA 2O7OA 3UNGC 3W2VA 5LD2C 3ZR8X 2CQXA 1D3YA 2DTZA 1ZQ3P 1T0FA 2Z1DA 3KYCB 3P5JA 4IHTA 4BXXJ 2R7SA 1V55H 5J1YA 2OTJI 2LKXA 3PNYA 1VQ4I 3LQQA 3K70D 2EQRA 4MQ9F 2NS8A 3VB2A 1UELB 2CUZA 4YG2F 3FXOA 5DUIA 3A03A 3TW7A 1BR4A 3AAFA 1J9IA 1ENHA 1FZPB 2VE9A 1VQKI 4LG3A 2HWVA 1MJBA 1T08B 5D8LB 1SD7A 3EUHA 1VQ8I 2HEOA 2OUMA 1G59A 1TW3A 2NNNA 2H1LA 1KU7A 2D1VA 5F0HA 5D6EA 4WXCA 3FK6A 2W48A 3K4CA 3OS1A 4EJTA 1FTTA 4P96A 5DUKA 2KDOA 1WI3A 2KL4A 2BVLA 2IS2A 4A0ZA 1JXSA 4BAYA 2W00A 5FKMA 1KA8A 1J7KA 1JTYA 1OISA 1JGGA 1MMDA 3BJOA 3Q3SA 1SD6A 3JRHA 5LHHA 4JYKA 5EGOA 1LUJB 2K40A 4BJ5C 2MH9A 3MKLA 1EH8A 1IN5A 2A07F 2E7XA 3FHNA 3GTMJ 3CO7C 2ZO4A 4D7MA 1MBHA 5E8IA 3S3NA 3DLLF 1BIBA 1N75A 3GUDA 2V1UA 1EH7A 3DEUA 1K79A 4KIFA 3SDBA 2R7XA 2LG4A 5E3MA 3RKQA 1SC7A 2DN0A 4UVBA 4CH7A 3IRQA 2QKLB 2CO5A 1VNDA 2BYVE 1R5HA 2NYXA 3ECOA 3MMYB 1WZ2A 3ROUA 1Z0XA 3GW2A 1T39A 4OAZA 1YIOA 2R7ZJ 3BTIA 3A02A 4XKBA 1FOYA 2QA4I 1SAXA 3CF5F 4A93J 3OV8A 2O9LA 3ULQB 2DJIA 1R49A 3LSIA 4HF2A 3I4PA 2YU9J 1K78A 1WJDA 2EFNA 4G94A 2QYOA 3ZQIA 3H9JA 3FXKA 4LLGF 1MDMB 4ENNA 2R7OA 2CV2A 5LRSA 1XSXA 1Y8RB 1UFMA 2LREA 4LOCA 2VBWA 3FXMA 4PUSA 4PFOA 3T8RA 4KITB 4RAGA 4CO8A 2W82A 5IYCJ 2DT7B 4M3EA 1LB2A 2X48A 5IT9Z 1GVDA 3J7ZI 1NTCA 3VODA 1RETA 1BL0A 2EK5A 1T98A 1ZG1A 2E1NA 2EFQA 4WX9A 5H20A 1KYZA 3QODA 2VLAA 3CJTB 3G6EI 3MWMA 3ONQA 4BE1A 3L2VA 3C2HA 2Z33A 1E0EA 3JRCA 4L9TA 3B6AA 1APLC 1A6QA 1UHMA 1SMTA 4HQEA 3SZPA 4HF1A 2K27A 1MBFA 4D7NA 3TMOA 2DOFA 1YW7A 2C6YA 3PNTA 4ZDPA 4EMSA 3A1YA 1MH3A 2Q2EB 1BBYA 4XLPF 1VQ7I 2OV7A 4J00A 2M7BA 3BTJA 4LK1F 5ICEA 1U9OA 2BY2A 2IP2A 3AL0C 2IJLA 4KIBA 3WGIA 2HYGD 2FQ4A 3HUGB 4A3IJ 4IL6C 4ZYHA 1ZRFA 2DAOA 2KZGA 4E7HA 2PMZA 1MDMA 2E1OA 5GADJ 2WV1A 3M1CA 4WB3A 3F6OA 2FEZA 2HKXA 2BV6A 5IOZA 1ZG5A 3ASNH 2P8TA 1TNSA 3K0LA 4U7BA 1ZGJA 5ILSA 2CH0A 3JRDA 3PSIA 3FM3A 2LVSA 4XM3A 3UR3C 4HWJA 5IP6A 1GV5A 5K7FA 1MBEA 1SAUA 1OCZH 4NC6A 1CFAA 4C3JJ 3HOTA 3LSMA 3RYRA 2W1OA 1D1AA 1OQYA 3GZ5A 4UU9C 5B1BH 4HBLA 1JKRC 3F8MA 1G6NA 1S6LA 1LQ1A 2PJPA 3LL7A 2QQBA 2LY2A 2Q2EA 5DCMB 3QOEA 2DMPA 2VJJA 5DD8A 5FKNA 2XAQA 2CU7A 2MLGA 3LSGA 4L18B 3KP5A 4RGUA 3ZGKA 3MD2A 4IRIA 5EZGA 3F8CA 3O6BB 1KONA 4H4KC 3T8TA 1FIPA 2DDBA 5JHFA 1D8KA 3HUGA 4U0WA 3IUOA 1WJ5A 3QWLA 2HFHA 3M8JA 1XMAA 3FXLA 4DQ2A 2OQRA 2VI6A 2ZNYA 2CRGA 3F21A 4U88A 5LFAA 1FBQA 2FE3A 4B48A 2OQGA 3K4MA 4UHTA 5BOXA 3CO6C 4OIQF 4QWQA 4KT5C 1U0JA 4BXUA 4ESBA 2OTLI 4PCQA 4MIMA 2ZCWA 3WTVC 4M71A 2VONA 2HXIA 2JK3A 2VBXA 4Y17A 3HQBA 4MNUA 4NC8A 1IAWA 2E2IJ 1UMQA 2IXSA 4GGGA 3J7AO 1KZHA 4PFPA 2IEKA 4CSWA 3GZ6A 4Q4ZF 4BH9A 4ETSA 2XB0X 1KU2A 2BEOA 1U8BA 2W85A 1IJWC 2CV0A 3HOWJ 3V8KA 1TWFJ 1FYKA 1SMYF 2QSHX 1R1TA 3RPQA 3EUAA 3U2RA 2EH3A 1PDNC 3FBIB 5FRNA 1SFUA 5DCMA 5CKTA 2EFOA 3P7NA 5E1XA 4M3DA 2DYSH 1O3SA 1DQUA 1GLNA 1VFCA 2A73B 3LMMA 1AOYA 1QVUA 4V19K 4A2UA 2P7VB 3L2WA 3DPLC 4HNVA 5K5OA 2OAZA 4K2EA 4RBOA 2ESNA 1W36C 4JP0A 2B0LA 2OD5A 2LFBA 3ZCOA 1F43A 2OZUA 4PJ0C 3SEQA 1F36A 1R36A 3L2QA 3HG9A 3RSNA 2HOEA 3SQNA 3G73A 1HW2A 4RLQA 5ICGA 4HDVA 5FLXK 4F52A 2RKHA 3ZMSA 3I53A 2P0WA 5K5QA 2ZC2A 5AIPA 5DS9A 3OYLA 4GDFA 4W97A 2BHZA 3GTPJ 3H35A 3K70C 1YJ9I 3BC8A 3D5SC 3L9FA 1F9NA 3V8JA 4XOTA 1XX5A 4J19A 3HZJA 4E6KG 1LVKA 2I5UA 1KQ8A 3A4CA 1JTXA 2CWEA 3L2CA 1XC5A 1DPUA 4HNTA 2HTSA 2DFIA 4KYWA 1K4SA 1I50J 5GTHC 2HQNA 4RGRA 2MH2A 4LG0B 1IN6A 1H9GA 1Z91A 3DV8A 5C3EJ 2NVXJ 3GTKJ 4LB6B 2M8GX 2IRFG 1XDSA 3U9GA 1ONVA 1MKMA 2NOGA 2YSRA 1TTYA 1I1GA 1V5FA 3BR0A 3O8HA 2LP0A 2R3SA 3QYFA 1ETWA 4RM3A 3W3CA 1ZKGA 1KQ0A 3HBLA 1JJ8C 3EETA 3BPXA 4BHPA 3JSPA 3NWTA 2IBDA 2XKOA 4I02A 4UB6C 3W6KB 3R61A 2P7CB 4IHSA 2FUG2 2NOJB 3LA7A 1T0FC 3ERMA 1UCRA 1ULYA 2IA2A 3HJEA 4YIFA 2YR2A 5FROA 5D5UB 3JREA 3ABUA 4A12A 2X6WA 1HDDC 4CHUA 2HS5A 3FX3A 3J7YJ 1S7AA 1DP3A 5BQTA 3EYIA 2DDAA 4KIGA 4XSXF 3VPRA 1ACIA 1IG7A 1E2XA 4LGWA 4RB1A 3EUHC 4MFDA 4R1HA 3BR6A 3C1DA 1TWHJ 2RDPA 3Q9VA 1W5SA 1WJCA 3ZMVA 1HW5A 4BGDA 4LD5A 1JKOC 3ZQHA 4BHBA 2K5CA 3D0SA 5EJCA 1A36A 4NC7A 2RQQA 1VQ5I 1JUMA 1G8XA 2QQAA 4G9YA 2AXLA 2Y75A 4BY7J 4OIOF 3PUBA 1X19A 4DOZA 3D5RC 1SD5A 2PG4A 4CYCB 2HDCA 3QYBA 3QPTA 5H2FC 3OOUA 1HKQA 3Q0VA 3BR1A 1B59A 2FRHA 1VQMI 2F5CA 4I7HA 1G4DA 2ME6A 2ZFWA 4B1RA 3EQLF 1JKQC 4XLAA 2LR8A 3I4MJ 5F08A 1K7AA 3OYCA 4KA4A 2JMWA 3CC7I 3KYDB 4OMYA 3WE2A 2OBPA 3L09A 5FLXZ 5L3EA 2A68F 3FXQA 1PUFB 2XV4S 4IOCF 1U78A 4M74A 2OJED 1A5JA 4NUBA 4ESFA 4N0BA 2HQ5A 2XRNA 4B09A 4EQQA 3MKWB 4NHJA 2JA8J 2B39A 3O2PE 3NRVA 1EH6A 5J6XA 3LSPA 2B9SA 4AUXA 5BMZA 4Q5SF 5KCMA 2K4JA 3MQ0A 4G6DA 5F64A 1YO5C 4PSWA 4MGRA 5DM6F 1S5LC 2GM4A 1ZK8A 1I39A 1XD7A 5ICFA 1IXCA 3HGGA 2L54A 2PMUA 3W6JB 2FJ1A 3D1NI 1WQ2A 3RIRA 2JRMA 2XAFA 5FRMA 4CYCA 2EJRA 4E7KA 3TBIA 3BZ6A 2DO7A 1R4MB 3FMRA 3KX2A 5M5YJ 2WTEA 2OF7A 1J75A 4FQGA 1YX3A 5BPIA 4XQFA 4G7HF 4P55A 4IX7A 3BDDA 2EV6A 4AD9A 4F93B 3IL2A 1XN7A 2H6CA 3FK7A 3S1NJ 2BBYA 5HS8A 4QTRA 3I59A 2ZSHB 1PYVA 2Y9YA 5EEGA 3VYRB 1MMSA 1ZLJA 4BQAA 2JJ7A 4B8XA 5HNHA 4Z2YA 3IAS2 2FBHA 4JX6A 3CMEI 1OYYA 4DBRA 3HRSA 5DYMA 1PUFA 2WAFA 1TT5B 1RZ4A 3WE3A 5CVJA 1T6SA 5L3FA 3VYSB 1EF4A 2FNAA 2QLZA 1CF7A 2ZBKA 1OJLA 4KMFA 1E17A 1JUPA 3G1LA 1WKMA 3CCQI 3HGYA 4FETA 1D1BA 2V9VA 5D4RA 3HQAA 4KMUX 5J1RA 3I3LA 3CCYA 2AXTC 3CC2I 2AO9A 3QP6A 2HOSA 1OCTC 3BT9A 4YEJA 1FOKA 2CW7A 2KIMA 1X3ZB 1N77A 2GOMA 3BP8A 3DKYA 3F3XA 3KP3A 3RZDJ 2BY1A 1BM9A 2EZLA 4C9YA 1VF9A 2FOKA 2P5VA 3T5XA 4YFKF 4A3LJ 3OYGA 1SFXA 5K5RA 1LEAA 5JVGF 2A69F 4DYCA 2X4HA 3K4KA 3OIQA 3OWTA 2HGCA 5H6RA 3BCAA 5ERIA 4I6OA 4IHYA 1E3HA 1IW7F 1USTA 3CTAA 1AWCA 4AVZA 2MBFA 2DYRH 3FXJA 1QO0D 4YFXF 3Q5FA 1G3WA 2JRTA 2L9VA 2I8DA 3A2KA 3K10A 4AU7A 4IEJA 4AYBN 2L7MP 3F9KA 4ENKA 1RUOA 4PGHA 4EGZA 3KIOA 3CD6I 4XBFA 1WWXA 2JTVA 2TDXA 3CCRI 1X1BA 1ZG3A 2VOPA 2CUEA 3ZOBA 2LBFB 1T33A 5B4PB 1BIAA 1WRJA 1QRYA 4M9SA 5KVRA 2J5PA 1FT9A 4I01A 1G3SA 4XLHA 2JSCA 4MQVA 5HDNA 1I5ZA 2CUFA 1I1SA 4X1EA 1FY7A 1TQMA 3WGGA 4LLNA 3Q0WA 2XGXA 3J81K 2RV8A 1YHQI 2GXAA 5JPMB 2PN6A 1Y6IA 4IKFA 1WJFA 5DCFA 2O6GE 2Z2SB 4GFBA 3CMMA 2NNYA 5CQGA 5B3SH 5J47A 2CW8A 2JPBA 1ZREA 1U6GA 5ILUA 4EJVA 2QKMB 5KHDA 3HPGA 2YS9A 1ON2A 4NBQA 3BTCA 4XIDA 1XCVA 2VE8A 2EINH 1ITYA 1J0RA 1GT0C 