4PUSA

Crystal structure of influenza a virus matrix protein m1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
HSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 1
publication title Crystal structures of influenza a virus matrix protein m1: variations on a theme.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 54
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4pusA02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 4pusA01
1AA7A 4D9JA 4ITVA 4PUSA 2Z16A 4IQ4A 3VDXA 1EA3A 5CQEA 3MD2A
chains in the Genus database with same CATH superfamily
3ZN0A 2RV8A 2AXTC 3AAFA 5BOXA 4WK8F 1XDSA 1VQ6I 4OAZA 5JHUA 3SEZA 4O3MA 2BW3B 1YE9A 1HSJA 1I39A 3OYGA 1Z6RA 4M6YA 3NWTA 2HYGD 4EJWA 4E7SA 2BZTA 1HF0A 4WXDA 1T0FA 2O03A 2W85A 3EUHC 1Z9CA 2QWWA 3F0CA 4P9FA 3L7WA 3KEQA 3J7AO 1IRFA 1V5EA 2V9VA 5J4VA 3TDZC 3S15J 2PJPA 2MGQA 2YX7A 4G7OF 1QU3A 2BEOA 5BNGA 2LY1A 3FF5A 1Y8RB 3OYBA 3JREA 2VXDA 1D5YA 2BOLA 2K4JA 1K4SA 3OIOA 5CQEA 2IA1A 5DM6F 3F23A 3CO7C 3J7YJ 5DS9A 3OYNA 2W7NA 1FOKA 3ZN1A 3I5UA 2IA2A 2RNJA 1OPCA 3J81Z 3H36A 3SHFA 3CF5F 2Y48A 4GXOA 1YX5A 3ZMVA 3KPHA 3V7CA 4P9UA 1E3OC 1IG7A 3M4OJ 2PJRA 3ECOA 4I99C 3RKYA 4LIUA 4EM0B 1WJFA 2QM3A 1HBXG 4EVIA 1N77A 1KONA 1LPQA 3F6OA 2R7ZJ 2M1BA 4UV8A 3S1RJ 2A68F 3CDHA 4Y52J 2Y0SA 3L2VA 4JOMA 2COMA 4KUMA 1MMGA 3FWEA 4EGZA 3KLOA 1WPKA 4HA8A 2CH0A 2H8WA 1ZLKA 2JA8J 1IRGA 2CFOA 2DTRA 2DLLA 2R5YB 4M6XA 5CVJA 3E3VA 1QHGA 4LG0B 4HBLA 1O3SA 4XLEA 2GM4A 1YS7A 2LKPA 3HJEA 1HQCA 3G71I 3BJAA 2CRGA 3TGNA 4OINF 1K79A 4IEJA 3LL7A 3CCEI 1BJZA 1NG7A 4Q48A 2E5NA 2KZGA 2M4GA 2IS1A 1J9IA 4BXXJ 2DMPA 2FQ4A 1DPRA 4XLNF 3KLSA 2FX0A 4Y4RA 2E1CA 3LSRA 3QP6A 1TWFJ 1LDKB 3JRAA 1R49A 1UZCA 3VODA 1E0EA 4ZYDA 2CW8A 1ONVA 3BDDA 1OLTA 4II2A 3FXMA 1IRZA 2M3AA 1XS9A 2M2EA 5HDGA 3SXYA 5C4XJ 3FM3A 1R9TJ 2VN2A 4CZZA 3EYIA 2EZLA 3H0GJ 2XAQA 2RDPA 2X6OA 1W36D 1FTZA 4CCMA 1MBFA 2F5VA 4XKCA 3V8LA 1RR7A 2WV1A 2BY2A 5K7ZA 3E6MA 1OQYA 2KLOA 4A3LJ 1USSA 1XGMA 2FSWA 1RIOH 2E71A 2MH2A 3WTXC 4XOPA 1YS6A 3OYFA 3IRQA 3RZOJ 3KP3A 3KX2A 3JSOA 2OZUA 1FLIA 3GZ6A 4HSTA 4HF2A 3HOZJ 3K4LA 4MHGA 4IF4A 4U7DA 3LSIA 5E18F 4C3JJ 4F92B 5JLXA 1MSEC 1IN8A 3D5LA 4C3IJ 3HIFA 3IKVA 2R7RA 1Y1WJ 1FY7A 1K6OA 1GDTA 4A3DJ 1R5ID 2A6TA 2K5CA 1EJ9A 2HXIA 2MH9A 1TT0A 3HOWJ 1B59A 2CUEA 2MC3A 5F1RA 1HLVA 3EYYA 4QPOA 2GAUA 3PO3J 2K02A 1S72I 1STZA 4D5CA 4QIWN 5KAIC 5EZGA 5FKOA 4IHSA 4EEFG 2VE8A 5FROA 1OKRA 3DBLB 4WXCA 2IRFG 4GYIA 4YIFA 2LRDA 2HNHA 3G73A 3A03A 2VI6A 2LD5A 1X1DA 3ZQHA 5DCFA 4AVPA 4ZTJA 3A1YA 2JK3A 1K78A 2VASA 2DMUA 3MMYB 4L5EA 2AHQA 2O7OA 2X85A 3DCFA 2KZVA 4NC7A 3MCZA 3ZMUA 3TP3A 5HLTA 1RKWA 3ZGKA 1HDDC 4B09A 2WB1A 4U87A 3ZP5A 2QQAA 3BCAA 1SVLA 1WJAA 3MD2A 4A5NA 3QPTA 1BI2A 4G6QA 2VPLA 4HNUA 4HWJA 2XPUA 1R00A 1ZGJA 2DJNA 3DPLC 3IH4A 2ZJPF 4RAFA 1ZG3A 3PNTA 4BH9A 1B8IA 5DTDA 3GEZA 3WGHA 3BTIA 4HEA2 3RQ4A 3ZQ7A 1TC3C 4CCOA 5JVTA 1JXSA 5LRSA 1EA3A 1LDJA 4AU7A 2EFNA 3ABMH 1PDNC 4CH7A 4CYCB 2CQQA 4FXGB 2CWEA 4UUSA 3LWFA 1IC8A 1AA7A 2HXOA 1PVEA 4ZDLA 2VLAA 2VBWA 2MLKA 3F8NA 3ZXSA 1R5GA 3MN2A 3F21A 4AD9A 2ZMEC 2FQ3A 2IGNA 5H6RA 4C2MJ 2GXBA 1H9GA 1HCRA 2P4WA 4MFDA 3ABTA 1FTTA 3ISPA 1TL8A 1D8KA 2JPBA 2XAUA 3UKGA 3OOPA 4GCVA 5TGTA 4P3AA 2ZNZA 3KIOA 4BEHA 3B02A 2ECCA 3S16J 3HC7A 2A69F 4MEXF 2CJJA 4HX8A 2PLYA 2MA3A 4XKVA 1I6HJ 2ZFUA 2DU9A 2JZYA 2H6BA 3ESWB 1W5CC 4ZDPA 1J59A 2L9NA 2BV6A 2ZCWA 2FEZA 2JJ7A 4UVAA 3RKQA 4OU0A 4CHUA 4BQQA 6PAXA 1K4TA 2XPVA 1HC8A 1WI3A 3MKLA 1GT0C 3SZPA 4MLOA 4D1QA 2IBDA 2BY3A 4HLYA 1L3LA 3HRSA 1BC7C 1MJAA 5IOZA 3H5NA 1SFEA 2P6TA 3RDIA 3MKWB 2Q2EB 2WC2A 2HQAA 1R22A 5BPDA 1SAXA 5LEJA 1GUUA 1JUPA 2LC2A 2DA2A 1XGOA 3DPUA 2RN7A 2R7VA 3F9KA 1FYLA 3KLNA 2KJBA 3TMOA 2LMDA 4OIRF 4RAGA 3ECHA 1G3WA 2X6XA 3HKZN 3OYLA 3QODA 2FRHA 5J3LA 3UNGC 1QHHD 4CICA 2DPDA 2M8EA 1CF7A 5EJCA 1U9OA 2ETHA 4CCLA 4MGRA 2LBFB 4W97A 3ERED 1X2NA 5ICGA 1YI2I 2OPTA 4IQ4A 2UXXA 3IV5A 4BACA 4XICA 2E2HJ 2FXAA 1UHSA 4IO9F 4I09A 1KYZA 1UG2A 5L3FA 2K9MA 3HUGA 3RYRA 2W82A 3OR1C 3EETA 4KN7X 4NC8A 4RB3C 4UHTA 3HXLA 5AONA 3TEDA 1IRXA 1D3YA 1LE8A 3BG9A 3JSPA 4MTDA 2XRLA 3GMEA 2MFZA 2VODA 1EH7A 2FF4A 5CVIA 3KE2A 1ENHA 1ON1A 3M1CA 3S93A 4EQQA 1W0UA 4YEJA 1RI7A 4CO8A 1MMDA 5KVRA 2F5DA 3CCRI 5BQTA 1LUJB 3WTZA 4BYYA 2L9RA 3FXLA 2O8KA 2DA4A 1BL0A 2FOKA 3L1PA 2OQGA 1C0WA 4B3AA 2FBHA 2DFEA 4F7ZA 1FSEA 4G7ZF 1VTNC 2E34A 1XMKA 4M3GA 3JAMK 3I55I 4XOTA 1O57A 1WJ5A 