3RYPA 2ZXJA 3LNQA 2JZYA 2VN2A 2F5EA 2VJ4A 2DODA 3A01B 2HDDA 2ICWG 2VB6A 3VYTB 1VQ9I 2RAEA 2E2HJ 1KU3A 3OMYA 5IYBJ 2P4WA 2QVOA 3EPZA 4M9ZA 1EKEA 2LBFA 3OIOA 1B9MA 2HYJA 2M0CA 2L9NA 2BE5F 3BG3A 3FMSA 1SFEA 2VC1A 2AQFA 2ZB9A 3TP3A 2VJIA 3K4NA 4YIRX 5CYVA 3D5LA 3OYHA 4XRSG 1XGOA 5GAHJ 3G1OA 1JHHA 3CP8A 2BHYA 1TWCJ 4IHVA 1RNLA 1TP4A 3H9GA 1FLIA 2LMDA 4V2GA 1UHWA 3HC7A 2E71A 3E3VA 3PFYA 4O5VA 3DQVC 5FKOA 2E1MB 5EGOB 3KZIC 1R58A 4IQ4A 3F23A 1LFPA 5GP9A 2H09A 2DXIA 4XKVA 1B72A 1B6AA 2GXBA 4CYDA 2DOEA 5HOOA 4S0HB 3LOCA 1VQLI 3DCFA 1YS6A 5CVRA 3TW6A 4UVCA 4IZZA 2VOOA 4FX4A 2LY9A 3A01A 1HF0A 1WH5A 1YITI 2GA2A 1W7PB 3AG2H 3QP5A 3NQOA 2RNGA 3QAHA 4G6TB 5D5XB 4BEHB 2H8WA 2JUCA 3OIPA 3H3ZA 4M3FA 2ZKZA 1Y39A 4II3A 3GLXA 2R5ZB 2VQCA 2XVCA 4RGXA 4JK1X 1OCPA 4UB8C 3E5QA 1S72I 3GFLA 1Z1DA 1BJZA 1HCRA 4EM0B 1K6YA 4CGZA 2PMHA 3DF8A 4HAMA 1Z21A 3S15J 1K78B 2LK2A 2M4GA 4HX8A 4L0ZB 2HYFA 2F5FA 1BOAA 3GTGJ 1QPIA 3VFZA 3J81Z 1PVEA 1TL8A 2WC2A 3KCCA 1UHSA 4IF4A 1L3LA 2VIXA 1LDJA 3LA2A 4E4HA 1BR2A 2EV5A 2PBIA 4BQNA 4OIRF 1RKWA 1XB4A 1OFCX 4RS8A 3LFUA 3IH3A 1OR7A 5LHGA 1R9TJ 1W7PA 4P9UA 4P3BA 4BY1J 1HC8A 1YJNI 3OYIA 4AIHA 5FFZA 3C18A 4BEHA 2XROA 3HM5A 4L9VA 2EB7A 5FFXA 3RTRA 3DFGA 2OU2A 2L3DA 1ORKA 3HKZN 4XORA 2I10A 4UVAA 2R5ZA 1F1ZA 1OCCH 1MMAA 2XUBA 3TOBA 1FYLA 4E70A 3CJRB 3OYFA 4EM2A 4QIWN 4XLNF 2COBA 3MZ8A 2BY0A 2XKPA 1I6XA 4Y13A 4WWCA 2RN7A 3OYBA 1MZBA 2LY1A 3BG7A 4AIDA 1OPCA 1DUXC 2KJBA 1X3WB 5DDGA 1X1DA 1OKRA 3HSFA 3ZMZA 1TNTA 2VPRA 3H3VK 1I6HJ 4B43A 1DGWY 4UNOA 4M6YA 1ZR4A 1UJ8A 2HXOA 2RGVA 3J80Z 1A35A 2ACJA 1G2HA 2YU3A 4A3KJ 1PP7U 4HNUA 2K02A 3FBNB 2A61A 3K4JA 3T1BA 4EJUA 2ID6A 2GIZA 4UV8A 2HNHA 4D5CA 2LKPA 1X2NA 4F92B 2KJCA 4KJZA 2JA6J 1S8NA 1ERDA 5E17F 2DJNA 3MKZA 1HDPA 4HG2A 2L7ZA 3K4BA 1W7PD 2M5WA 2LH9A 1P4WA 4B44A 2ELJA 1IRFA 2RNJA 4A6DA 3KLNA 1WI9A 2EA2A 3JTHA 2MC3A 2V1NA 3H5RA 1HA8A 4ENMA 4O6JA 5D6FA 2BW3B 5LEKA 3JRBA 1HSTA 3GTJJ 3V8LA 1UG2A 4EEFG 1YW8A 1Z6TA 2BXYA 2D5VA 2FBIA 5F04A 3A0HC 1JT0A 5HNFA 4KFCA 1ZYRF 3MVPA 4CCLA 1FC3A 1AA7A 3AG3H 1QQIA 4N9HA 3L1PA 3OYKA 3IV5A 1IN7A 1HQCA 5EG0B 4CXFA 4Y33A 1FSEA 4EJWA 3FISA 4MEXF 5H6QA 3EYYA 2IGMA 3G4SI 5E18F 1YYVA 2VC0A 2CMPA 5ED4A 3ABTA 1QZZA 3QRFF 1TWAJ 3DXJF 1O57A 3IH2A 2V9KA 2DW4A 2R92J 2IS1A 4IPAA 5E3OA 1IV8A 2L02A 2YX7A 4J01A 4PGGA 4XR6A 1QBJA 4PJLA 4CCJA 3ML6A 1A6IA 1MBKA 1V4RA 3M3YJ 3ZMDA 1L0OC 2BGCA 2XSJC 3E1SA 1FBSA 3DEEA 2IS4A 1IRGA 4A69C 1OYWA 4BBSJ 3SZGA 2BW3A 4G12A 3GFIA 3KEYA 2KP6A 2R5YB 5CVVA 1B8IA 1YLFA 2CUJA 3DBHB 4CICA 1ETXA 1BN5A 5KK1A 5ICCA 4XRSA 4PK4A 2A5YB 1JJ6C 3ERED 2IT0A 5EG0A 2E19A 1OLTA 2GOXB 2VUMJ 4N4OB 5J40A 1K4TA 3H0GJ 2Z16A 1IUYA 4RB2C 2HQAA 2XPUA 3WTUC 1O3RA 3CMAI 2MA3A 3B6CA 2HVRA 4UUTA 1LVAA 3K9TA 1J2XA 1IZ1A 1Z7UA 4M3GA 4N4NB 5FD6A 4E7LA 2DA5A 1K6OA 5D5WB 3FMQA 4NB5A 4CZZA 1NK2P 4HX4A 2CSOA 4A6EA 2B63J 2KIFA 1IO2A 3I4NJ 2DK8A 2EA4A 3R6SA 2K4BA 1RRJA 2TRTA 2UZKA 3SHFA 3BY6A 1LFBA 2NVYJ 3GLLA 2L9SA 2DA7A 3JW4A 2ZFUA 5FGMA 3EDPA 4L9NA 2R5YA 3MZHA 1MBGA 2CJJA 3F0CA 4BDYA 3K1MA 4P3AA 3IWZA 4PJMA 1KYWA 2M1BA 3GO5A 2RC4A
chains in the Genus database with same CATH topology
4F55A 3MKWB 4ZDOA 4XL9A 1EA3A 3HKZA 5KCMA 2A5WA 3SEZA 3CF2A 2IGNA 4PSWA 2UWMA 2M7AA 2X1EA 4XOPA 4BU2A 4XNFA 1QHGA 3PSFA 3OR2C 4FASD 3FKJA 2RREA 2L7KA 4PJNA 5FRMA 2E60A 4E7KA 3OS2A 3TBIA 2WY7Q 3KX2A 4HPQA 4YELA 3CP2A 1YX3A 1FMWA 1P9QC 2KPMA 4CA0A 4XQFA 4Y3OA 3DPUA 2PJRB 2UV1A 4IX7A 4F93B 4ZYAA 4C2TA 1ZELA 2M3AA 2MFZA 2ZSHB 1PYVA 3VYRB 3OYJA 5HNHA 3IAS2 4XMYA 4DBRA 1W36D 3W2WA 4E7JA 4ZC3A 2WAFA 2M4KA 2MC4A 2MYSA 1PJRA 3OS0A 3DTKA 2AQEA 3VYSB 4DIQA 1NG6A 1YE9A 4QPQA 2HPMA 3UNGC 3W2VA 5LD2C 3ZR8X 4FETA 1D1BA 1QU3A 2Z1DA 2R7SA 1WJEA 4LIVA 3I3LA 1WJAA 4XKCA 3PNYA 4XONA 2LRDA 3K70D 2VASA 2VQHA 4PJJA 4YEJA 1UELB 3L2UA 2CUZA 4PSXA 2X85A 1BR4A 2CW7A 1N77A 4Y4RA 4LG3A 2GOMA 3DKYA 3S3MA 4FXGB 4P5OA 3DU6A 2OUMA 1G59A 2PJRA 4C9YA 4LITA 3CESA 3OYGA 2X51A 3BCBA 3DU5A 4JQFA 3K4CA 3OS1A 2XDVA 2K9LA 3K4KA 3OIQA 2KDOA 2KL4A 2XAUA 2BVLA 3OWTA 4B47A 2IS2A 2W00A 3BCAA 4AVZA 3DTEA 1MMDA 3OYEA 2KHMA 4XLFA 3G2BA 4BJ5C 3I9V2 2I8DA 3A2KA 1LDKB 3K10A 1D0YA 4AU7A 3F9KA 1X1CA 3FHNA 1X1BA 3LSKA 1YX5A 2E1MC 2LBFB 3EUKL 3PJRA 3S3NA 1D1CA 4XN0A 1N75A 2R4GA 4NQWB 4ZDLA 4XLHA 2HPIA 3V42A 1S9HA 3SDBA 4E7IA 2LC2A 2R7XA 2LG4A 4GRIA 4KT6A 1DGRM 4P1WA 2M0MA 5JPMB 2V26A 1Y6IA 4CH7A 1UG0A 2R7QA 4IKFA 2QKLB 1WJFA 1OR7C 3MMYB 2Z2SB 2V7FA 3CMMA 3H9QA 3BG6A 5CQGA 2CW8A 3FDYA 1LKXA 4OAZA 2QKMB 5KHDA 3HPGA 3HXLA 4XKBA 4RM2A 3S93A 2VQLA 4QPOA 2DJIA 2VXZA 3LSIA 4ZJZA 4BUPA 4ITVA 2Q1ZB 1WJDA 3H9JA 2WAEA 1MW7A 2VJ4A 2R7OA 4BE2A 2CV2A 3OYMA 2MABA 1MNDA 4PUSA 4KITB 2LREA 4BE0A 2VB6A 4PFOA 1V5EA 3VYTB 2W82A 5KNLA 4ANJA 2DT7B 4BS9A 3OMYA 3EPZA 3QYEA 4XKWA 2LBFA 3SYTA 1NG7A 2VPLA 2L9NA 2E5NA 2AQFA 3QODA 2VLAA 2VJIA 3K4NA 3OYHA 4BE1A 3D5LA 3ONQA 3L2VA 2LYCA 3C2HA 3DLAA 1E0EA 5TGTA 3CP8A 4E7SA 1BOBA 2VXDA 2UUZA 2W4SA 3H9GA 4HSRA 2X1CA 3DWLE 3HC7A 2BVMA 3TMOA 2XF7A 3PFYA 3DQVC 3PNTA 4ZDPA 1TZLA 3A1YA 4F3QA 2E1MB 2WY8Q 2Q2EB 2WB1A 1R6RA 4BXFA 5HLTA 2O5RA 2OV7A 4II2A 2M7BA 4IQ4A 4J00A 1LFPA 3OYNA 2DXIA 4XKVA 1WFXA 1TT0A 3GBGA 2WADA 3AL0C 2IS6A 5HOOA 4IQJA 3HUGB 4C2UA 4CUGA 3VWBA 1X4OA 4DJAA 2XF5A 3PL8A 4E7HA 3BLYA 1V5GA 2PMZA 4IZZA 1UAAA 3L2RA 2L2OA 2KRHA 2VKDA 3M1CA 2BOLA 1MMNA 1MMGA 2RNGA 4G6TB 2XC7A 4U7BA 2WA0A 3K6GA 4BEHB 3OL3A 2F4IA 3OIPA 2CH0A 4II3A 3PSIA 4XM3A 2VQCA 3UR3C 1MNEA 1SAUA 3S3OA 3HOTA 3LSMA 2JUGA 2W1OA 4LIUA 1D1AA 2WBMA 2DT6A 3DPTA 2JVHA 4B3XA 1K6YA 1Z21A 3LL7A 2LY2A 4XN3A 3QOEA 2M4GA 2VJJA 4HEA2 3LSGA 3ZGKA 4BDZA 3MD2A 4E7ZA 3HL2A 2F6CA 1KONA 4H4KC 3ZXSA 5JHFA 2VIXA 3IUOA 4E4HA 1BR2A 1WJ5A 4BQNA 4CZCA 3M8JA 4D1QA 2CS3A 3LFUA 3VSLA 5LFAA 3DTIA 4B48A 3TL4X 3K4MA 1QHHD 1BR1A 2A6TA 3RPUD 2MD0A 5CQEA 3OYIA 4RLFA 4EATA 3PNVA 1U0JA 4BEHA 4YRVA 2DCEA 3AL0B 3RTRA 3ZQQA 4XORA 4NC8A 3RCOA 2IXSA 1MMAA 4PFPA 2ZXHA 3CJRB 3N05A 4CSWA 3OYFA 3S8PA 1Z3XA 4AYBA 2R7RA 5HVQC 4ZTJA 2CV0A 3OYBA 2HVSA 3E0JB 2LY1A 3BG7A 3EUAA 4F91B 2HU9A 2KQRA 3J7AY 3FBIB 5FRNA 5CKTA 1X1DA 1FMVA 3HPHA 4XLCA 1DQUA 1GLNA 3VYUB 3LMMA 4B43A 1DGWY 4BJTA 2IGKA 3H5NA 4DBQA 3L2WA 4XLEA 4DGWB 3DPLC 3RQ4A 4HNUA 3FBNB 4CCOA 3CZ6A 1W36C 2W7NA 3K4JA 4OAYA 3OL4A 3ZCOA 4R79A 3SEQA 2HNHA 4C30A 3L2QA 4ZTFA 4OWRB 1VZ0A 3HG9A 4F92B 2VJ5A 3RSNA 3U21A 4KJZA 1WJBA 4RLQA 1ERDA 4F52A 3MKZA 2P0WA 3OYDA 4HG2A 3K4BA 3IP4B 2JSPA 2LH9A 4D9JA 4B44A 2ELJA 3LSHA 2HVQA 1X1AA 2X1DA 3OYLA 2X6YA 3H5RA 2V1NA 3H35A 3BC8A 3D5SC 3K70C 1HA8A 3AFHA 2R7TA 4XOTA 2BW3B 4E6KG 1LVKA 3AKZA 3A4CA 5HNFA 1Y56A 3H0DA 4CCLA 1AA7A 3OR1C 3OYKA 4HNTA 3H5AA 4Y33A 2IGMA 2F5VA 4RMNA 2E5ZA 2X6XA 2CMPA 3KYLA 2R7UA 4NNJA 4X0GA 2WAQA 2HZDA 3S32A 2V9KA 2IS1A 1V5FA 2CFOA 4J01A 1JI8A 4XR6A 3DKXA 3QYFA 3VDXA 1T95A 4RM3A 2R7WA 3W3CA 4PJLA 4CCJA 4CCNA 3NWTA 2JA2A 2FUG2 2NOJB 2OC6A 4JOMA 1T0FC 2ZXIA 2R7VA 3OY9A 2XSJC 3E1SA 2JVGA 4BACA 3DEEA 2IS4A 5FROA 4KISA 1J09A 3SZGA 2BW3A 3KEYA 2KP6A 2KLOA 2X6WA 3C2GA 1X4PA 1Z3YA 2CUJA 4U87A 2XF6A 2L5QA 1DP3A 2V4JC 2VKHA 4PK4A 2VL8A 3EUHC 2KZVA 4CCMA 1OLTA 2GOXB 1WJCA 4BGDA 2KMUA 4N4OB 2V6EA 2K5CA 2VQGA 2K9MA 2Z16A 3W2AA 4NC7A 2RQQA 1SFKA 2DOAA 1G8XA 2HQAA 3ZRGA 2HVRA 3PUBA 1X19A 4DOZA 3D5RC 3QYBA 3MKYB 4HRIA 3OOUA 3OYAA 4CCKA 4N4NB 4E7LA 5CPRB 2K3PA 4HSTA 1D0XA 1Z7LA 2KRCA 1D0ZA 3VSKA 3K4LA 4XLAA 1N78A 2IGOA 4BQOA 2CV1A 3OYCA 1IRXA 2HDWA 2Y0SA 2L9SA 2ZSIB 2LOOA 2ZFUA 3IAM2 4BJ6C 3HOSA 4MLOA 3CJQB 4BL0B 3NWSA 4BDYA 4NUBA 4PJMA 4BQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D9J A;  3MD2 A;  1AA7 A;  5CQE A;  4ITV A;  1EA3 A;  4IQ4 A;  4PUS A;  3VDX A;  2Z16 A; 
#chains in the Genus database with same CATH topology
 1AKH A;  2OCE A;  1EA3 A;  2A5W A;  3MZY A;  3HTU A;  4W1U A;  2X1E A;  2R93 J;  1EV7 A;  2LF8 A;  4XOP A;  2XPW A;  5F1J A;  5FLM J;  2WB1 N;  2QUF A;  3G3Z A;  2V6C A;  2ECB A;  2H94 A;  3OR2 C;  3PSF A;  1O3T A;  1A04 A;  2L7K A;  4PJN A;  1FX7 A;  5IYD J;  2E60 A;  3CCM I;  4FTH A;  2O8K A;  3GME A;  3CUQ B;  3IC7 A;  1Z6R A;  4Q47 A;  9ANT A;  4WB2 A;  4YEL A;  3TED A;  1SEU A;  3RDI A;  1MIJ A;  3CP2 A;  2LLK A;  1P9Q C;  3DPU A;  4NQW A;  2PLY A;  1BI3 A;  2M3A A;  2MFZ A;  3TO6 A;  4P9F A;  3WU0 A;  4XMY A;  2A6H F;  1KU9 A;  5TRD A;  2EIM H;  2MC4 A;  1Y8Q B;  1PJR A;  3ZN1 A;  2R0Q C;  2KT0 A;  1XGN A;  3MN2 A;  3OS0 A;  2XSD C;  4D0P A;  3ECH A;  1D5Y A;  1NG6 A;  1YE9 A;  3PFI A;  5F0C A;  2L9R A;  3FM5 A;  3I64 A;  4DZP A;  3IH4 A;  4OIP F;  2MSY A;  4M72 A;  1RC9 A;  1YS7 A;  1WJE A;  3RKX A;  1WJA A;  4XKC A;  1WPK A;  3R4K A;  2LRD A;  1WVR A;  2VQH A;  2H8R A;  1O3Q A;  3GFM A;  3L2U A;  1TBX A;  2A6E F;  4EJO A;  4RB3 C;  1BJA A;  2ETH A;  1XDU A;  2EFW A;  3WTY C;  3CUQ A;  2LKS A;  3TDU C;  3S3M A;  4P5O A;  2ADU A;  2FXA A;  3DU6 A;  1Q1H A;  2PI0 A;  4MTE A;  1RKT A;  3BCB A;  4JX4 A;  4L5I A;  2QSG X;  3TOA A;  1EJ9 A;  1YTY A;  4B47 A;  2K9N A;  2UXN A;  4C2M J;  2VKE A;  2O8X A;  2XAH A;  4GYI A;  4FCY A;  2KHM A;  3K2A A;  3G2B A;  1SD4 A;  2XAS A;  2K9S A;  3I9V 2;  4C3I J;  2NVT J;  1LDK B;  5JI6 A;  1S7E A;  1R1V A;  5JHU A;  3CLO A;  2Y9Z A;  2FX0 A;  4YFN F;  3GVA A;  2M34 A;  3LSK A;  1YX5 A;  2E1M C;  3ABM H;  3P9C A;  4HA8 A;  1ETO A;  1VQN I;  1H8A C;  1D1C A;  4XN0 A;  1GVJ A;  2E36 A;  2R4G A;  1ETQ A;  1BW5 A;  4P39 A;  2W24 A;  2X6O A;  1S9H A;  3I59 B;  4I98 B;  3ZQ7 A;  4E7I A;  2LC2 A;  1WHU A;  3TQN A;  4KT6 A;  4BKX A;  3A0B C;  4L5E A;  4IRG A;  4GXO A;  2XPV A;  1DGR M;  2M0M A;  1T2K A;  2V26 A;  5M3F J;  2W57 A;  2ID3 A;  2R7Q A;  3GX4 X;  3HSE A;  1OR7 C;  1FPQ A;  1Y1V J;  2QSF X;  3H9Q A;  1R1U A;  2V7F A;  1YRN B;  2NVU B;  4Y52 J;  2COM A;  4UUS A;  1CF7 B;  3TGN A;  2NS7 A;  3HXL A;  5K1Y A;  4RM2 A;  1F5T A;  2K86 A;  3M07 A;  3S93 A;  4QPO A;  4RAY A;  3ABL H;  4ZJZ A;  4S04 A;  3GTO J;  4HV6 A;  4ITV A;  1AU7 A;  2QQ8 A;  3I5U A;  5IY5 H;  3TO9 A;  4HDU A;  3LST A;  1Y1W J;  5FLV A;  3E97 A;  3PM1 A;  2BXZ A;  3F8F A;  4BE2 A;  2ELK A;  4BE0 A;  1V5E A;  5KNL A;  2E34 A;  2L7F P;  1O7F A;  1YJW I;  4XKW A;  1H88 C;  4JBA A;  2VPL A;  2GXG A;  3CMY A;  2Y0M A;  2E5N A;  3QU3 A;  1JT6 A;  2LYC A;  3RKY A;  4PDK A;  2DT5 A;  2JA7 J;  5LHI A;  2XIG A;  1CQT A;  2XAG A;  1BOB A;  2VXD A;  4FE4 A;  2UUZ A;  2W4S A;  4AVP A;  4H0E A;  3HRU A;  2WAQ N;  4HOB A;  1XCB A;  4WK8 F;  3BOQ A;  3IRR A;  2DU9 A;  3SJM A;  4OOI A;  3G71 I;  2FSW A;  1YRN A;  4D5F A;  2M8E A;  4II2 A;  5M3M J;  3I55 I;  4A3J J;  5JLW A;  1B1B A;  1REP C;  2J5O A;  3M9A A;  5HLG A;  1WFX A;  1TT0 A;  3E5U A;  2ZJQ F;  3HOY J;  3GBG A;  2LTP A;  2WAD A;  2VT3 A;  2IS6 A;  4IQJ A;  3I56 I;  3S2D J;  5JPN B;  4A3B J;  2N8G A;  3VOE A;  1C5A A;  4AIK A;  3VWB A;  1X4O A;  2VKV A;  2PEX A;  3RKW A;  4DJA A;  5GAG J;  1BC7 C;  3BLY A;  1V5G A;  3JTG A;  2L2O A;  2DQR A;  2EZK A;  5F1R A;  1Z67 A;  1R4N B;  3WTX C;  3RPU A;  3E6C C;  2BOL A;  2IAI A;  3O3K A;  4I6Z A;  1ZRD A;  5AIQ A;  1P7I A;  4A5M A;  1ETK A;  4G8X A;  2WA0 A;  3K6G A;  2HTJ A;  1W0U A;  2KIQ A;  3OL3 A;  2MLK A;  5IP9 J;  1HKT A;  3CCE I;  1PP8 F;  3LQR A;  3M4O J;  3BRO A;  4CDG A;  2ZME B;  1MNE A;  2GA1 A;  2EIJ H;  5DV5 A;  3S3O A;  3RI4 A;  3AG1 H;  5C4J J;  2JUG A;  4LIU A;  3AG4 H;  2WBM A;  4HYE A;  3DPT A;  2ME0 A;  1ETY A;  1I3A A;  2JVH A;  4B3X A;  4I99 C;  3HOV J;  1BC8 C;  2G7U A;  1G3Y A;  1S7O A;  1V54 H;  4FXK B;  1IUF A;  4HEA 2;  2O61 A;  5GPA A;  1IC8 A;  2XB5 A;  4BDZ A;  4G7O F;  4L0Y B;  1POG A;  3FXR A;  3V4G A;  4GO1 A;  3HL2 A;  2F6C A;  3H3U A;  1QZE A;  1MBJ A;  3R0A A;  2AHQ A;  2X9D A;  2EZI A;  3COA C;  2Y0S N;  5D5V B;  4D1Q A;  2CS3 A;  5DM7 F;  1LPQ A;  2Y2Z A;  3TL4 X;  2M2E A;  4A3C J;  1R00 A;  2PX9 A;  3RPU D;  1WCM J;  2MD0 A;  4RLF A;  4EAT A;  4WXH A;  1XSV A;  1U5T B;  3PNV A;  1RUN A;  5E79 C;  1SVL A;  2V1X A;  4AIJ A;  1P4A A;  3R0J A;  1HSJ A;  4YII A;  2XGC A;  3CLQ A;  2ZME A;  3RCO A;  3GYH X;  2JWT A;  1T38 A;  3I58 A;  3N05 A;  4LLL A;  3CDH A;  3X2Q H;  1F4K A;  3S8P A;  1Z3X A;  4AYB A;  3DEW A;  2R7R A;  3BZC A;  5IOY A;  5HVQ C;  2GLO A;  3JRA A;  1B72 B;  2H27 A;  3PO3 J;  2QM3 A;  1QZY A;  1IF1 A;  1XMK A;  1V3F A;  2PQ8 A;  3HEF A;  2DA1 A;  1TWG J;  5JVT A;  