2HYJA 4BNCA 2B39A 2NS0A 3JW4A 4F52A 4PJJA 2JVHA 2EH3A 2Q1ZB 4I98B 3HG9A 2CQKA 3HUGB 3D1NI 1J09A 2VKDA 3FK7A 3FXKA 3WE3A 1Y0UA 5B5EC 1CGPA 2DAOA 1FIAA 4NQWA 2ZXHA 4DNCA 1L0OC 1N75A 4B1RA 1RUNA 5JPMB 3VYTB 2KT0A 3I4MJ 3VYSB 5B4PB 5CYVA 2PMZN 2VOOA 1QGPA 5M5WJ 2BXYA 2F4IA 3CUQA 4U0WA 1YJNI 3CCSI 1JKPC 1J7KA 1MBEA 1XMAA 4Q5SF 2OZ6A 2WBMA 4HV6A 3BR1A 3TO7A 4PDKA 2QQ8A 3CC2I 4DJAA 4Y3OA 5IT3A 1MZBA 2ZXJA 1G59A 3DKWA 1KU9A 5GTIC 1HKSA 4WWCA 2EIKH 2L9SA 3DU6A 4A6DA 4M74A 3HRTA 1OCCH 3N05A 2XAFA 1BC8C 2E2IJ 4BQNA 3HKZA 2ZMEB 1D8JA 1ZN2A 3OYJA 2Q0OA 3OSFA 3JRFA 3E6BA 3BZ6A 4L9JA 5FLXZ 2AO9A 3TBIA 1U5TC 2WV0A 2LVSA 2BY1A 1K83J 4ZTFA 1Q1HA 5H2FC 1WJDA 4FHTA 1S9HA 3MZYA 3CJNA 3K10A 3HOXJ 2MG4A 4CUGA 1VFCA 5L3DA 3U1DA 3RTRA 4HYEA 5ILUA 1YRNA 3OS1A 3MAJA 3FDYA 2IVMA 4XL9A 3Q0WA 1H0MA 1R4NB 1BA5A 1R6RA 3GTKJ 2NVTJ 1WFXA 1X1BA 4XBFA 2CV1A 1Z7UA 1F4KA 2DA1A 2YX4A 1JKQC 4DYCA 3IUOA 2QKMB 3S8PA 2EB7A 3F72A 3DU5A 4AIJA 4YRVA 3D5RC 1DGWY 5CKTA 1Z21A 3CTAA 2DOAA 3WTYC 2NAZA 3BR5A 4E7JA 3K1NA 1XSXA 2OC6A 2QSGX 1OYWA 3M3YJ 4A93J 1IN7A 5D5UB 1XTAA 2FMLA 2GOMA 4HOBA 5J47A 1ORKA 4FTHA 2LOOA 1H9TA 3KZZA 4BAYA 2NS8A 4YIIA 1AWCA 4R1HA 3K4BA 4KISA 4L5JA 2QYOA 4E7LA 5CQGA 3G4SI 3I4NJ 4BL0B 5J6XA 4H4KC 1JJ6C 2VQHA 3H0DA 4BY1J 2WA0A 1WHUA 2BVLA 2XAHA 2B7EA 3MZHA 5D5XB 3ABKH 1BI3A 4A2UA 4IHVA 4XQFA 3T5XA 4RGRA 1TWCJ 2KISA 3FXJA 2H1LA 1N78A 2Y69H 2F48A 2PMZA 4KIGA 3WTSC 4M3FA 4F91B 1FJLA 1BIBA 3F6VA 1PUFB 2W4SA 4U88A 5H6QA 3V8KA 1NK2P 1JHFA 3PO2J 4JX4A 1R23A 2R4GA 4N9IA 3PNVA 1F1ZA 4CCJA 4BE2A 2GWRA 1BR2A 3REOA 2QEXI 2R7TA 5FO5A 3E1SA 1QZYA 5FD5A 4GFBA 2IP2A 2ZSIB 5J8CA 2ESNA 3U21A 1TW2A 2XB0X 5BPIA 3ZMDA 3WHCA 2VL8A 1P4WA 1YOVB 1ZTRA 1KA8A 2XAJA 2DMTA 2PEXA 1HKQA 1TT5B 4U7BA 2KHMA 4AIHA 4X0GA 4HF0A 3LFKA 1P4AA 2JRMA 3EUKL 2PQ8A 1S7AA 1MNMC 3QU3A 2B63J 3K1MA 4OIOF 1BW5A 3GZNB 3KP6A 5IP7J 4A3FJ 2OTJI 3J80K 3MQ0A 5FKNA 3LNQA 3C18A 2EINH 3CUOA 2HDDA 1T56A 3CCMI 3LAJA 1UHMA 5D8LB 1W7PB 3OS0A 1OYIA 3CQZJ 3I53A 3LFUA 1HXDA 2QVOA 2GIVA 1SFUA 4A0ZA 2BW3A 3V4GA 3VSKA 4RGUA 2G7UA 2LDUA 4EV0A 1UAAA 1BIAA 2I8DA 2ZJ2A 2MW8A 5H20A 3QPLA 2KL4A 2O5RA 1F43A 2D2WA 3GF2A 2H8RA 4AVZA 1APLC 2P7CB 2F5FA 3AFHA 4Y33A 4AIKA 2O8XA 1U5TB 3HZJA 1QPIA 1PJRA 3IL2A 2EFPA 1YO5C 1W5SA 3ROUA 1A6QA 1Z0XA 2DDBA 2E60A 2KIUA 4CDGA 2RAEA 3F22A 5F0HA 2QGUA 4A0XA 2CS3A 4E6KG 2EA2A 2HWVA 2O0YA 3I0TA 2FBIA 4WB3A 2KRCA 5IT9Z 2ME0A 1T98A 1FX7A 3H9QA 3BWGA 3A01B 4IOCF 1T38A 4A6EA 2JPCA 2GQQA 3OL4A 5BMZA 5L3GA 4CXFA 1VZ0A 3TKYA 1K61A 5HS8A 3M1EA 3ZR8X 2GBYA 3HSRA 5TISC 4BUPA 4ITVA 2XKOA 2V79A 1JTYA 2R5YA 3CF2A 2QUFA 2XGXA 3LMMA 2STTA 2OUMA 4LG0A 3HHGA 1G6NA 1QVTA 3P9CA 2ZO4A 2RQPA 5EEHA 5KCMA 4CZCA 2DA6A 2KDOA 3CMMA 1WKMA 1QRYA 3K9TA 4XLHA 2F2EA 3CLQA 4FX0A 2D45A 3K7AJ 2M87A 2E1NA 2L4AA 2Y9YA 3MKYB 1HA8A 4OWRB 3S2HJ 4LD5A 3F3XA 1T6SA 1ZGAA 5GP9A 5JI6A 4HRIA 1IN6A 4M3DA 3CMEI 4RA2A 2WY7Q 1KQ0A 5CVRA 3P9KA 5HS9A 3AG4H 3BC8A 3C3WA 1VQKI 3ZPLA 2M8GX 4B44A 1B72B 3SJMA 2X9DA 2CU7A 4G94A 4AIDA 4LLNA 4KITB 1VQOI 3RSNA 3ZQGA 5DYMA 2EV5A 4BKXA 4EJOA 4ENKA 2X6YA 4QTRA 4EATA 2F4OB 2CQ7A 2O6GE 2OA4A 2DK5A 2PFBA 2WB1N 3HRUA 3R0JA 2V1XA 3ASNH 2E35A 3OYMA 2NVXJ 1A04A 3F8BA 2ZXWH 1IV6A 4EM1A 3BPXA 1ZR2A 1ZYRF 2K86A 3IH3A 3A2KA 3GTMJ 1FOWA 1FMWA 3K69A 4Y15A 2R93J 3BPVA 1X1CA 4P55A 2VJ5A 1FC3A 2Y30A 1XPXA 3GYHX 4L9NA 2HQ5A 1JGGA 3F8MA 2ADUA 4UUTA 2ECBA 5DD8A 1HW1A 4S0HB 1KQ8A 1H88C 2A5WA 3I54A 2CV0A 2GXAA 1ETVA 4GDFA 1B9NA 4KIFA 3A4CA 5C44J 2M45A 3QP5A 5E3NA 3I58A 1G2HA 4A3JJ 1IF1A 2FMYA 1FZPB 3OYEA 2IAIA 3OYCA 1ZRFA 3SDGA 1DDNA 4BBSJ 2QQBA 2RVCA 1FMVA 3GLLA 2X6WA 4RB1A 2Z9OA 1UJ8A 3KP7A 1BJAA 1ZELA 2VJJA 2M7AA 3CCJI 3TW6A 2DYRH 3BTLA 4JK1X 2EWNA 2NVUB 1T2KA 4KN4X 3WU0A 5EG0B 4XIDA 3I3LA 1TP4A 1MJ9A 4KMUX 4ABZA 2GZWA 2EIMH 5L3CA 1ZQ3P 2K40A 2VKVA 2L4MA 1OMIA 2M4KA 2XVCA 3FMQA 1RETA 1U8BA 3L2QA 3BG6A 5FLVA 3K4CA 3EUHA 3O6BB 4C9YA 3PJRA 2MABA 5F0FA 1XGSA 2IPQX 2O61A 2CO5A 3ZQIA 3CC4I 2W48A 1UB9A 3VYUB 3BG3A 3J7ZI 1R71A 5ILSA 2XF7A 4HPQA 1U6GA 2Z33A 4IX7A 1B6AA 1MMNA 3KP4A 1OR7C 2F5EA 5GAEJ 1HW2A 1UMQA 2XROA 1D0XA 1WRJA 3BR2A 4D9JA 4HQEA 3CJTB 1GV5A 4KYWA 4FT8A 3K6GA 3ZMTA 5M3MJ 2UWMA 1KYWA 2ELHA 2P5LC 2WY8Q 5D6EA 4LLGF 1FPQA 4CYCA 2E2JJ 1VI0A 2NOJB 2K3FA 2JTVA 3FBNB 4E7HA 4PSWA 1MBKA 4IKFA 2LTPA 2ZSHB 2WAFA 4N4OB 3S14J 1JI8A 3S3OA 3GTJJ 1WH5A 3DEWA 3PFYA 3ZMZA 2DQLA 2FNPA 1GXPA 3IHUA 1LFBA 5GAGJ 