1XMX A;  3NEU A;  4XLC A;  3VYU B;  4BJT A;  2P5K A;  3SZT A;  3H5N A;  2EIL H;  4XLE A;  2G7H A;  4DGW B;  1FP1 D;  4CCO A;  2OCC H;  3CZ6 A;  1TLH B;  4UXN A;  3PQJ A;  3K69 A;  3I54 A;  2ESH A;  1JKP C;  2QGU A;  2ZJ2 A;  4R79 A;  4C30 A;  2G0E A;  1YFH A;  1T56 A;  3FHZ A;  4OWR B;  1VZ0 A;  3HHH A;  3HSR A;  4EVI A;  1GHC A;  2FOW A;  3U21 A;  5B5E C;  1WJB A;  1H89 C;  1IGN A;  2KRF A;  2Y48 A;  5D8K B;  4S05 A;  3Q0U A;  2V9P A;  3OYD A;  1U5T A;  4KUM A;  3J80 K;  3CCS I;  1ZAR A;  4A5N A;  4A3D J;  2X1D A;  1X1A A;  1XS9 A;  2STW A;  2X6Y A;  3WG7 H;  1K83 J;  2R7T A;  5GPC A;  1FP2 A;  2W84 A;  4HLY A;  4BHC A;  3V7C A;  1YQA A;  3RQI A;  1OMI A;  4U0Y A;  2IA0 A;  3K7A J;  3AKZ A;  3HHG A;  1MJA A;  1W0T A;  5JFR A;  2UXX A;  3ELK A;  4XRM A;  1Y56 A;  2EIK H;  3H0D A;  3HRT A;  1IN4 A;  1IDY A;  2FQ3 A;  1E3O C;  3ZQL A;  1QGP A;  5DD4 A;  2KIS A;  1XG1 A;  4Z6Y A;  2FD5 A;  2OZ6 A;  2F5V A;  2F5D A;  5EF6 A;  4X6A J;  3KYL A;  1KJS A;  2JT1 A;  5BNG A;  4NNJ A;  4UY8 I;  4X0G A;  3IHU A;  5EZH A;  4IXA A;  1GXP A;  4A3F J;  3S32 A;  2OPT A;  4KDP A;  3QOP A;  1JI8 A;  3VDX A;  2R7F A;  1VTN C;  2NAZ A;  3Q9S A;  1RPW A;  2KIU A;  1I27 A;  4HW5 A;  3FZV A;  3E6D A;  4NDL A;  1P2F A;  3CCL I;  4ON0 A;  4JOM A;  5EYR A;  2P6T A;  1YW9 A;  2ZXI A;  2R7V A;  3OY9 A;  2EBI A;  3CCV I;  4BAC A;  5K7Z A;  4ESJ A;  3JRI A;  1ZRC A;  3QQA A;  3KP4 A;  1Z3Y A;  3QPS A;  2BZT A;  1R23 A;  4U87 A;  4EGY A;  4L9J A;  3ISP A;  5AON A;  3HTS B;  3CUQ C;  1LE8 B;  1ZTR A;  3V7R A;  3BQY A;  2VKH A;  3MAJ A;  1WGX A;  2B7E A;  4HF0 A;  3K1P A;  4ASN A;  5JLX A;  3M1E A;  1BW6 A;  2Z99 A;  3CC4 I;  2KMU A;  2V6E A;  2VQG A;  2ZNZ A;  2ELH A;  1SFK A;  2DOA A;  1HOM A;  4UV9 A;  1LFU P;  2YUS A;  3ZRG A;  1YIJ I;  3GTQ J;  1KQ9 A;  3V7S A;  2EWN A;  5M5X J;  4AM3 A;  3FF5 A;  5DEQ A;  4HRI A;  3SXY A;  2K9Q A;  3OYA A;  2Y30 A;  3BG9 A;  3NAU A;  3KLO A;  3LAP A;  2K3P A;  1FOX A;  1Z7L A;  2ZJR F;  1D0Z A;  3VSK A;  1ZLK A;  5CLS A;  2QZ8 A;  4A0X A;  2MW8 A;  1N78 A;  4BQO A;  3SFZ A;  2CV1 A;  1PUE E;  2MGQ A;  3MCZ A;  5L3B A;  4KIC A;  4I0B A;  1IRX A;  2HDW A;  4WXD A;  2LOO A;  1TQP A;  2GAU A;  2K85 A;  3IAM 2;  2DTR A;  4BJ6 C;  3KZZ A;  4MLO A;  2CQN A;  3CJQ B;  4BL0 B;  4BQQ A;  2AS5 F;  1VI0 A;  4F55 A;  1LE8 A;  1RIO H;  4ZYD A;  4BBR J;  1ZGW A;  1SVM A;  3HKZ A;  4LB5 A;  3BPV A;  3SEZ A;  2UWM A;  2IGN A;  1IRZ A;  1OYI A;  1U8R A;  2M7A A;  3OSF A;  2DA4 A;  2DMQ A;  4ZYE A;  2K7L A;  1MSF C;  3E5X A;  1W5C C;  4XNF A;  3OOP A;  5K7H A;  1QHG A;  5F27 A;  2G9W A;  4FT8 A;  2YPR A;  4FAS D;  3FKJ A;  3LSR A;  2HZT A;  2RRE A;  3JR9 A;  3E6B A;  3TDZ C;  1GV2 A;  3GCM A;  2HQR A;  3OS2 A;  5E8G A;  2JA5 J;  3FWE A;  4OU0 A;  2WY7 Q;  4HPQ A;  3WTT C;  4FHT A;  4A3G J;  3WTW C;  1ZAO A;  2PJR B;  2ZXW H;  3C7J A;  2PMZ N;  4ZYA A;  3KZY A;  4C2T A;  1B8I B;  4OMZ A;  1TQI A;  3S1R J;  3CQZ J;  3OYJ A;  1Q1V A;  4XRF A;  3KET A;  4HQM A;  4DYQ A;  3IWF A;  1A31 A;  3R60 A;  5EEH A;  5C4X J;  1YOV B;  2LDU A;  4EM1 A;  2M45 A;  4ZC3 A;  2XHK A;  3WGH A;  4F7Z A;  2MYS A;  2DQL A;  1X58 A;  1G3T A;  3DTK A;  2AQE A;  3F6V A;  1Z77 A;  2MG4 A;  3PO2 J;  2DA6 A;  4A0Y A;  2ISZ A;  4QPQ A;  5LGN A;  5F6F A;  4IHW A;  2KKO A;  2HPM A;  2HOT A;  3KEQ A;  2DA3 A;  4A3E J;  3PUF A;  1QU3 A;  1W4M A;  4LIV A;  2QBY B;  4TV7 A;  4B3A A;  2EV0 A;  4XON A;  2VAS A;  5J1U A;  5HOD A;  2Q8K A;  1IXS B;  4PJJ A;  2CQK A;  5D4S A;  3L7W A;  4MEY F;  4IHX A;  4PSX A;  2X85 A;  5ILV A;  3JCU C;  2KDZ A;  5A2Q K;  4Y4R A;  1GXQ A;  5LEJ A;  4FXG B;  1IDZ A;  2FBK A;  3S16 J;  1VQP I;  2PJR A;  3F72 A;  4LIT A;  2LF7 A;  2Z9O A;  4U7D A;  3CES A;  2X51 A;  1NK3 P;  4C3H J;  3DU5 A;  1XGM A;  4JQF A;  2XDV A;  2K9L A;  1IV6 A;  3S2W A;  1AKH B;  2LNB A;  2XAU A;  4IOA F;  2DPD A;  2E35 A;  5HS7 A;  3DTE A;  4L5J A;  3OYE A;  4XLF A;  2DFE A;  4LFU A;  5E3L A;  1U2W A;  4N9I A;  1D0Y A;  2HOA A;  1MSE C;  5FD5 A;  3DBR B;  3ZMT A;  1FSH A;  4ZZD A;  3CU7 A;  1X1C A;  3HOU J;  2CG4 A;  3ASO H;  3LA3 A;  3CCJ I;  1WH7 A;  2QBY A;  2CYY A;  3KP2 A;  4IJA A;  3EUK L;  5FKK A;  3PJR A;  3S2H J;  2GBY A;  1M1E B;  2IPQ X;  4HV5 A;  2GIV A;  4NQW B;  4ZDL A;  1C0W A;  4M73 A;  2HPI A;  3V42 A;  2Z5U A;  1BI0 A;  1HXD A;  4GRI A;  1ZH5 A;  5BS6 A;  4AC0 A;  1UZC A;  1BI2 A;  4P1W A;  2VT2 A;  2CQQ A;  1UG0 A;  2EPF A;  2DMN A;  1HBX G;  2CFX A;  3HOX J;  1RES A;  2DA2 A;  3BG6 A;  4B4C A;  3FDY A;  1LKX A;  3HIF A;  5HDG A;  1SAN A;  2QEN A;  2VQL A;  3LSJ A;  1S29 A;  5IPA A;  2NVQ J;  1ZN2 A;  2VXZ A;  5KAF C;  1E3P A;  2QF7 A;  4RAZ A;  1XTA A;  1QNT A;  5CJ9 A;  4BUP A;  3E7L A;  2ZME C;  1Y0U A;  2Q1Z B;  2FA5 A;  2F2E A;  4M3B A;  2CGP A;  1RR7 A;  5FJ8 J;  2RVC A;  2WAE A;  1MW7 A;  3BR5 A;  3OYM A;  3CDL A;  2MAB A;  1MND A;  2D1H A;  3GF2 A;  4DW6 A;  1N25 A;  3WG9 A;  4MFE A;  4ANJ A;  1DP7 P;  3KLS A;  4BS9 A;  2TCT A;  3QYE A;  2DLL A;  3SYT A;  1NG7 A;  1U3E M;  1HKS A;  2XGE A;  1OCO H;  1W5T A;  2DBB A;  5TJJ A;  4Y15 A;  1P4X A;  4Q48 A;  2M87 A;  3WHC A;  3DLA A;  2VBY A;  4ZYG A;  4WF2 A;  5TGT A;  3S1Q J;  4E7S A;  3C2B A;  1OCR H;  1AHD P;  2NS0 A;  3SFI A;  1R22 A;  4HSR A;  1DPR A;  1TW2 A;  2X1C A;  3DWL E;  4RB0 A;  5J4Y A;  6PAX A;  1P6R A;  2BVM A;  2XF7 A;  1TZL A;  2JN6 A;  3K1N A;  4M6X A;  5FO5 A;  2WY8 Q;  4F3Q A;  1WSU A;  2QCO A;  2WB1 A;  1R6R A;  2IVM A;  2O0Y A;  4BXF A;  5HLT A;  2O5R A;  1GDT A;  1R5G A;  2E1C A;  5A2Q Z;  3K2Z A;  3OYN A;  1U5T C;  5IT3 A;  3W6V A;  4IRH A;  5HDK A;  5HLH A;  1J59 A;  3GXO A;  3U1K A;  4C2U A;  4CUG A;  2VBZ A;  3LFK A;  2XF5 A;  3PL8 A;  2GQQ A;  4RA2 A;  1VQO I;  4I09 A;  1UAA A;  3JAM K;  3JRF A;  3L2R A;  2KRH A;  2VKD A;  1FYM A;  4BNC A;  3GWZ A;  2FNP A;  3BWG A;  1P7J A;  2DMU A;  3BJ6 A;  4U0V A;  2FF4 A;  1MMN A;  5F0F A;  1H9T A;  1MMG A;  4I2O A;  2XC7 A;  2F4I A;  1ZR2 A;  3ZQF A;  1D5V A;  1O7L A;  3VEP A;  3WOD F;  5EDN A;  4HLX A;  2XGD A;  1LJ9 A;  