1X1PA 2CMPA 4J19A 4PJMA 2KDZA 3GTQJ 3KYDB 4HQMA 5LLQA 1GLNA 2IT0A 2LP0A 2QSHX 4XLFA 3PL8A 5K7HA 2DT6A 2WAEA 1NH3A 2BHYA 2KIFA 2L7KA 3NAUA 5DUIA 5CLSA 3LSPA 5LBQA 1HDPA 3A0BC 3GZ5A 4YG2F 2Y75A 5FRNA 4F3QA 5FD6A 3IAM2 1R36A 4XMYA 3VOEA 3FXOA 4I76A 3HOSA 4UVBA 3I59B 1S3JA 1QZEA 2IS2A 3MZ8A 2HTJA 4ENNA 1U78A 4IJAA 4M9ZA 1U8RA 2LYCA 2Q2EA 5J40A 1FOXA 1MKMA 4LK0F 1UHWA 4UU9C 1T08B 1WH7A 4L9VA 4U0YA 1SVOA 5CPRB 4A3BJ 4X6AJ 1Z1DA 4KMFA 3CMYA 4ZJZA 1USTA 1RKTA 4U0VA 4IZZA 3LSTA 3KEYA 4RM3A 4PK4A 5IOYA 1CQTA 3DWLE 2HTSA 4RDUA 3OYAA 5LHHA 4IRGA 3GFJA 1IUFA 1AKHB 3K2AA 2HFHA 2DMNA 2DQRA 2QSFX 3IC7A 1YIJI 1RRJA 3NEUA 2LBFA 2QBYB 2JQ7A 3WG9A 2ZXIA 1MW7A 5AIQA 4ZH4F 4NC6A 3G2BA 4WX9A 3U2RA 3PIPF 2CQXA 2QKLB 2IGMA 2K9NA 3HGGA 2DOEA 4AWXB 1ETOA 5E1ZB 4NB5A 2XF6A 1P7IA 4Q47A 4A12A 3VWBA 2YPRA 5J1UA 3OYKA 3DEEA 4G6TB 4ESBA 2Y9ZA 3SYTA 5D4RA 3K1PA 2KKOA 3DKYA 3U1KA 1UFMA 4D7MA 1IGNA 3KP2A 2E19A 2YUSA 3HGYA 2ISZA 1JHHA 1WJEA 2LK2A 3BOQA 3HRMA 1VQMI 1TNSA 3GXOA 2OTLI 1KZHA 1HOMA 2DOFA 3QQAA 2A73B 5J1RA 1V5FA 4LGWA 1X1AA 1WI9A 3I64A 4FASD 1V55H 3BY6A 1IDZA 4GO1A 2ZFWA 3B6AA 4GYGA 2EFWA 3ERMA 2NNYA 1JT6A 1SMTA 3ONQA 3QYBA 2OCEA 3ZOBA 3EUAA 3OYDA 1S5LC 2GA2A 4N4NB 2RGVA 5FLMJ 2E7WA 4XKBA 3CCYA 2VUMJ 1XDUA 2XB5A 3GW2A 4XORA 4EMSA 5C4JJ 3GWZA 3CO6C 1EH6A 1YYVA 3EPZA 3FISA 1W0TA 1IXRC 1OCOH 1YX3A 3G1OA 4PCQA 4XLAA 3G3ZA 4XRFA 3JRIA 1VQPI 1VQLI 4N0BA 1Z77A 4A5MA 1R58A 1GHCA 1DUXC 3KETA 3VPRA 5HDKA 1IN4A 2V26A 4B48A 3DKXA 1ZH5A 4LB5A 1C5AA 3T8TA 2KIMA 4UB6C 1R5HA 5TJJA 1ZAOA 4BHCA 4XNFA 4II3A 3HOUJ 3KP5A 1H89C 1V5GA 3IWZA 1FBSA 1VF9A 2DTZA 1ZGWA 4PJLA 1Y0NA 3R61A 1S7OA 4JYKA 2L54A 2COBA 5A2QK 1GVDA 1SFKA 1YIOA 1X4PA 5GADJ 3WGGA 4E4HA 2VONA 4DOZA 1VQ9I 1ZRCA 2HOTA 1POGA 4DZPA 3GFIA 2IS6A 2IXSA 2EIJH 4BJ5C 1RZ4A 3OYHA 3O2PE 4HX4A 2ZMEA 1OFCX 5HOOA 2DCEA 5FFXA 1T39A 3RPQA 1RUOA 5TRDA 1U0JA 5KNLA 1D1BA 4M73A 4HG2A 5B1BH 5IY5H 2Y31A 1T33A 4DBRA 2M5WA 2V6EA 1FSHA 2QZ8A 1KGSA 1G3TA 4PFPA 4EM2A 3JAMZ 5EGOB 2Z5UA 1OCZH 1P7JA 2R7DA 5GTHC 4NHJA 3QYEA 5HNFA 1LEAA 3GFLA 5FGMA 1MNDA 2DT7B 2Z3YA 2OCCH 1SMYF 1MBHA 2D5VA 1XSDA 2D1HA 4RAYA 1RNLA 5BS6A 4CGZA 1U3EM 4ASNA 5KHDA 1G4DA 1VQ8I 4PFOA 2CFXA 2HVQA 2EK5A 2V4JC 4K2EA 1D5VA 3ZQCA 3M8JA 2K7LA 4WB2A 1Z6TA 3CCLI 1A6IA 2DYSH 1P6RA 2PX9A 2X51A 5DCMB 1SFXA 3GTPJ 3RIRA 2DMQA 2X48A 3IWFA 1I5ZA 1ZLJA 3C1DA 3KZIC 1KJSA 3LA3A 2YU3A 3Q9VA 4XN0A 3E6CC 1I3AA 3ULQB 1ZHFA 3G1MA 4PGHA 4RS8A 1DQUA 1DU6A 1YTYA 3LSJA 2DJIA 4BS9A 1FT9A 2M30A 4M6VA 1SD5A 2VE9A 1JT0A 4I02A 5B1AH 2HEOA 4IQJA 4HW0A 5J8FA 2DT5A 2CG4A 5CVVA 2IW5A 3BR0A 4IRIA 3CU7A 1MDMB 1XGNA 4O6JA 4XK4A 1FP2A 1AU7A 2R5ZB 4BDZA 1D0ZA 1ODDA 4D7NA 4B47A 5K5OA 5F64A 4FCYA 3QU6A 5HDNA 3CC7I 3WU1B 3AKZA 2XHKA 4WCGA 1TZLA 2HI3A 3RCOA 1MIJA 5E3LA 4EGYA 2UZKA 2NVQJ 2IGOA 5JPNB 4UUVA 1PUFA 1K7AA 2P6SA 4N9HA 3BR3A 1A31A 3IAS2 1IXCA 1BR4A 3NRVA 1PYVA 1WJCA 3BQZA 4Q4ZF 1ETYA 4HNTA 1YFHA 4UB8C 3VDXA 3KYLA 4S05A 2CQNA 4P39A 2N8GA 2BHZA 4LLLA 3E5QA 1X3ZB 3R4KA 2A61A 3Q0UA 4RBOA 3TOBA 4HAMA 3DLLF 2HR3A 3GTOJ 4YIRX 3GFMA 1P92A 3WHBA 3K4MA 1XCVA 2V1DA 2L01A 1S29A 4NBQA 4HDVA 3BTJA 3OIQA 1FNNA 3QPSA 1FYMA 2PBIA 4ENJA 2X1DA 1DPUA 2LREA 2BE5F 2FOWA 1YHQI 3QAHA 4KT5C 4YFKF 3H5RA 5HLHA 3CD6I 3ML6A 1JJ8C 3WU2C 3CCUI 3HL2A 3LSMA 3JCUC 4ZYAA 1Z3XA 2XAGA 3T1BA 2WADA 3C7JA 2VQCA 1ULYA 2XSJC 1W7PA 4X1EA 3JTHA 2R0QC 1ZG1A 3KCCA 1QA6A 1TW3A 2BGCA 4V2GA 5K5QA 2A6HF 4YFNF 1E2XA 2BVMA 1ETKA 3I9V2 2M7BA 4QWQA 5F27A 4BQAA 1FEXA 1T0FC 5L3EA 3L2CA 3N97A 3KEOA 1YLFA 3KZYA 3S32A 1QNTA 3H3UA 2Y0MA 3FHZA 1IXSB 3CCVI 3HEFA 1VQ7I 3PUFA 2O9LA 1EV7A 2ESHA 4G6DA 4D0PA 1U9NA 3TP0A 2F6CA 3R6SA 1IAWA 3J7AY 2A05A 5HLGA 3TOAA 4UV9A 1S7EA 2EFOA 3BJOA 1W4MA 4BHPA 1Z3YA 2DODA 1U5TA 1W7PD 1Z7LA 2LLKA 3FMRA 1R7JA 3M7GA 3Q9SA 4AM3A 2G0EA 1Y8QB 4I6ZA 5M5XJ 4RB2C 3SEQA 4M9XA 3CP2A 1XC5A 4MQVA 1MMSA 1PP7U 3HM5A 1Z91A 3LA2A 3E97A 3LSGA 1JE8A 1KQ9A 1ZG5A 1ETXA 2TDXA 4G7HF 2EQRA 4BGDA 1D1CA 3DF8A 3BP8A 1UG0A 1IDYA 3CZ6A 3A01A 1TLHB 3D0SA 4CCKA 2EILH 2VOPA 2JMWA 3EDPA 3MKZA 2VT3A 4FISA 3HPGA 2G7HA 4J00A 2UV1A 4HSRA 3FKJA 3V42A 4LK1F 3J80Z 1I1SA 3RPUA 2FUG2 1MH4A 2X4HA 2EV6A 1Y1VJ 4CSWA 3ABLH 2GA1A 2DN0A 3S2WA 1WCMJ 2B9SA 1O4XA 1DU0A 4FE4A 3ZRGA 1VQNI 5GAHJ 2V6CA 1GVJA 2Z1DA 5IP6A 1W36C 2NYXA 2XDVA 4ANJA 1LQ1A 1OCTC 1EH8A 2XIGA 2VC0A 2AQEA 1J0RA 2ICWG 3PFIA 2HKOA 1KU3A 5FRMA 2P5VA 4I0BA 3W3CA 2P5KA 2W84A 4DYRA 3GUDA 2HPIA 5D5VB 4DBQA 2P7VB 2XKPA 3H1CA 1RESA 1P9QC 3QRFF 1X3UA 4BXUA 4DYQA 1E17A 4PJ0C 2CV2A 2L7MP 2JA7J 2CW7A 4PJNA 5GPCA 1RPWA 3T0YA 3RPUD 3NQOA 1X3WB 3O3KA 3VB2A 4LG3A 1DGRM 1F9NA 4LIVA 2NOGA 4NDLA 3T8RA 1DP3A 3DPTA 5IYDJ 1B72A 3U9GA 2CSOA 2UXNA 4W1UA 2CUFA 2QQ9A 3DBRB 1RC9A 4F55A 5E3OA 3JRCA 4MQ9F 3HSEA 1LNWA 3CJQB 2LKSA 1J5YA 3H9JA 2XF5A 3FXQA 1XN7A 3K4KA 2VBZA 5DD4A 2JRTA 3QOEA 1WVRA 5EEAA 3J81K 2R7UA 2MC4A 3QPHA 3FKIJ 4L0ZB 2CUJA 2F4MB 2WTEA 3GO5A 2R7WA 2AS5F 1AOYA 1UCRA 3OIPA 2F5CA 4PUSA 2LNBA 3VSLA 5JFRA 4JQFA 3SQNA 2M0MA 1Q1VA 2XASA 4XR6A 2DA5A 3GLXA 5E1XA 4YFXF 3L09A 3CESA 3QYFA 4IHTA 1F36A 4YELA 1E3PA 2K85A 4DZJA 4ESFA 4OAYA 1OYYA 1QVUA 9ANTA 3CDLA 2HOAA 5ICCA 1G3SA 3SZGA 3TDUC 1XD7A 3GCMA 4E7KA 1B9MA 4A69C 3CMAI 1WQ2A 1D0YA 3JR9A 3WGIA 4F93B 1Y6IA 2ELJA 3C2HA 3K2ZA 5AIPA 2HZDA 2MD0A 4BU2A 4I2OA 4MO7A 2D1VA 2C6YA 4HV5A 2W24A 2P0WA 5EG0A 1M1EB 4EJVA 5M3FJ 2M34A 3OWTA 5B66C 3A0HC 2X1CA 4RLQA 2HOSA 2V7FA 1JKRC 2K3PA 1OCPA 1NK3P 1A35A 4QLCU 3L2RA 1I50J 4QSHA 1YJ9I 2RC4A 3VYRB 3HPHA 5ED4A 5GPAA 3HQBA 3I4PA 1IW7F 3DP7A 1MMAA 2EPFA 1NTCA 1LJ9A 2IS4A 2Z99A 1R4MB 3I56I 2GLOA 3FHNA 3MFKA 2R92J 4BJ6C 1BBYA 4M9SA 4PZJA 4AYBN 4V19K 3IKTA 1CFAA 1V54H 2DO7A 1Y39A 2DDAA 5FB2A 3HOVJ 4GRIA 2PJRB 1MH3A 2EA4A 1SVMA 4Y13A 2L2OA 5EF6A 1QZZA 1ZRDA 3QOPA 4NNJA 1BI1A 1WJBA 1SAUA 1YQAA 2EFQA 2Z16A 1XMXA 3KFWX 4ENMA 3ZQLA 2NS7A 2ZC2A 2QLZA 2Z2SB 3MWMA 3RQIA 1LFPA 1U2WA 4HDUA 2A07F 3W2WA 4KIBA 2JA6J 2V1NA 3AL0C 3LA7A 5LGTA 2VJIA 2E7XA 4D5FA 2R3SA 2VIXA 2K4BA 2E36A 3IH2A 2LKXA 1BW6A 3QWLA 4LJZF 1X4OA 1FBUA 1SEUA 3A02A 2A3SA 3JRGA 1NHAA 2ZJQF 3JRHA 1HKTA 1OISA 1TQPA 3FXUA 4P5OA 3ELKA 4M72A 4MFEA 2GXGA 2ZNYA 3PUBA 1KU7A 3BZCA 4LOCA 3VEPA 3WTWC 4J01A 2NNNA 1PUEE 3HSFA 4PGGA 2MYSA 1TTYA 2EZHA 4BXFA 3SFIA 3Q5FA 1TNTA 2YR2A 3AG1H 3I59A 3PM1A 2HDWA 5JVGF 4A3EJ 3DQVC 5LEKA 3S1MJ 2P81A 3W6JB 3RZDJ 2UUZA 2NRAC 1IUYA 4XRSG 3R60A 2JSPA 2LF8A 3M8FA 2HVSA 1LDDA 2O3FA 3F8CA 3L2UA 3SDBA 3NARA 3H5AA 3PQJA 1FYKA 2CW0F 3BR6A 4XKWA 1FIPA 3DXJF 3AG2H 2H6CA 3CLOA 4ZYEA 2XRNA 3TO9A 1LB2A 2KMUA 1I1GA 3FXRA 3BJ6A 2E1MC 3HTSB 4E70A 3OR2C 1AKHA 4LITA 1MD0A 2LY9A 2KIQA 2W25A 4WF2A 5FJ8J 4L5IA 2FE3A 2MSYA 3OL3A 5D4SA 2QBYA 1EF4A 1YG2A 3WG7H 4B4CA 2M9HA 3HYIA 4RLFA 3K4NA 5D5WB 1YITI 2STWA 3P5JA 4MEYF 2I10A 3PQKA 1S8NA 2PN6A 3BTCA 2B0LA 3IP4B 2JA2A 5E8IA 1O3TA 1XCBA 2V9KA 1SC7A 4IHWA 3OMYA 4BY7J 1MBJA 1BOBA 3GTLJ 1REPC 4UY8I 2V1UA 3FX3A 3W6VA 5KAFC 2L0KA 2FA5A 5HNHA 4ON0A 2HGCA 2TRTA 4MTEA 4KT6A 4AYBA 1ACIA 4P96A 1SD4A 2WAQN 4A3MJ 2VQGA 2OBPA 3B73A 5HVQC 2XGDA 4Y17A 2M0CA 1LVKA 2AQFA 4IHYA 3WODF 3GX4X 3WTVC 1E3HA 4EJTA 1P2FA 2VBYA 4XSZF 1WWXA 1ZREA 2BY0A 1EKEA 1X58A 2KJCA 1I3QJ 4AUXA 4A3CJ 4IPAA 3RJPA 3FIWA 5HODA 3OV8A 4H0EA 2VC1A 1K78B 3H9GA 4OMYA 3ABUA 2XGEA 3C2BA 1AHDP 4BDYA 4IVNA 3FBIB 3W2AA 2V9PA 1B4AA 1VNDA 2W1OA 3DTKA 1J75A 1IN5A 2ELKA 5E1WA 2VB6A 1ERDA 2KFDA 2ID6A 2W57A 1BM9A 5E3MA 2TCTA 4HF1A 1SD7A 1OR7A 1B8IB 4KFCA 2RNGA 3CUQC 2CGPA 2YU9J 5DUKA 4TV7A 5LGNA 5HS7A 1VQ5I 3HOTA 4OIPF 5EEGA 3NWSA 1V3FA 2L5QA 3B6CA 2HQRA 1LFUP 1OJLA 2ISYA 3G1LA 3JRDA 3O8HA 2PMUA 4E7IA 1HW5A 4DGWB 4LB6B 2JUGA 2HKXA 4RM2A 2PI0A 4UUSB 3OS2A 2DA3A 5F1JA 2IGKA 3DTIA 4MNUA 3OYIA 1IV8A 3K70C 3GBGA 4ZC3A 2XC7A 1X19A 4RAZA 3AL0B 2OF7A 1N25A 2DFIA 3S1QJ 5IYCJ 5CJ9A 3FK6A 3M9AA 3DBHB 2DA7A 4C2TA 1TQMA 5IPAA 4BEHB 1O3QA 2QF7A 2R7OA 1KU2A 4HLXA 2K9LA 1V4RA 1FWZA 4M71A 1BR1A 2VJ4A 2DPUA 3JRBA 2VXZA 2J5PA 3DEUA 3E6DA 1B1BA 5EGOA 1BN5A 3W2VA 3DTEA 5LFAA 4ZZLA 4OIQF 2MD5A 5FKLA 1W5TA 2VPRA 2VKEA 3H3ZA 3W6KB 3PSIA 4C3HJ 1O7FA 1JUMA 4C2UA 2HOEA 4I7HA 4JX6A 2H1KA 2NVYJ 5HLIA 1YW7A 4C30A 2WAQA 5J4YA 4IXAA 1MBGA 1FOYA 2DBBA 3PNYA 5B3SH 3PIOF 1SFOJ 3LSHA 4HZFA 3PSFA 4L18B 5DCMA 3HTUA 4B43A 4ZYHA 3G6EI 3CDIA 1ETWA 2JUCA 3K0LA 4DW6A 3CCQI 2HQNA 1YJWI 4FXKB 1JUSA 2ACJA 1JGSA 3LQRA 4EJUA 4UXNA 5ICFA 4P3BA 1G3YA 2E1MB 2H27A 2PMHA 3R0AA 5A2QZ 1CF7B 1WGXA 2JT1A 1Z05A 2QCOA 2LFBA 4BHBA 2FD5A 4I6OA 1QPMA 2DFHA 1TWHJ 4FQGA 4MIMA 5FFZA 3HBLA 4G9YA 4A3IJ 1MDMA 4UNOA 3CJRB 2OV7A 5LD2C 3C2GA 2KPMA 2H09A 2R5ZA 2HZTA 3FMSA 3H92A 5K1YA 4GGGA 4BBRJ 3Q0VA 4Y7NJ 3S3NA 2XUBA 4UVCA 5ERIA 2VQLA 5LHGA 4A3KJ 3VFZA 2JVGA 1X2MA 2JWTA 2RKHA 2ID3A 2LR8A 2HDCA 4CA0A 3BLYA 4RB0A 5JR3A 4KDPA 3ZCOA 2YS9A 3L00A 1LE8B 2KRFA 2EJRA 4R8HA 2EBIA 1MJBA 4XLPF 5ILVA 5E79C 4XM3A 4CCNA 1MGTA 5FLXK 2OJED 3V8JA 5FKKA 1XX5A 