1ZHF A;  4UUS B;  3F22 A;  4DZJ A;  2ECC A;  2HKO A;  3WHB A;  3WTS C;  5KAI C;  2DT6 A;  2W25 A;  2STT A;  4LMY A;  1R71 A;  2Z3Y A;  5HS9 A;  3PIP F;  3QPH A;  2HR3 A;  4XN3 A;  3GFJ A;  2DFF A;  2FU4 A;  3ESW B;  4KNY A;  3HB9 A;  4E7Z A;  3QU6 A;  5LGU A;  3M7G A;  5GTI C;  3T0Y A;  1MGT A;  3ZQG A;  3F8N A;  3ZXS A;  1QA6 A;  2A3S A;  3KEO A;  3KP6 A;  4Y7N J;  2X0L A;  4CZC A;  1DU6 A;  2E7W A;  2DK5 A;  2DMT A;  3VSL A;  1FEX A;  3DTI A;  3G1M A;  3IKT A;  5L3G A;  1QHH D;  1BR1 A;  1ON1 A;  2KFD A;  4LG0 A;  4IVN A;  3PIO F;  4G7Z F;  2A6T A;  5CQE A;  1MJ9 A;  5FB2 A;  1JHF A;  4YRV A;  5LBQ A;  4G6Q A;  2DCE A;  3AL0 B;  3SDG A;  3ZQQ A;  4M9X A;  3L00 A;  1Z9C A;  2ZXH A;  1I3Q J;  1IN8 A;  3BQZ A;  3NAR A;  4A3M J;  3S17 J;  3N4M A;  4ZTJ A;  3CUO A;  4V2F A;  3IKV A;  5E3N A;  2LD5 A;  2L01 A;  2HVS A;  3E0J B;  4F91 B;  3BG5 A;  1Y0N A;  2GWR A;  2HU9 A;  2KQR A;  2L4M A;  4ENJ A;  3J7A Y;  1QPM A;  4HX7 A;  4M6V A;  3FIW A;  2JQ7 A;  5IP7 J;  1FMV A;  3KP7 A;  3HPH A;  3O8G A;  2H6B A;  2Q0O A;  2IGK A;  1YI2 I;  4JX5 A;  4DBQ A;  4FX0 A;  3UKG A;  2E2J J;  3H92 A;  3RQ4 A;  4LJZ F;  1RI7 A;  2P81 A;  2W7N A;  2NXN B;  4OAY A;  3DKW A;  2ISY A;  3OL4 A;  4XSZ F;  4ZTF A;  2A05 A;  3ZN0 A;  2MD5 A;  1ETV A;  2VJ5 A;  5GAE J;  1MNM C;  3E6M A;  2IW5 A;  4DYR A;  4XIC A;  2M30 A;  2D2W A;  1TC3 C;  1MH4 A;  2XRL A;  5M5W J;  1FWZ A;  2L4A A;  3TKY A;  1O4X A;  2O3F A;  3IP4 B;  4PZJ A;  2JSP A;  4D9J A;  2LSO A;  2OA4 A;  2DFH A;  3LSH A;  5J8F A;  2HVQ A;  3JAM Z;  4LK0 F;  1S3J A;  3BR2 A;  4KN7 X;  2D45 A;  1R7J A;  2EZH A;  3AFH A;  1W1W E;  4I76 A;  1J5Y A;  1VQ6 I;  3TP0 A;  4XK4 A;  2QWW A;  1XPX A;  1FOW A;  3HDD A;  1IXR C;  5J8C A;  3OR1 C;  1P92 A;  3P9I A;  4HW0 A;  1JUS A;  1MD0 A;  2V1D A;  2VOD A;  4QSH A;  3H5A A;  3HOZ J;  2F48 A;  2QEX I;  3PQK A;  1SVO A;  3DP7 A;  3JSO A;  4RMN A;  4ZH4 F;  2E5Z A;  1XSD A;  2X6X A;  2Y69 H;  3CCU I;  2R7U A;  3BTL A;  2ZJP F;  2WAQ A;  2HZD A;  3LAJ A;  1BA5 A;  1K61 A;  1GUU A;  4UUV A;  2CFO A;  2M9H A;  3DKX A;  5LRR A;  1USS A;  1T95 A;  2R7W A;  3I71 A;  5FKL A;  1YG2 A;  5JR3 A;  4FIS A;  2L0K A;  4CCN A;  3U1D A;  2JA2 A;  5E1W A;  1HLV A;  2OC6 A;  3KFW X;  1X2M A;  2V79 A;  1JE8 A;  2FMY A;  3ZP5 A;  3WU2 C;  4MHG A;  2JVG A;  3OSG A;  4KIS A;  2RQP A;  1J09 A;  4MTD A;  2KLO A;  3C2G A;  1X4P A;  2P6S A;  1XGS A;  3ZPL A;  1B9N A;  1LEB A;  5J3L A;  1CGP A;  2XF6 A;  2L5Q A;  1UB9 A;  3C3W A;  1T8I A;  3WU1 B;  1X1P A;  4OIN F;  2XAJ A;  2V4J C;  4MO7 A;  2JPC A;  2VL8 A;  2KZV A;  5B66 C;  1ZGA A;  4CCM A;  2DI3 A;  1NHA A;  2QQ9 A;  3I0T A;  4IO9 F;  3CJN A;  1NH3 A;  2K9M A;  3QPL A;  2F4M B;  4I0A A;  3W2A A;  1FNN A;  4HZF A;  4WCG A;  5L3D A;  4AWX B;  5C44 J;  2EFP A;  4QLC U;  3MKY B;  4DNC A;  5LGT A;  2F4O B;  4CCK A;  4GYG A;  5CPR B;  2YX4 A;  4HST A;  1D0X A;  1FJL A;  3ZMU A;  1HW1 A;  3WTZ A;  2FML A;  2KRC A;  2H1K A;  1FTZ A;  3K4L A;  3FXU A;  2IGO A;  1BI1 A;  2WV0 A;  2R7D A;  3B73 A;  5EEA A;  2P5L C;  3DBL B;  5L3C A;  1X3U A;  3FKI J;  2Y0S A;  4O3M A;  1D8J A;  2ZSI B;  2K3F A;  3S1M J;  1JGS A;  3LWF A;  3N97 A;  3BR3 A;  3HOS A;  3RZO J;  5CVI A;  3BZK A;  2NRA C;  3NWS A;  4KN4 X;  2IA1 A;  4FE7 A;  3KE2 A;  3REO A;  1KGS A;  4ZDO A;  2BY3 A;  4RDU A;  1DDN A;  4ABZ A;  4XL9 A;  5BPD A;  5E20 A;  3CDI A;  3F8B A;  2DPU A;  3CF2 A;  2Y31 A;  5J4V A;  3M8F A;  1ODD A;  1FIA A;  4R8H A;  4BU2 A;  3ZQC A;  1FBU A;  3S14 J;  3RJP A;  3JRG A;  3GEZ A;  3H36 A;  1DU0 A;  1Z05 A;  4RAF A;  3HYI A;  2WWY A;  3TO7 A;  5TIS C;  4ZZL A;  5CVU A;  3MEX A;  2O03 A;  3P9K A;  1B4A A;  4EV0 A;  1FMW A;  2KPM A;  4CA0 A;  1LDD A;  2GZW A;  4Y3O A;  2UV1 A;  3MFK A;  3H1C A;  1STZ A;  5HLI A;  3GTL J;  1RR8 C;  1ZEL A;  4GCV A;  5E1Z B;  1U9N A;  2CQ7 A;  4BYY A;  3M8E A;  4RGS A;  3GZN B;  1W36 D;  3W2W A;  2HI3 A;  4E7J A;  1SFO J;  2M4K A;  5LLQ A;  1LNW A;  5IT9 K;  3B02 A;  2CW0 F;  3BJA A;  3HRM A;  1R5I D;  2PFB A;  3ABK H;  4DIQ A;  5DTD A;  3KPH A;  1H0M A;  5B1A H;  1QVT A;  2O7O A;  3UNG C;  3W2V A;  5LD2 C;  3ZR8 X;  2CQX A;  1D3Y A;  2DTZ A;  1ZQ3 P;  1T0F A;  2Z1D A;  3KYC B;  3P5J A;  4IHT A;  4BXX J;  2R7S A;  1V55 H;  5J1Y A;  2OTJ I;  2LKX A;  3PNY A;  1VQ4 I;  3LQQ A;  3K70 D;  2EQR A;  4MQ9 F;  2NS8 A;  3VB2 A;  1UEL B;  2CUZ A;  4YG2 F;  3FXO A;  5DUI A;  3A03 A;  3TW7 A;  1BR4 A;  3AAF A;  1J9I A;  1ENH A;  1FZP B;  2VE9 A;  1VQK I;  4LG3 A;  2HWV A;  1MJB A;  1T08 B;  5D8L B;  1SD7 A;  3EUH A;  1VQ8 I;  2HEO A;  2OUM A;  1G59 A;  1TW3 A;  2NNN A;  2H1L A;  1KU7 A;  2D1V A;  5F0H A;  5D6E A;  4WXC A;  3FK6 A;  2W48 A;  3K4C A;  3OS1 A;  4EJT A;  1FTT A;  4P96 A;  5DUK A;  2KDO A;  1WI3 A;  2KL4 A;  2BVL A;  2IS2 A;  4A0Z A;  1JXS A;  4BAY A;  2W00 A;  5FKM A;  1KA8 A;  1J7K A;  1JTY A;  1OIS A;  1JGG A;  1MMD A;  3BJO A;  3Q3S A;  1SD6 A;  3JRH A;  5LHH A;  4JYK A;  5EGO A;  1LUJ B;  2K40 A;  4BJ5 C;  2MH9 A;  3MKL A;  1EH8 A;  1IN5 A;  2A07 F;  2E7X A;  3FHN A;  3GTM J;  3CO7 C;  2ZO4 A;  4D7M A;  1MBH A;  5E8I A;  3S3N A;  3DLL F;  1BIB A;  1N75 A;  3GUD A;  2V1U A;  1EH7 A;  3DEU A;  1K79 A;  4KIF A;  3SDB A;  2R7X A;  2LG4 A;  5E3M A;  3RKQ A;  1SC7 A;  2DN0 A;  4UVB A;  4CH7 A;  3IRQ A;  2QKL B;  2CO5 A;  1VND A;  2BYV E;  1R5H A;  2NYX A;  3ECO A;  3MMY B;  1WZ2 A;  3ROU A;  1Z0X A;  3GW2 A;  1T39 A;  4OAZ A;  1YIO A;  2R7Z J;  3BTI A;  3A02 A;  4XKB A;  1FOY A;  2QA4 I;  1SAX A;  3CF5 F;  4A93 J;  3OV8 A;  2O9L A;  3ULQ B;  2DJI A;  1R49 A;  3LSI A;  4HF2 A;  3I4P A;  2YU9 J;  1K78 A;  1WJD A;  2EFN A;  4G94 A;  2QYO A;  3ZQI A;  3H9J A;  3FXK A;  4LLG F;  1MDM B;  4ENN A;  2R7O A;  2CV2 A;  5LRS A;  1XSX A;  1Y8R B;  1UFM A;  2LRE A;  4LOC A;  2VBW A;  3FXM A;  4PUS A;  4PFO A;  3T8R A;  4KIT B;  4RAG A;  4CO8 A;  2W82 A;  5IYC J;  2DT7 B;  4M3E A;  1LB2 A;  2X48 A;  5IT9 Z;  1GVD A;  3J7Z I;  1NTC A;  3VOD A;  1RET A;  1BL0 A;  2EK5 A;  1T98 A;  1ZG1 A;  2E1N A;  2EFQ A;  4WX9 A;  5H20 A;  1KYZ A;  3QOD