2BYVE 2HPMA 2WWYA 1R1TA 2R7SA 1WSUA 5ICEA 4IL6C 1ZR4A 1GXQA 2IEKA 4BQOA 1BOAA 1W1WE 2H94A 1JKOC 5C3EJ 5FKMA 2K9QA 2FU4A 4OOIA 5KK1A 1A36A 3DFGA 3BT9A 3L2WA 1WZ2A 3S2DJ 3MEXA 3RI4A 4O5VA 3BCBA 3MVPA 5F0CA 1QO0D 3TL4X 3P7NA 1Z67A 3HB9A 4XN3A 3LAPA 5DM7F 5DV5A 4CYDA 2A5YB 1LVAA 3V7SA 2X0LA 2RREA 3SZTA 2Q8KA 4S04A 1FBQA 1GV2A 4DIQA 5E20A 3HDDA 3M8EA 3KYCB 2L3DA 1IJWC 3F8FA 2OD5A 1OCRH 3DLAA 1R1UA 3RKXA 3LSKA 4PSXA 3N4MA 4NQWB 4A3GJ 3E0JB 3BG5A 1LKXA 3LQQA 3CP8A 4RGXA 1XG1A 2W00A 2JSCA 2FNAA 1O3RA 2YSRA 1XSVA 3GVAA 3SFZA 3CUQB 2XV4S 3TW7A 2DK8A 1S6LA 4XLCA 5DEQA 1H8AC 3BG7A 4ZZDA 5F08A 5K7FA 3K70D 2QENA 2OQRA 4Z2YA 2ZJRF 4A0YA 3M07A 3S1NJ 2EZKA 4IHXA 3EQLF 3P9IA 4QPQA 3ZQFA 3HOYJ 2QA4I 3E5UA 1I27A 4KA4A 1J2XA 4JBAA 3OSGA 2CYYA 2CUZA 2Y2ZA 1HSTA 1MNEA 1G8XA 5M5YJ 2VT2A 5D6FA 3UR3C 2XPWA 2FBKA 2OAZA 3S3MA 4XRMA 2DXIA 5CVUA 1T8IA 1TQIA 4FX4A 1P4XA 2LSOA 4FETA 4JX5A 5JHFA 4AC0A 4DQ2A 5E8GA 1FP1D 1YRNB 2E5ZA 4LFUA 3FZVA 5EYRA 5EZHA 4RMNA 4XSXF 1TWAJ 4LMYA 2DW4A 3E7LA 2OU2A 2KP6A 2LY2A 1YW9A 4FE7A 4OMZA 2EZIA 5F04A 2FJ1A 1IO2A 2PG4A 4IRHA 4B3XA 3H3VK 4JP0A 2A6EF 3DV8A 3RYPA 3S17J 5F6FA 1RR8C 2L02A 5JLWA 2EV0A 1VQ4I 2BXZA 2ME6A 2K9SA 2KRHA 2VBXA 2ZBKA 2I5UA 3AG3H 5IP9J 2DI3A 1UELB 2HVRA 2HS5A 2VKHA 3ZQQA 4L9TA 2MLGA 1BI0A 2R7XA 1D1AA 4E7ZA 2HU9A 3X2QH 1A5JA 3Q3SA 3BROA 4M3BA 5D8KB 1NG6A 5LGUA 1MSFC 3ASOH 4M3EA 1I6XA 3GTGJ 2ZB9A 2GIZA 4L0YB 4HW5A 1PP8F 4ZDOA 3I71A 2RQQA 1T95A 3JTGA 3WE2A 1O7LA 2P8TA 1LEBA 2MBFA 1ZKGA 5K5RA 3HQAA 2LH9A 3E5XA 3O8GA 2X1EA 2J5OA 1ON2A 3LOCA 5E17F 2Y0SN 2AXLA 1TWGJ 4BJTA 3BZKA 2HYFA 5LHIA 4KNYA 1QQIA 3TO6A 5LRRA 1R1VA 3HHHA 4V2FA 4ETSA 5J1YA 4R79A 2ZKZA 2R7QA 2DFFA 1JTXA 2IA0A 3ZMSA 2XSDC 2JA5J 5L3BA 2L7ZA 4P1WA 3K4JA 4Z6YA 2E1OA 4BE1A 3L9FA 4ZYGA 2IJLA 2L7FP 1ZARA 3WTUC 4G8XA 5EDNA 4BE0A 1Y56A 2G9WA 4I01A 4WXHA 5IT9K 1SD6A 2JN6A 4I0AA 1QBJA 2LF7A 2R7FA 2NXNB 3OOUA 5DDGA 4B8XA 3V7RA 3D5SC 2XGCA 3H35A 4HNVA 2K27A 3RKWA 3OY9A 2LG4A 2BBYA 4IOAF 1TBXA 3BQYA 1K6YA 1F5TA 1ZK8A 4KICA 4XONA 4XRSA 4KJZA 1ITYA 1SANA 4RGSA 2KQRA 3IRRA 4HX7A 1DP7P 1XB4A 2L9VA 4G12A 5IYBJ 3WTTC 1IZ1A 4ESJA 2GOXB 3TQNA 3COAC 4NUBA 3FM5A 1ETQA 1YW8A
chains in the Genus database with same CATH topology
3D5RC 1DGWY 4BXFA 5CKTA 1Z21A 3EPZA 2DOAA 4E7JA 2HDWA 4OAZA 3DQVC 1YX3A 4XLAA 2OC6A 3SEZA 2BW3B 2UUZA 1YE9A 2JSPA 2HVSA 2GOMA 3OYGA 3L2UA 2LOOA 2V26A 3SDBA 3NWTA 3H5AA 4B48A 3DKXA 4E7SA 4XKWA 3K4BA 3EUHC 4KISA 4XNFA 4E7LA 4II3A 5CQGA 1V5EA 1V5GA 2KMUA 4BL0B 4H4KC 2VQHA 3H0DA 2WA0A 1QU3A 4PJLA 2E1MC 2BVLA 3OR2C 2LY1A 4LITA 3OYBA 4XQFA 2VXDA 2BOLA 5CQEA 3OL3A 1SFKA 4E4HA 1X4PA 1N78A 3OYNA 4DOZA 2W7NA 2PMZA 4RLFA 3K4NA 2IS6A 2IXSA 4BJ5C 4F91B 3OYHA 1YX5A 3IP4B 2W4SA 2JA2A 5HOOA 2DCEA 2V9KA 2PJRA 3OMYA 4LIUA 1WJFA 1BOBA 1U0JA 2R4GA 1N77A 5KNLA 3PNVA 1D1BA 1KONA 4HG2A 4CCJA 4BE2A 5HNHA 1BR2A 2R7TA 4KT6A 4DBRA 4AYBA 2V6EA 3E1SA 2ZSIB 2Y0SA 2VQGA 4PFPA 4JOMA 3L2VA 3U21A 5HVQC 1MMGA 2CH0A 1LVKA 2AQFA 3QYEA 5HNFA 2VL8A 2CFOA 1MNDA 2DT7B 4U7BA 2KHMA 4X0GA 1QHGA 4XLEA 5KHDA 3EUKL 4PFOA 2HVQA 2V4JC 3H9GA 3M8JA 3LL7A 2X51A 1NG7A 2E5NA 2IS1A 2M4GA 4BDYA 3FBIB 3W2AA 3OS0A 3LFUA 2W1OA 3DTKA 4Y4RA 4XN0A 1LDKB 2VB6A 1ERDA 2BW3A 3VSKA 1E0EA 2CW8A 1DQUA 1OLTA 1UAAA 4II2A 2DJIA 4BS9A 2M3AA 2I8DA 4IQJA 2RNGA 3HOTA 3NWSA 2KL4A 2L5QA 1W36D 2O5RA 4CCMA 4XKCA 2F5VA 4AVZA 4BDZA 4E7IA 1D0ZA 4DGWB 4B47A 2JUGA 3AFHA 4RM2A 3OS2A 4Y33A 2KLOA 1PJRA 2IGKA 3DTIA 3AKZA 3OYIA 4XOPA 1TZLA 3OYFA 3RCOA 2E60A 3KX2A 3K70C 3GBGA 4HSTA 3K4LA 2IGOA 4ZC3A 2CS3A 4E6KG 2XC7A 1X19A 3LSIA 3AL0B 4F92B 3IAS2 1BR4A 2KRCA 3D5LA 1PYVA 1WJCA 2R7RA 3H9QA 4HNTA 4C2TA 3VDXA 4BEHB 3KYLA 2K5CA 2A6TA 2R7OA 3OL4A 1TT0A 2K9LA 1VZ0A 1BR1A 2VJ4A 4QPOA 2VXZA 3ZR8X 3W2VA 4BUPA 4ITVA 3DTEA 5LFAA 3K4MA 3PSIA 5FROA 3CF2A 3LMMA 4C2UA 3OIQA 2OUMA 2LRDA 2HNHA 4C30A 2WAQA 2X1DA 3PNYA 1X1DA 2LREA 4ZTJA 3A1YA 5KCMA 3LSHA 4CZCA 2KDOA 2VASA 3H5RA 3PSFA 3CMMA 3MMYB 4B43A 4XLHA 2X85A 4NC7A 2KZVA 3LSMA 3HL2A 4ZYAA 1Z3XA 5HLTA 3ZGKA 2WADA 2VQCA 3MKYB 2XSJC 4OWRB 2WB1A 4U87A 1HA8A 3BCAA 1WJAA 4HRIA 3MD2A 2E1MB 2VPLA 2BVMA 4HNUA 3I9V2 2WY7Q 2M7BA 3DPLC 1T0FC 3PNTA 3BC8A 3S32A 4B44A 4HEA2 3RQ4A 4CCOA 4KITB 3CJRB 2OV7A 3RSNA 5LD2C 3C2GA 2KPMA 1EA3A 2F6CA 3J7AY 4AU7A 2X6YA 4EATA 4CH7A 3OYMA 3S3NA 4FXGB 2VQLA 1Z3YA 2JVGA 1AA7A 2VLAA 1Z7LA 4ZDLA 4CA0A 3A2KA 3BLYA 3ZCOA 3ZXSA 1FMWA 3SEQA 3CP2A 2IGNA 