A;  2VLA A;  3CJT B;  3G6E I;  3MWM A;  3ONQ A;  4BE1 A;  3L2V A;  3C2H A;  2Z33 A;  1E0E A;  3JRC A;  4L9T A;  3B6A A;  1APL C;  1A6Q A;  1UHM A;  1SMT A;  4HQE A;  3SZP A;  4HF1 A;  2K27 A;  1MBF A;  4D7N A;  3TMO A;  2DOF A;  1YW7 A;  2C6Y A;  3PNT A;  4ZDP A;  4EMS A;  3A1Y A;  1MH3 A;  2Q2E B;  1BBY A;  4XLP F;  1VQ7 I;  2OV7 A;  4J00 A;  2M7B A;  3BTJ A;  4LK1 F;  5ICE A;  1U9O A;  2BY2 A;  2IP2 A;  3AL0 C;  2IJL A;  4KIB A;  3WGI A;  2HYG D;  2FQ4 A;  3HUG B;  4A3I J;  4IL6 C;  4ZYH A;  1ZRF A;  2DAO A;  2KZG A;  4E7H A;  2PMZ A;  1MDM A;  2E1O A;  5GAD J;  2WV1 A;  3M1C A;  4WB3 A;  3F6O A;  2FEZ A;  2HKX A;  2BV6 A;  5IOZ A;  1ZG5 A;  3ASN H;  2P8T A;  1TNS A;  3K0L A;  4U7B A;  1ZGJ A;  5ILS A;  2CH0 A;  3JRD A;  3PSI A;  3FM3 A;  2LVS A;  4XM3 A;  3UR3 C;  4HWJ A;  5IP6 A;  1GV5 A;  5K7F A;  1MBE A;  1SAU A;  1OCZ H;  4NC6 A;  1CFA A;  4C3J J;  3HOT A;  3LSM A;  3RYR A;  2W1O A;  1D1A A;  1OQY A;  3GZ5 A;  4UU9 C;  5B1B H;  4HBL A;  1JKR C;  3F8M A;  1G6N A;  1S6L A;  1LQ1 A;  2PJP A;  3LL7 A;  2QQB A;  2LY2 A;  2Q2E A;  5DCM B;  3QOE A;  2DMP A;  2VJJ A;  5DD8 A;  5FKN A;  2XAQ A;  2CU7 A;  2MLG A;  3LSG A;  4L18 B;  3KP5 A;  4RGU A;  3ZGK A;  3MD2 A;  4IRI A;  5EZG A;  3F8C A;  3O6B B;  1KON A;  4H4K C;  3T8T A;  1FIP A;  2DDB A;  5JHF A;  1D8K A;  3HUG A;  4U0W A;  3IUO A;  1WJ5 A;  3QWL A;  2HFH A;  3M8J A;  1XMA A;  3FXL A;  4DQ2 A;  2OQR A;  2VI6 A;  2ZNY A;  2CRG A;  3F21 A;  4U88 A;  5LFA A;  1FBQ A;  2FE3 A;  4B48 A;  2OQG A;  3K4M A;  4UHT A;  5BOX A;  3CO6 C;  4OIQ F;  4QWQ A;  4KT5 C;  1U0J A;  4BXU A;  4ESB A;  2OTL I;  4PCQ A;  4MIM A;  2ZCW A;  3WTV C;  4M71 A;  2VON A;  2HXI A;  2JK3 A;  2VBX A;  4Y17 A;  3HQB A;  4MNU A;  4NC8 A;  1IAW A;  2E2I J;  1UMQ A;  2IXS A;  4GGG A;  3J7A O;  1KZH A;  4PFP A;  2IEK A;  4CSW A;  3GZ6 A;  4Q4Z F;  4BH9 A;  4ETS A;  2XB0 X;  1KU2 A;  2BEO A;  1U8B A;  2W85 A;  1IJW C;  2CV0 A;  3HOW J;  3V8K A;  1TWF J;  1FYK A;  1SMY F;  2QSH X;  1R1T A;  3RPQ A;  3EUA A;  3U2R A;  2EH3 A;  1PDN C;  3FBI B;  5FRN A;  1SFU A;  5DCM A;  5CKT A;  2EFO A;  3P7N A;  5E1X A;  4M3D A;  2DYS H;  1O3S A;  1DQU A;  1GLN A;  1VFC A;  2A73 B;  3LMM A;  1AOY A;  1QVU A;  4V19 K;  4A2U A;  2P7V B;  3L2W A;  3DPL C;  4HNV A;  5K5O A;  2OAZ A;  4K2E A;  4RBO A;  2ESN A;  1W36 C;  4JP0 A;  2B0L A;  2OD5 A;  2LFB A;  3ZCO A;  1F43 A;  2OZU A;  4PJ0 C;  3SEQ A;  1F36 A;  1R36 A;  3L2Q A;  3HG9 A;  3RSN A;  2HOE A;  3SQN A;  3G73 A;  1HW2 A;  4RLQ A;  5ICG A;  4HDV A;  5FLX K;  4F52 A;  2RKH A;  3ZMS A;  3I53 A;  2P0W A;  5K5Q A;  2ZC2 A;  5AIP A;  5DS9 A;  3OYL A;  4GDF A;  4W97 A;  2BHZ A;  3GTP J;  3H35 A;  3K70 C;  1YJ9 I;  3BC8 A;  3D5S C;  3L9F A;  1F9N A;  3V8J A;  4XOT A;  1XX5 A;  4J19 A;  3HZJ A;  4E6K G;  1LVK A;  2I5U A;  1KQ8 A;  3A4C A;  1JTX A;  2CWE A;  3L2C A;  1XC5 A;  1DPU A;  4HNT A;  2HTS A;  2DFI A;  4KYW A;  1K4S A;  1I50 J;  5GTH C;  2HQN A;  4RGR A;  2MH2 A;  4LG0 B;  1IN6 A;  1H9G A;  1Z91 A;  3DV8 A;  5C3E J;  2NVX J;  3GTK J;  4LB6 B;  2M8G X;  2IRF G;  1XDS A;  3U9G A;  1ONV A;  1MKM A;  2NOG A;  2YSR A;  1TTY A;  1I1G A;  1V5F A;  3BR0 A;  3O8H A;  2LP0 A;  2R3S A;  3QYF A;  1ETW A;  4RM3 A;  3W3C A;  1ZKG A;  1KQ0 A;  3HBL A;  1JJ8 C;  3EET A;  3BPX A;  4BHP A;  3JSP A;  3NWT A;  2IBD A;  2XKO A;  4I02 A;  4UB6 C;  3W6K B;  3R61 A;  2P7C B;  4IHS A;  2FUG 2;  2NOJ B;  3LA7 A;  1T0F C;  3ERM A;  1UCR A;  1ULY A;  2IA2 A;  3HJE A;  4YIF A;  2YR2 A;  5FRO A;  5D5U B;  3JRE A;  3ABU A;  4A12 A;  2X6W A;  1HDD C;  4CHU A;  2HS5 A;  3FX3 A;  3J7Y J;  1S7A A;  1DP3 A;  5BQT A;  3EYI A;  2DDA A;  4KIG A;  4XSX F;  3VPR A;  1ACI A;  1IG7 A;  1E2X A;  4LGW A;  4RB1 A;  3EUH C;  4MFD A;  4R1H A;  3BR6 A;  3C1D A;  1TWH J;  2RDP A;  3Q9V A;  1W5S A;  1WJC A;  3ZMV A;  1HW5 A;  4BGD A;  4LD5 A;  1JKO C;  3ZQH A;  4BHB A;  2K5C A;  3D0S A;  5EJC A;  1A36 A;  4NC7 A;  2RQQ A;  1VQ5 I;  1JUM A;  1G8X A;  2QQA A;  4G9Y A;  2AXL A;  2Y75 A;  4BY7 J;  4OIO F;  3PUB A;  1X19 A;  4DOZ A;  3D5R C;  1SD5 A;  2PG4 A;  4CYC B;  2HDC A;  3QYB A;  3QPT A;  5H2F C;  3OOU A;  1HKQ A;  3Q0V A;  3BR1 A;  1B59 A;  2FRH A;  1VQM I;  2F5C A;  4I7H A;  1G4D A;  2ME6 A;  2ZFW A;  4B1R A;  3EQL F;  1JKQ C;  4XLA A;  2LR8 A;  3I4M J;  5F08 A;  1K7A A;  3OYC A;  4KA4 A;  2JMW A;  3CC7 I;  3KYD B;  4OMY A;  3WE2 A;  2OBP A;  3L09 A;  5FLX Z;  5L3E A;  2A68 F;  3FXQ A;  1PUF B;  2XV4 S;  4IOC F;  1U78 A;  4M74 A;  2OJE D;  1A5J A;  4NUB A;  4ESF A;  4N0B A;  2HQ5 A;  2XRN A;  4B09 A;  4EQQ A;  3MKW B;  4NHJ A;  2JA8 J;  2B39 A;  3O2P E;  3NRV A;  1EH6 A;  5J6X A;  3LSP A;  2B9S A;  4AUX A;  5BMZ A;  4Q5S F;  5KCM A;  2K4J A;  3MQ0 A;  4G6D A;  5F64 A;  1YO5 C;  4PSW A;  4MGR A;  5DM6 F;  1S5L C;  2GM4 A;  1ZK8 A;  1I39 A;  1XD7 A;  5ICF A;  1IXC A;  3HGG A;  2L54 A;  2PMU A;  3W6J B;  2FJ1 A;  3D1N I;  1WQ2 A;  3RIR A;  2JRM A;  2XAF A;  5FRM A;  4CYC A;  2EJR A;  4E7K A;  3TBI A;  3BZ6 A;  2DO7 A;  1R4M B;  3FMR A;  3KX2 A;  5M5Y J;  2WTE A;  2OF7 A;  1J75 A;  4FQG A;  1YX3 A;  5BPI A;  4XQF A;  4G7H F;  4P55 A;  4IX7 A;  3BDD A;  2EV6 A;  4AD9 A;  4F93 B;  3IL2 A;  1XN7 A;  2H6C A;  3FK7 A;  3S1N J;  2BBY A;  5HS8 A;  4QTR A;  3I59 A;  2ZSH B;  1PYV A;  2Y9Y A;  5EEG A;  3VYR B;  1MMS A;  1ZLJ A;  4BQA A;  2JJ7 A;  4B8X A;  5HNH A;  4Z2Y A;  3IAS 2;  2FBH A;  4JX6 A;  3CME I;  1OYY A;  4DBR A;  3HRS A;  5DYM A;  1PUF A;  2WAF A;  1TT5 B;  1RZ4 A;  3WE3 A;  5CVJ A;  1T6S A;  5L3F A;  3VYS B;  1EF4 A;  2FNA A;  2QLZ A;  1CF7 A;  2ZBK A;  1OJL A;  4KMF A;  1E17 A;  1JUP A;  3G1L A;  1WKM A;  3CCQ I;  3HGY A;  4FET A;  1D1B A;  2V9V A;  5D4R A;  3HQA A;  4KMU X;  5J1R A;  3I3L A;  3CCY A;  2AXT C;  3CC2 I;  2AO9 A;  3QP6 A;  2HOS A;  1OCT C;  3BT9 A;  4YEJ A;  1FOK A;  2CW7 A;  2KIM A;  1X3Z B;  1N77 A;  2GOM A;  3BP8 A;  3DKY A;  3F3X A;  3KP3 A;  3RZD J;  2BY1 A;  1BM9 A;  2EZL A;  4C9Y A;  1VF9 A;  2FOK A;  2P5V A;  3T5X A;  4YFK F;  4A3L J;  3OYG A;  1SFX A;  5K5R A;  1LEA A;  5JVG F;  2A69 F;  