4XM3A 1X1CA 2VJ5A 4CCNA 3LSGA 2XAUA 2HPMA 5TGTA 4BGDA 1D1CA 1UG0A 2R7SA 3CZ6A 4CCKA 4BEHA 4BQOA 2A5WA 3HC7A 3MKZA 2CV0A 3HPGA 3L2WA 4XKVA 3A4CA 2ZFUA 4J00A 2UV1A 4HSRA 3BCBA 3FKJA 3V42A 4ZDPA 2L9NA 3TL4X 3OYEA 4XN3A 3OYCA 2FUG2 1FMVA 2RREA 2X6WA 4BQQA 4DIQA 4CSWA 1ZELA 2VJJA 2M7AA 4MLOA 3ZRGA 3DLAA 4D1QA 3LSKA 4PSXA 2Z1DA 3H5NA 1W36C 4NQWB 3MKWB 2Q2EB 2XDVA 3I3LA 4ANJA 3E0JB 2HQAA 2AQEA 1LKXA 3CP8A 2LC2A 5FRMA 2W00A 2M4KA 3W3CA 3DPUA 2HPIA 3L2QA 3BG6A 2R7VA 3F9KA 3K4CA 4C9YA 4DBQA 3TMOA 3PJRA 2MABA 1P9QC 4XLCA 3VYUB 2X6XA 3OYLA 2CV2A 3BG7A 3QODA 3K70D 3UNGC 2CW7A 4PJNA 2XF7A 1QHHD 4HPQA 3RPUD 4IX7A 1MMNA 4CCLA 2LBFB 4LG3A 1DGRM 1OR7C 4QPQA 4LIVA 1D0XA 1DP3A 4D9JA 3DPTA 4IQ4A 4BACA 3K6GA 2CUZA 2UWMA 2WY8Q 2K9MA 1MNEA 1G8XA 2W82A 3OR1C 4F55A 3UR3C 2NOJB 3CJQB 3FBNB 4NC8A 4PSWA 4E7HA 3H9JA 4IKFA 2XF5A 2ZSHB 3HXLA 2WAFA 3K4KA 4N4OB 1JI8A 3S3MA 3S3OA 1IRXA 2DXIA 3QOEA 2R7UA 3PFYA 4FETA 2MC4A 2MFZA 5JHFA 2CUJA 2R7WA 3M1CA 3S93A 3OIPA 2CMPA 4PJMA 4YEJA 4PUSA 3VSLA 2E5ZA 1MMDA 4JQFA 2M0MA 1GLNA 4RMNA 4XR6A 2KP6A 4XLFA 2LY2A 3PL8A 3CESA 3QYFA 2DT6A 2WAEA 4YELA 4B3XA 2L7KA 4OAYA 4XOTA 1WJ5A 3SZGA 4F52A 4E7KA 4PJJA 2JVHA 5FRNA 1D0YA 4F3QA 2KRHA 4F93B 3IAM2 1Y6IA 2ELJA 2Q1ZB 3C2HA 4XMYA 2HZDA 2MD0A 3HG9A 4BU2A 3HUGB 3HOSA 1UELB 1J09A 2IS2A 2VKDA 2HVRA 2VKHA 2P0WA 3ZQQA 2LYCA 2ZXHA 3OWTA 1N75A 5JPMB 3VYTB 2R7XA 1D1AA 2X1CA 4RLQA 5CPRB 3VYSB 2V7FA 2HU9A 4E7ZA 2K3PA 1NG6A 4ZJZA 4IZZA 2F4IA 3L2RA 3KEYA 4RM3A 4PK4A 3VYRB 3DWLE 2WBMA 4ZDOA 3OYAA 3HPHA 2RQQA 1T95A 1MMAA 4DJAA 4Y3OA 1G59A 2IS4A 2LBFA 2LH9A 2L9SA 2ZXIA 3DU6A 1MW7A 3FHNA 4BJ6C 2X1EA 3G2BA 3N05A 2QKLB 2IGMA 4BQNA 3HKZA 4BJTA 3OYJA 2XF6A 4GRIA 2PJRB 3VWBA 2L2OA 4R79A 3OYKA 3TBIA 2R7QA 3DEEA 4G6TB 4NNJA 2Z16A 1WJBA 1SAUA 3SYTA 3DKYA 4ZTFA 1WJDA 4P1WA 2Z2SB 3K4JA 1S9HA 1WJEA 1LFPA 3K10A 3W2WA 4BE1A 3AL0C 2V1NA 4CUGA 4BE0A 1Y56A 2VJIA 1V5FA 3RTRA 2VIXA 1X1AA 4FASD 3OS1A 3OOUA 3FDYA 4XL9A 3D5SC 3H35A 1X4OA 1R6RA 3OY9A 2LG4A 3ONQA 1WFXA 1K6YA 3QYBA 1X1BA 3EUAA 4P5OA 3OYDA 2CV1A 4XONA 4KJZA 3PUBA 2KQRA 4N4NB 4J01A 2GOXB 4XKBA 3IUOA 2QKMB 4NUBA 3S8PA 4XORA 3DU5A 2MYSA 4YRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA7 A;  4D9J A;  4ITV A;  4PUS A;  2Z16 A;  4IQ4 A;  3VDX A;  1EA3 A;  5CQE A;  3MD2 A; 
#chains in the Genus database with same CATH topology
 3ZN0 A;  2RV8 A;  2AXT C;  3AAF A;  5BOX A;  4WK8 F;  1XDS A;  1VQ6 I;  4OAZ A;  5JHU A;  3SEZ A;  4O3M A;  2BW3 B;  1YE9 A;  1HSJ A;  1I39 A;  3OYG A;  1Z6R A;  4M6Y A;  3NWT A;  2HYG D;  4EJW A;  4E7S A;  2BZT A;  1HF0 A;  4WXD A;  1T0F A;  2O03 A;  2W85 A;  3EUH C;  1Z9C A;  2QWW A;  3F0C A;  4P9F A;  3L7W A;  3KEQ A;  3J7A O;  1IRF A;  1V5E A;  2V9V A;  5J4V A;  3TDZ C;  3S15 J;  2PJP A;  2MGQ A;  2YX7 A;  4G7O F;  1QU3 A;  2BEO A;  5BNG A;  2LY1 A;  3FF5 A;  1Y8R B;  3OYB A;  3JRE A;  2VXD A;  1D5Y A;  2BOL A;  2K4J A;  1K4S A;  3OIO A;  5CQE A;  2IA1 A;  5DM6 F;  3F23 A;  3CO7 C;  3J7Y J;  5DS9 A;  3OYN A;  2W7N A;  1FOK A;  3ZN1 A;  3I5U A;  2IA2 A;  2RNJ A;  1OPC A;  3J81 Z;  3H36 A;  3SHF A;  3CF5 F;  2Y48 A;  4GXO A;  1YX5 A;  3ZMV A;  3KPH A;  3V7C A;  4P9U A;  1E3O C;  1IG7 A;  3M4O J;  2PJR A;  3ECO A;  4I99 C;  3RKY A;  4LIU A;  4EM0 B;  1WJF A;  2QM3 A;  1HBX G;  4EVI A;  1N77 A;  1KON A;  1LPQ A;  3F6O A;  2R7Z J;  2M1B A;  4UV8 A;  3S1R J;  2A68 F;  3CDH A;  4Y52 J;  2Y0S A;  3L2V A;  4JOM A;  2COM A;  4KUM A;  1MMG A;  3FWE A;  4EGZ A;  3KLO A;  1WPK A;  4HA8 A;  2CH0 A;  2H8W A;  1ZLK A;  2JA8 J;  1IRG A;  2CFO A;  2DTR A;  2DLL A;  2R5Y B;  4M6X A;  5CVJ A;  3E3V A;  1QHG A;  4LG0 B;  4HBL A;  1O3S A;  4XLE A;  2GM4 A;  1YS7 A;  2LKP A;  3HJE A;  1HQC A;  3G71 I;  3BJA A;  2CRG A;  3TGN A;  4OIN F;  1K79 A;  4IEJ A;  3LL7 A;  3CCE I;  1BJZ A;  1NG7 A;  4Q48 A;  2E5N A;  2KZG A;  2M4G A;  2IS1 A;  1J9I A;  4BXX J;  2DMP A;  2FQ4 A;  1DPR A;  4XLN F;  3KLS A;  2FX0 A;  4Y4R A;  2E1C A;  3LSR A;  3QP6 A;  1TWF J;  1LDK B;  3JRA A;  1R49 A;  1UZC A;  3VOD A;  1E0E A;  4ZYD A;  2CW8 A;  1ONV A;  3BDD A;  1OLT A;  4II2 A;  3FXM A;  1IRZ A;  2M3A A;  1XS9 A;  2M2E A;  5HDG A;  3SXY A;  5C4X J;  3FM3 A;  1R9T J;  2VN2 A;  4CZZ A;  3EYI A;  2EZL A;  3H0G J;  2XAQ A;  2RDP A;  2X6O A;  1W36 D;  1FTZ A;  4CCM A;  1MBF A;  2F5V A;  4XKC A;  3V8L A;  1RR7 A;  2WV1 A;  2BY2 A;  5K7Z A;  3E6M A;  1OQY A;  2KLO A;  4A3L J;  1USS A;  1XGM A;  2FSW A;  1RIO H;  2E71 A;  2MH2 A;  3WTX C;  4XOP A;  1YS6 A;  3OYF A;  3IRQ A;  3RZO J;  3KP3 A;  3KX2 A;  3JSO A;  2OZU A;  1FLI A;  3GZ6 A;  4HST A;  4HF2 A;  3HOZ J;  3K4L A;  4MHG A;  4IF4 A;  4U7D A;  3LSI A;  5E18 F;  4C3J J;  4F92 B;  5JLX A;  1MSE C;  1IN8 A;  3D5L A;  4C3I J;  3HIF A;  3IKV A;  2R7R A;  1Y1W J;  1FY7 A;  1K6O A;  1GDT A;  4A3D J;  1R5I D;  2A6T A;  2K5C A;  1EJ9 A;  2HXI A;  2MH9 A;  1TT0 A;  3HOW J;  1B59 A;  2CUE A;  2MC3 A;  5F1R A;  1HLV A;  3EYY A;  4QPO A;  2GAU A;  3PO3 J;  2K02 A;  1S72 I;  1STZ A;  4D5C A;  4QIW N;  5KAI C;  5EZG A;  5FKO A;  4IHS A;  4EEF G;  2VE8 A;  5FRO A;  1OKR A;  3DBL B;  4WXC A;  2IRF G;  4GYI A;  4YIF A;  2LRD A;  2HNH A;  3G73 A;  3A03 A;  2VI6 A;  2LD5 A;  1X1D A;  3ZQH A;  5DCF A;  4AVP A;  4ZTJ A;  3A1Y A;  2JK3 A;  1K78 A;  2VAS A;  2DMU A;  3MMY B;  4L5E A;  2AHQ A;  2O7O A;  2X85 A;  3DCF A;  2KZV A;  4NC7 A;  3MCZ A;  3ZMU A;  3TP3 A;  5HLT A;  1RKW A;  3ZGK A;  1HDD C;  4B09 A;  2WB1 A;  4U87 A;  3ZP5 A;  2QQA A;  3BCA A;  1SVL A;  1WJA A;  3MD2 A;  4A5N A;  3QPT A;  1BI2 A;  4G6Q A;  2VPL A;  4HNU A;  4HWJ A;  2XPU A;  1R00 A;  1ZGJ A;  2DJN A;  3DPL C;  3IH4 A;  2ZJP F;  4RAF A;  1ZG3 A;  3PNT A;  4BH9 A;  1B8I A;  5DTD A;  3GEZ A;  3WGH A;  3BTI A;  4HEA 2;  3RQ4 A;  3ZQ7 A;  1TC3 C;  4CCO A;  5JVT A;  1JXS A;  5LRS A;  1EA3 A;  1LDJ A;  4AU7 A;  2EFN A;  3ABM H;  1PDN C;  4CH7 A;  4CYC B;  2CQQ A;  4FXG B;  2CWE A;  4UUS A;  3LWF A;  1IC8 A;  1AA7 A;  2HXO A;  1PVE A;  4ZDL A;  2VLA A;  2VBW A;  2MLK A;  3F8N A;  3ZXS A;  1R5G A;  3MN2 A;  3F21 A;  4AD9 A;  2ZME C;  2FQ3 A;  2IGN A;  5H6R A;  4C2M J;  2GXB A;  1H9G A;  1HCR A;  2P4W A;  4MFD A;  3ABT A;  1FTT A;  3ISP A;  1TL8 A;  1D8K A;  2JPB A;  2XAU A;  3UKG A;  3OOP A;  4GCV A;  5TGT A;  4P3A A;  2ZNZ A;  3KIO A;  4BEH A;  3B02 A;  2ECC A;  3S16 J;  3HC7 A;  2A69 F;  4MEX F;  2CJJ A;  4HX8 A;  2PLY A;  2MA3 A;  4XKV A;  1I6H J;  2ZFU A;  2DU9 A;  2JZY A;  2H6B A;  3ESW B;  1W5C C;  4ZDP A;  1J59 A;  2L9N A;  2BV6 A;  2ZCW A;  2FEZ A;  2JJ7 A;  4UVA A;  3RKQ A;  4OU0 A;  4CHU A;  4BQQ A;  6PAX A;  1K4T A;  2XPV A;  1HC8 A;  1WI3 A;  3MKL A;  1GT0 C;  3SZP A;  4MLO A;  4D1Q A;  2IBD A;  2BY3 A;  4HLY A;  1L3L A;  3HRS A;  1BC7 C;  1MJA A;  5IOZ A;  3H5N A;  1SFE A;  2P6T A;  3RDI A;  3MKW B;  2Q2E B;  2WC2 A;  2HQA A;  1R22 A;  5BPD A;  1SAX A;  5LEJ A;  1GUU A;  1JUP A;  2LC2 A;  2DA2 A;  1XGO A;  3DPU A;  2RN7 A;  2R7V A;  3F9K A;  1FYL A;  3KLN A;  2KJB A;  3TMO A;  2LMD A;  4OIR F;  4RAG A;  3ECH A;  1G3W A;  2X6X A;  3HKZ N;  3OYL A;  3QOD A;  2FRH A;  5J3L A;  3UNG C;  1QHH D;  4CIC A;  2DPD A;  2M8E A;  1CF7 A;  5EJC A;  1U9O A;  2ETH A;  4CCL A;  4MGR A;  2LBF B;  4W97 A;  3ERE D;  1X2N A;  5ICG A;  1YI2 I;  2OPT A;  4IQ4 A;  2UXX A;  3IV5 A;  4BAC A;  4XIC A;  2E2H J;  2FXA A;  1UHS A;  4IO9 F;  4I09 A;  1KYZ A;  1UG2 A;  5L3F A;  2K9M A;  3HUG A;  3RYR A;  2W82 A;  3OR1 C;  3EET A;  4KN7 X;  4NC8 A;  4RB3 C;  4UHT A;  3HXL A;  5AON A;  3TED A;  1IRX A;  1D3Y A;  1LE8 A;  3BG9 A;  3JSP A;  4MTD A;  2XRL A;  3GME A;  2MFZ A;  2VOD A;  1EH7 A;  2FF4 A;  5CVI A;  3KE2 A;  1ENH A;  1ON1 A;  3M1C A;  3S93 A;  4EQQ A;  1W0U A;  4YEJ A;  1RI7 A;  4CO8 A;  1MMD A;  5KVR A;  2F5D A;  3CCR I;  5BQT A;  1LUJ B;  3WTZ A;  4BYY A;  2L9R A;  3FXL A;  2O8K A;  2DA4 A;  1BL0 A;  2FOK A;  3L1P A;  2OQG A;  1C0W A;  4B3A A;  2FBH A;  2DFE A;  4F7Z A;  1FSE A;  4G7Z F;  1VTN C;  2E34 A;  1XMK A;  4M3G A;  3JAM K;  3I55 I;  4XOT A;  1O57 A;  1WJ5 A;  2HYJ A;  4BNC A;  2B39 A;  2NS0 A;  3JW4 A;  4F52 A;  4PJJ A;  2JVH A;  2EH3 A;  2Q1Z B;  4I98 B;  3HG9 A;  2CQK A;  3HUG B;  3D1N I;  1J09 A;  2VKD A;  3FK7 A;  3FXK A;  3WE3 A;  1Y0U A;  5B5E C;  1CGP A;  2DAO A;  1FIA A;  4NQW A;  2ZXH A;  4DNC A;  1L0O C;  1N75 A;  4B1R A;  1RUN A;  5JPM B;  3VYT B;  2KT0 A;  3I4M J;  3VYS B;  5B4P B;  5CYV A;  2PMZ N;  2VOO A;  1QGP A;  5M5W J;  2BXY A;  2F4I A;  3CUQ A;  4U0W A;  1YJN I;  3CCS I;  1JKP C;  1J7K A;  1MBE A;  1XMA A;  4Q5S F;  2OZ6 A;  2WBM A;  4HV6 A;  3BR1 A;  3TO7 A;  4PDK A;  2QQ8 A;  3CC2 I;  4DJA A;  4Y3O A;  5IT3 A;  1MZB A;  2ZXJ A;  1G59 A;  3DKW A;  1KU9 A;  5GTI C;  1HKS A;  4WWC A;  2EIK H;  2L9S A;  3DU6 A;  4A6D A;  4M74 