4DYC A;  2X4H A;  3K4K A;  3OIQ A;  3OWT A;  2HGC A;  5H6R A;  3BCA A;  5ERI A;  4I6O A;  4IHY A;  1E3H A;  1IW7 F;  1UST A;  3CTA A;  1AWC A;  4AVZ A;  2MBF A;  2DYR H;  3FXJ A;  1QO0 D;  4YFX F;  3Q5F A;  1G3W A;  2JRT A;  2L9V A;  2I8D A;  3A2K A;  3K10 A;  4AU7 A;  4IEJ A;  4AYB N;  2L7M P;  3F9K A;  4ENK A;  1RUO A;  4PGH A;  4EGZ A;  3KIO A;  3CD6 I;  4XBF A;  1WWX A;  2JTV A;  2TDX A;  3CCR I;  1X1B A;  1ZG3 A;  2VOP A;  2CUE A;  3ZOB A;  2LBF B;  1T33 A;  5B4P B;  1BIA A;  1WRJ A;  1QRY A;  4M9S A;  5KVR A;  2J5P A;  1FT9 A;  4I01 A;  1G3S A;  4XLH A;  2JSC A;  4MQV A;  5HDN A;  1I5Z A;  2CUF A;  1I1S A;  4X1E A;  1FY7 A;  1TQM A;  3WGG A;  4LLN A;  3Q0W A;  2XGX A;  3J81 K;  2RV8 A;  1YHQ I;  2GXA A;  5JPM B;  2PN6 A;  1Y6I A;  4IKF A;  1WJF A;  5DCF A;  2O6G E;  2Z2S B;  4GFB A;  3CMM A;  2NNY A;  5CQG A;  5B3S H;  5J47 A;  2CW8 A;  2JPB A;  1ZRE A;  1U6G A;  5ILU A;  4EJV A;  2QKM B;  5KHD A;  3HPG A;  2YS9 A;  1ON2 A;  4NBQ A;  3BTC A;  4XID A;  1XCV A;  2VE8 A;  2EIN H;  1ITY A;  1J0R A;  1GT0 C;  3RYP A;  2ZXJ A;  3LNQ A;  2JZY A;  2VN2 A;  2F5E A;  2VJ4 A;  2DOD A;  3A01 B;  2HDD A;  2ICW G;  2VB6 A;  3VYT B;  1VQ9 I;  2RAE A;  2E2H J;  1KU3 A;  3OMY A;  5IYB J;  2P4W A;  2QVO A;  3EPZ A;  4M9Z A;  1EKE A;  2LBF A;  3OIO A;  1B9M A;  2HYJ A;  2M0C A;  2L9N A;  2BE5 F;  3BG3 A;  3FMS A;  1SFE A;  2VC1 A;  2AQF A;  2ZB9 A;  3TP3 A;  2VJI A;  3K4N A;  4YIR X;  5CYV A;  3D5L A;  3OYH A;  4XRS G;  1XGO A;  5GAH J;  3G1O A;  1JHH A;  3CP8 A;  2BHY A;  1TWC J;  4IHV A;  1RNL A;  1TP4 A;  3H9G A;  1FLI A;  2LMD A;  4V2G A;  1UHW A;  3HC7 A;  2E71 A;  3E3V A;  3PFY A;  4O5V A;  3DQV C;  5FKO A;  2E1M B;  5EGO B;  3KZI C;  1R58 A;  4IQ4 A;  3F23 A;  1LFP A;  5GP9 A;  2H09 A;  2DXI A;  4XKV A;  1B72 A;  1B6A A;  2GXB A;  4CYD A;  2DOE A;  5HOO A;  4S0H B;  3LOC A;  1VQL I;  3DCF A;  1YS6 A;  5CVR A;  3TW6 A;  4UVC A;  4IZZ A;  2VOO A;  4FX4 A;  2LY9 A;  3A01 A;  1HF0 A;  1WH5 A;  1YIT I;  2GA2 A;  1W7P B;  3AG2 H;  3QP5 A;  3NQO A;  2RNG A;  3QAH A;  4G6T B;  5D5X B;  4BEH B;  2H8W A;  2JUC A;  3OIP A;  3H3Z A;  4M3F A;  2ZKZ A;  1Y39 A;  4II3 A;  3GLX A;  2R5Z B;  2VQC A;  2XVC A;  4RGX A;  4JK1 X;  1OCP A;  4UB8 C;  3E5Q A;  1S72 I;  3GFL A;  1Z1D A;  1BJZ A;  1HCR A;  4EM0 B;  1K6Y A;  4CGZ A;  2PMH A;  3DF8 A;  4HAM A;  1Z21 A;  3S15 J;  1K78 B;  2LK2 A;  2M4G A;  4HX8 A;  4L0Z B;  2HYF A;  2F5F A;  1BOA A;  3GTG J;  1QPI A;  3VFZ A;  3J81 Z;  1PVE A;  1TL8 A;  2WC2 A;  3KCC A;  1UHS A;  4IF4 A;  1L3L A;  2VIX A;  1LDJ A;  3LA2 A;  4E4H A;  1BR2 A;  2EV5 A;  2PBI A;  4BQN A;  4OIR F;  1RKW A;  1XB4 A;  1OFC X;  4RS8 A;  3LFU A;  3IH3 A;  1OR7 A;  5LHG A;  1R9T J;  1W7P A;  4P9U A;  4P3B A;  4BY1 J;  1HC8 A;  1YJN I;  3OYI A;  4AIH A;  5FFZ A;  3C18 A;  4BEH A;  2XRO A;  3HM5 A;  4L9V A;  2EB7 A;  5FFX A;  3RTR A;  3DFG A;  2OU2 A;  2L3D A;  1ORK A;  3HKZ N;  4XOR A;  2I10 A;  4UVA A;  2R5Z A;  1F1Z A;  1OCC H;  1MMA A;  2XUB A;  3TOB A;  1FYL A;  4E70 A;  3CJR B;  3OYF A;  4EM2 A;  4QIW N;  4XLN F;  2COB A;  3MZ8 A;  2BY0 A;  2XKP A;  1I6X A;  4Y13 A;  4WWC A;  2RN7 A;  3OYB A;  1MZB A;  2LY1 A;  3BG7 A;  4AID A;  1OPC A;  1DUX C;  2KJB A;  1X3W B;  5DDG A;  1X1D A;  1OKR A;  3HSF A;  3ZMZ A;  1TNT A;  2VPR A;  3H3V K;  1I6H J;  4B43 A;  1DGW Y;  4UNO A;  4M6Y A;  1ZR4 A;  1UJ8 A;  2HXO A;  2RGV A;  3J80 Z;  1A35 A;  2ACJ A;  1G2H A;  2YU3 A;  4A3K J;  1PP7 U;  4HNU A;  2K02 A;  3FBN B;  2A61 A;  3K4J A;  3T1B A;  4EJU A;  2ID6 A;  2GIZ A;  4UV8 A;  2HNH A;  4D5C A;  2LKP A;  1X2N A;  4F92 B;  2KJC A;  4KJZ A;  2JA6 J;  1S8N A;  1ERD A;  5E17 F;  2DJN A;  3MKZ A;  1HDP A;  4HG2 A;  2L7Z A;  3K4B A;  1W7P D;  2M5W A;  2LH9 A;  1P4W A;  4B44 A;  2ELJ A;  1IRF A;  2RNJ A;  4A6D A;  3KLN A;  1WI9 A;  2EA2 A;  3JTH A;  2MC3 A;  2V1N A;  3H5R A;  1HA8 A;  4ENM A;  4O6J A;  5D6F A;  2BW3 B;  5LEK A;  3JRB A;  1HST A;  3GTJ J;  3V8L A;  1UG2 A;  4EEF G;  1YW8 A;  1Z6T A;  2BXY A;  2D5V A;  2FBI A;  5F04 A;  3A0H C;  1JT0 A;  5HNF A;  4KFC A;  1ZYR F;  3MVP A;  4CCL A;  1FC3 A;  1AA7 A;  3AG3 H;  1QQI A;  4N9H A;  3L1P A;  3OYK A;  3IV5 A;  1IN7 A;  1HQC A;  5EG0 B;  4CXF A;  4Y33 A;  1FSE A;  4EJW A;  3FIS A;  4MEX F;  5H6Q A;  3EYY A;  2IGM A;  3G4S I;  5E18 F;  1YYV A;  2VC0 A;  2CMP A;  5ED4 A;  3ABT A;  1QZZ A;  3QRF F;  1TWA J;  3DXJ F;  1O57 A;  3IH2 A;  2V9K A;  2DW4 A;  2R92 J;  2IS1 A;  4IPA A;  5E3O A;  1IV8 A;  2L02 A;  2YX7 A;  4J01 A;  4PGG A;  4XR6 A;  1QBJ A;  4PJL A;  4CCJ A;  3ML6 A;  1A6I A;  1MBK A;  1V4R A;  3M3Y J;  3ZMD A;  1L0O C;  2BGC A;  2XSJ C;  3E1S A;  1FBS A;  3DEE A;  2IS4 A;  1IRG A;  4A69 C;  1OYW A;  4BBS J;  3SZG A;  2BW3 A;  4G12 A;  3GFI A;  3KEY A;  2KP6 A;  2R5Y B;  5CVV A;  1B8I A;  1YLF A;  2CUJ A;  3DBH B;  4CIC A;  1ETX A;  1BN5 A;  5KK1 A;  5ICC A;  4XRS A;  4PK4 A;  2A5Y B;  1JJ6 C;  3ERE D;  2IT0 A;  5EG0 A;  2E19 A;  1OLT A;  2GOX B;  2VUM J;  4N4O B;  5J40 A;  1K4T A;  3H0G J;  2Z16 A;  1IUY A;  4RB2 C;  2HQA A;  2XPU A;  3WTU C;  1O3R A;  3CMA I;  2MA3 A;  3B6C A;  2HVR A;  4UUT A;  1LVA A;  3K9T A;  1J2X A;  1IZ1 A;  1Z7U A;  4M3G A;  4N4N B;  5FD6 A;  4E7L A;  2DA5 A;  1K6O A;  5D5W B;  3FMQ A;  4NB5 A;  4CZZ A;  1NK2 P;  4HX4 A;  2CSO A;  4A6E A;  2B63 J;  2KIF A;  1IO2 A;  3I4N J;  2DK8 A;  2EA4 A;  3R6S A;  2K4B A;  1RRJ A;  2TRT A;  2UZK A;  3SHF A;  3BY6 A;  1LFB A;  2NVY J;  3GLL A;  2L9S A;  2DA7 A;  3JW4 A;  2ZFU A;  5FGM A;  3EDP A;  4L9N A;  2R5Y A;  3MZH A;  1MBG A;  2CJJ A;  3F0C A;  4BDY A;  3K1M A;  4P3A A;  3IWZ A;  4PJM A;  1KYW A;  2M1B A;  3GO5 A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 4F55 A;  3MKW B;  4ZDO A;  4XL9 A;  1EA3 A;  3HKZ A;  5KCM A;  2A5W A;  3SEZ A;  3CF2 A;  2IGN A;  4PSW A;  2UWM A;  2M7A A;  2X1E A;  4XOP A;  4BU2 A;  4XNF A;  1QHG A;  3PSF A;  3OR2 C;  4FAS D;  3FKJ A;  2RRE A;  2L7K A;  4PJN A;  5FRM A;  2E60 A;  4E7K A;  3OS2 A;  3TBI A;  2WY7 Q;  3KX2 A;  4HPQ A;  4YEL A;  3CP2 A;  1YX3 A;  1FMW A;  1P9Q C;  2KPM A;  4CA0 A;  4XQF A;  4Y3O A;  3DPU A;  2PJR B;  2UV1 A;  4IX7 A;  4F93 B;  4ZYA A;  4C2T A;  1ZEL A;  2M3A A;  2MFZ A;  2ZSH B;  1PYV A;  3VYR B;  3OYJ A;  5HNH A;  3IAS 2;  4XMY A;  4DBR A;  1W36 D;  3W2W A;  4E7J A;  4ZC3 A;  2WAF A;  2M4K A;  2MC4 A;  2MYS A;  1PJR A;  3OS0 A;  3DTK A;  2AQE A;  3VYS B;  4DIQ A;  1NG6 A;  1YE9 A;  4QPQ A;  2HPM A;  3UNG C;  3W2V A;  5LD2 C;  3ZR8 X;  4FET A;  1D1B A;  1QU3 A;  2Z1D A;  2R7S A;  1WJE A;  4LIV A;  3I3L A;  1WJA A;  4XKC A;  3PNY A;  4XON A;  2LRD A;  3K70 D;  2VAS A;  2VQH A;  4PJJ A;  4YEJ A;  1UEL B;  3L2U A;  2CUZ A;  4PSX A;  2X85 A;  1BR4 A;  2CW7 A;  1N77 A;  4Y4R A;  4LG3 A;  2GOM A;  3DKY A;  3S3M A;  4FXG B;  4P5O A;  3DU6 A;  2OUM A;  1G59 A;  2PJR A;  4C9Y A;  4LIT A;  3CES A;  3OYG A;  2X51 A;  3BCB A;  3DU5 A;  4JQF A;  3K4C A;  3OS1 A;  2XDV A;  2K9L A;  3K4K A;  3OIQ A;  2KDO A;  2KL4 A;  2XAU A;  2BVL A;  3OWT A;  4B47 A;  2IS2 A;  2W00 A;  3BCA A;  4AVZ A;  3DTE A;  1MMD A;  3OYE A;  2KHM A;  4XLF A;  3G2B A;  4BJ5 C;  3I9V 2;  2I8D A;  3A2K A;  1LDK B;  3K10 A;  1D0Y A;  4AU7 A;  3F9K A;  1X1C A;  3FHN A;  1X1B A;  3LSK A;  1YX5 A;  2E1M C;  2LBF B;  3EUK L;  3PJR A;  3S3N A;  1D1C A;  4XN0 A;  1N75 A;  2R4G A;  4NQW B;  4ZDL A;  4XLH A;  2HPI A;  3V42 A;  1S9H A;  3SDB A;  4E7I A;  2LC2 A;  2R7X A;  2LG4 A;  4GRI A;  4KT6 A;  1DGR M;  4P1W A;  2M0M A;  5JPM B;  2V26 A;  1Y6I A;  4CH7 A;  1UG0 A;  2R7Q A;  4IKF A;  2QKL B;  1WJF A;  1OR7 C;  3MMY B;  2Z2S B;  2V7F A;  3CMM A;  3H9Q A;  3BG6 A;  5CQG A;  2CW8 A;  3FDY A;  1LKX A;  4OAZ A;  2QKM B;  5KHD A;  3HPG A;  3HXL A;  4XKB A;  4RM2 A;  3S93 A;  2VQL A;  4QPO A;  2DJI A;  2VXZ A;  3LSI A;  4ZJZ A;  4BUP A;  4ITV A;  2Q1Z B;  1WJD A;  3H9J A;  2WAE A;  1MW7 A;  2VJ4 A;  2R7O A;  4BE2 A;  2CV2 A;  3OYM A;  2MAB A;  1MND A;  4PUS A;  4KIT B;  2LRE A;  4BE0 A;  2VB6 A;  4PFO A;  1V5E A;  3VYT B;  2W82 A;  5KNL A;  4ANJ A;  2DT7 B;  4BS9 A;  3OMY A;  3EPZ A;  3QYE A;  4XKW A;  2LBF A;  3SYT A;  1NG7 A;  2VPL A;  2L9N A;  2E5N A;  2AQF A;  3QOD A;  2VLA A;  2VJI A;  3K4N A;  3OYH A;  4BE1 A;  3D5L A;  3ONQ A;  3L2V A;  2LYC A;  3C2H A;  3DLA A;  1E0E A;  5TGT A;  3CP8 A;  4E7S A;  1BOB A;  2VXD A;  2UUZ A;  2W4S A;  3H9G A;  4HSR A;  2X1C A;  3DWL E;  3HC7 A;  2BVM A;  3TMO A;  2XF7 A;  3PFY A;  3DQV C;  3PNT A;  4ZDP A;  1TZL A;  3A1Y A;  4F3Q A;  2E1M B;  2WY8 Q;  2Q2E B;  2WB1 A;  1R6R A;  4BXF A;  5HLT A;  2O5R A;  2OV7 A;  4II2 A;  2M7B A;  4IQ4 A;  4J00 A;  1LFP A;  3OYN A;  2DXI A;  4XKV A;  1WFX A;  1TT0 A;  3GBG A;  2WAD A;  3AL0 C;  2IS6 A;  5HOO A;  4IQJ A;  3HUG B;  4C2U A;  4CUG A;  3VWB A;  1X4O A;  4DJA A;  2XF5 A;  3PL8 A;  4E7H A;  3BLY A;  1V5G A;  2PMZ A;  4IZZ A;  1UAA A;  3L2R A;  2L2O A;  2KRH A;  2VKD A;  3M1C A;  2BOL A;  1MMN A;  1MMG A;  2RNG A;  4G6T B;  2XC7 A;  4U7B A;  2WA0 A;  3K6G A;  4BEH B;  3OL3 A;  2F4I A;  3OIP A;  2CH0 A;  4II3 A;  3PSI A;  4XM3 A;  2VQC A;  3UR3 C;  1MNE A;  1SAU A;  3S3O A;  3HOT A;  3LSM A;  2JUG A;  2W1O A;  4LIU A;  1D1A A;  2WBM A;  2DT6 A;  3DPT A;  2JVH A;  4B3X A;  1K6Y A;  1Z21 A;  3LL7 A;  2LY2 A;  4XN3 A;  3QOE A;  2M4G A;  2VJJ A;  4HEA 2;  3LSG A;  3ZGK A;  4BDZ A;  3MD2 A;  4E7Z A;  3HL2 A;  2F6C A;  1KON A;  4H4K C;  3ZXS A;  5JHF A;  2VIX A;  3IUO A;  4E4H A;  1BR2 A;  1WJ5 A;  4BQN A;  4CZC A;  3M8J A;  4D1Q A;  2CS3 A;  3LFU A;  3VSL A;  5LFA A;  3DTI A;  4B48 A;  3TL4 X;  3K4M A;  1QHH D;  1BR1 A;  2A6T A;  3RPU D;  2MD0 A;  5CQE A;  3OYI A;  4RLF A;  4EAT A;  3PNV A;  1U0J A;  4BEH A;  4YRV A;  2DCE A;  3AL0 B;  3RTR A;  3ZQQ A;  4XOR A;  4NC8 A;  3RCO A;  2IXS A;  1MMA A;  4PFP A;  2ZXH A;  3CJR B;  3N05 A;  4CSW A;  3OYF A;  3S8P A;  1Z3X A;  4AYB A;  2R7R A;  5HVQ C;  4ZTJ A;  2CV0 A;  3OYB A;  2HVS A;  3E0J B;  2LY1 A;  3BG7 A;  3EUA A;  4F91 B;  2HU9 A;  2KQR A;  3J7A Y;  3FBI B;  5FRN A;  5CKT A;  1X1D A;  1FMV A;  3HPH A;  4XLC A;  1DQU A;  1GLN A;  3VYU B;  3LMM A;  4B43 A;  1DGW Y;  4BJT A;  2IGK A;  3H5N A;  4DBQ A;  3L2W A;  4XLE A;  4DGW B;  3DPL C;  3RQ4 A;  4HNU A;  3FBN B;  4CCO A;  3CZ6 A;  1W36 C;  2W7N A;  3K4J A;  4OAY A;  3OL4 A;  3ZCO A;  4R79 A;  3SEQ A;  2HNH A;  4C30 A;  3L2Q A;  4ZTF A;  4OWR B;  1VZ0 A;  3HG9 A;  4F92 B;  2VJ5 A;  3RSN A;  3U21 A;  4KJZ A;  1WJB A;  4RLQ A;  1ERD A;  4F52 A;  3MKZ A;  2P0W A;  3OYD A;  4HG2 A;  3K4B A;  3IP4 B;  2JSP A;  2LH9 A;  4D9J A;  4B44 A;  2ELJ A;  3LSH A;  2HVQ A;  1X1A A;  2X1D A;  3OYL A;  2X6Y A;  3H5R A;  2V1N A;  3H35 A;  3BC8 A;  3D5S C;  3K70 C;  1HA8 A;  3AFH A;  2R7T A;  4XOT A;  2BW3 B;  4E6K G;  1LVK A;  3AKZ A;  3A4C A;  5HNF A;  1Y56 A;  3H0D A;  4CCL A;  1AA7 A;  3OR1 C;  3OYK A;  4HNT A;  3H5A A;  4Y33 A;  2IGM A;  2F5V A;  4RMN A;  2E5Z A;  2X6X A;  2CMP A;  3KYL A;  2R7U A;  4NNJ A;  4X0G A;  2WAQ A;  2HZD A;  3S32 A;  2V9K A;  2IS1 A;  1V5F A;  2CFO A;  4J01 A;  1JI8 A;  4XR6 A;  3DKX A;  3QYF A;  3VDX A;  1T95 A;  4RM3 A;  2R7W A;  3W3C A;  4PJL A;  4CCJ A;  4CCN A;  3NWT A;  2JA2 A;  2FUG 2;  2NOJ B;  2OC6 A;  4JOM A;  1T0F C;  2ZXI A;  2R7V A;  3OY9 A;  2XSJ C;  3E1S A;  2JVG A;  4BAC A;  3DEE A;  2IS4 A;  5FRO A;  4KIS A;  1J09 A;  3SZG A;  2BW3 A;  3KEY A;  2KP6 A;  2KLO A;  2X6W A;  3C2G A;  1X4P A;  1Z3Y A;  2CUJ A;  4U87 A;  2XF6 A;  2L5Q A;  1DP3 A;  2V4J C;  2VKH A;  4PK4 A;  2VL8 A;  3EUH C;  2KZV A;  4CCM A;  1OLT A;  2GOX B;  1WJC A;  4BGD A;  2KMU A;  4N4O B;  2V6E A;  2K5C A;  2VQG A;  2K9M A;  2Z16 A;  3W2A A;  4NC7 A;  2RQQ A;  1SFK A;  2DOA A;  1G8X A;  2HQA A;  3ZRG A;  2HVR A;  3PUB A;  1X19 A;  4DOZ A;  3D5R C;  3QYB A;  3MKY B;  4HRI A;  3OOU A;  3OYA A;  4CCK A;  4N4N B;  4E7L A;  5CPR B;  2K3P A;  4HST A;  1D0X A;  1Z7L A;  2KRC A;  1D0Z A;  3VSK A;  3K4L A;  4XLA A;  1N78 A;  2IGO A;  4BQO A;  2CV1 A;  3OYC A;  1IRX A;  2HDW A;  2Y0S A;  2L9S A;  2ZSI B;  2LOO A;  2ZFU A;  3IAM 2;  4BJ6 C;  3HOS A;  4MLO A;  3CJQ B;  4BL0 B;  3NWS A;  4BDY A;  4NUB A;  4PJM A;  4BQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...