A;  3HRT A;  1OCC H;  3N05 A;  2XAF A;  1BC8 C;  2E2I J;  4BQN A;  3HKZ A;  2ZME B;  1D8J A;  1ZN2 A;  3OYJ A;  2Q0O A;  3OSF A;  3JRF A;  3E6B A;  3BZ6 A;  4L9J A;  5FLX Z;  2AO9 A;  3TBI A;  1U5T C;  2WV0 A;  2LVS A;  2BY1 A;  1K83 J;  4ZTF A;  1Q1H A;  5H2F C;  1WJD A;  4FHT A;  1S9H A;  3MZY A;  3CJN A;  3K10 A;  3HOX J;  2MG4 A;  4CUG A;  1VFC A;  5L3D A;  3U1D A;  3RTR A;  4HYE A;  5ILU A;  1YRN A;  3OS1 A;  3MAJ A;  3FDY A;  2IVM A;  4XL9 A;  3Q0W A;  1H0M A;  1R4N B;  1BA5 A;  1R6R A;  3GTK J;  2NVT J;  1WFX A;  1X1B A;  4XBF A;  2CV1 A;  1Z7U A;  1F4K A;  2DA1 A;  2YX4 A;  1JKQ C;  4DYC A;  3IUO A;  2QKM B;  3S8P A;  2EB7 A;  3F72 A;  3DU5 A;  4AIJ A;  4YRV A;  3D5R C;  1DGW Y;  5CKT A;  1Z21 A;  3CTA A;  2DOA A;  3WTY C;  2NAZ A;  3BR5 A;  4E7J A;  3K1N A;  1XSX A;  2OC6 A;  2QSG X;  1OYW A;  3M3Y J;  4A93 J;  1IN7 A;  5D5U B;  1XTA A;  2FML A;  2GOM A;  4HOB A;  5J47 A;  1ORK A;  4FTH A;  2LOO A;  1H9T A;  3KZZ A;  4BAY A;  2NS8 A;  4YII A;  1AWC A;  4R1H A;  3K4B A;  4KIS A;  4L5J A;  2QYO A;  4E7L A;  5CQG A;  3G4S I;  3I4N J;  4BL0 B;  5J6X A;  4H4K C;  1JJ6 C;  2VQH A;  3H0D A;  4BY1 J;  2WA0 A;  1WHU A;  2BVL A;  2XAH A;  2B7E A;  3MZH A;  5D5X B;  3ABK H;  1BI3 A;  4A2U A;  4IHV A;  4XQF A;  3T5X A;  4RGR A;  1TWC J;  2KIS A;  3FXJ A;  2H1L A;  1N78 A;  2Y69 H;  2F48 A;  2PMZ A;  4KIG A;  3WTS C;  4M3F A;  4F91 B;  1FJL A;  1BIB A;  3F6V A;  1PUF B;  2W4S A;  4U88 A;  5H6Q A;  3V8K A;  1NK2 P;  1JHF A;  3PO2 J;  4JX4 A;  1R23 A;  2R4G A;  4N9I A;  3PNV A;  1F1Z A;  4CCJ A;  4BE2 A;  2GWR A;  1BR2 A;  3REO A;  2QEX I;  2R7T A;  5FO5 A;  3E1S A;  1QZY A;  5FD5 A;  4GFB A;  2IP2 A;  2ZSI B;  5J8C A;  2ESN A;  3U21 A;  1TW2 A;  2XB0 X;  5BPI A;  3ZMD A;  3WHC A;  2VL8 A;  1P4W A;  1YOV B;  1ZTR A;  1KA8 A;  2XAJ A;  2DMT A;  2PEX A;  1HKQ A;  1TT5 B;  4U7B A;  2KHM A;  4AIH A;  4X0G A;  4HF0 A;  3LFK A;  1P4A A;  2JRM A;  3EUK L;  2PQ8 A;  1S7A A;  1MNM C;  3QU3 A;  2B63 J;  3K1M A;  4OIO F;  1BW5 A;  3GZN B;  3KP6 A;  5IP7 J;  4A3F J;  2OTJ I;  3J80 K;  3MQ0 A;  5FKN A;  3LNQ A;  3C18 A;  2EIN H;  3CUO A;  2HDD A;  1T56 A;  3CCM I;  3LAJ A;  1UHM A;  5D8L B;  1W7P B;  3OS0 A;  1OYI A;  3CQZ J;  3I53 A;  3LFU A;  1HXD A;  2QVO A;  2GIV A;  1SFU A;  4A0Z A;  2BW3 A;  3V4G A;  3VSK A;  4RGU A;  2G7U A;  2LDU A;  4EV0 A;  1UAA A;  1BIA A;  2I8D A;  2ZJ2 A;  2MW8 A;  5H20 A;  3QPL A;  2KL4 A;  2O5R A;  1F43 A;  2D2W A;  3GF2 A;  2H8R A;  4AVZ A;  1APL C;  2P7C B;  2F5F A;  3AFH A;  4Y33 A;  4AIK A;  2O8X A;  1U5T B;  3HZJ A;  1QPI A;  1PJR A;  3IL2 A;  2EFP A;  1YO5 C;  1W5S A;  3ROU A;  1A6Q A;  1Z0X A;  2DDB A;  2E60 A;  2KIU A;  4CDG A;  2RAE A;  3F22 A;  5F0H A;  2QGU A;  4A0X A;  2CS3 A;  4E6K G;  2EA2 A;  2HWV A;  2O0Y A;  3I0T A;  2FBI A;  4WB3 A;  2KRC A;  5IT9 Z;  2ME0 A;  1T98 A;  1FX7 A;  3H9Q A;  3BWG A;  3A01 B;  4IOC F;  1T38 A;  4A6E A;  2JPC A;  2GQQ A;  3OL4 A;  5BMZ A;  5L3G A;  4CXF A;  1VZ0 A;  3TKY A;  1K61 A;  5HS8 A;  3M1E A;  3ZR8 X;  2GBY A;  3HSR A;  5TIS C;  4BUP A;  4ITV A;  2XKO A;  2V79 A;  1JTY A;  2R5Y A;  3CF2 A;  2QUF A;  2XGX A;  3LMM A;  2STT A;  2OUM A;  4LG0 A;  3HHG A;  1G6N A;  1QVT A;  3P9C A;  2ZO4 A;  2RQP A;  5EEH A;  5KCM A;  4CZC A;  2DA6 A;  2KDO A;  3CMM A;  1WKM A;  1QRY A;  3K9T A;  4XLH A;  2F2E A;  3CLQ A;  4FX0 A;  2D45 A;  3K7A J;  2M87 A;  2E1N A;  2L4A A;  2Y9Y A;  3MKY B;  1HA8 A;  4OWR B;  3S2H J;  4LD5 A;  3F3X A;  1T6S A;  1ZGA A;  5GP9 A;  5JI6 A;  4HRI A;  1IN6 A;  4M3D A;  3CME I;  4RA2 A;  2WY7 Q;  1KQ0 A;  5CVR A;  3P9K A;  5HS9 A;  3AG4 H;  3BC8 A;  3C3W A;  1VQK I;  3ZPL A;  2M8G X;  4B44 A;  1B72 B;  3SJM A;  2X9D A;  2CU7 A;  4G94 A;  4AID A;  4LLN A;  4KIT B;  1VQO I;  3RSN A;  3ZQG A;  5DYM A;  2EV5 A;  4BKX A;  4EJO A;  4ENK A;  2X6Y A;  4QTR A;  4EAT A;  2F4O B;  2CQ7 A;  2O6G E;  2OA4 A;  2DK5 A;  2PFB A;  2WB1 N;  3HRU A;  3R0J A;  2V1X A;  3ASN H;  2E35 A;  3OYM A;  2NVX J;  1A04 A;  3F8B A;  2ZXW H;  1IV6 A;  4EM1 A;  3BPX A;  1ZR2 A;  1ZYR F;  2K86 A;  3IH3 A;  3A2K A;  3GTM J;  1FOW A;  1FMW A;  3K69 A;  4Y15 A;  2R93 J;  3BPV A;  1X1C A;  4P55 A;  2VJ5 A;  1FC3 A;  2Y30 A;  1XPX A;  3GYH X;  4L9N A;  2HQ5 A;  1JGG A;  3F8M A;  2ADU A;  4UUT A;  2ECB A;  5DD8 A;  1HW1 A;  4S0H B;  1KQ8 A;  1H88 C;  2A5W A;  3I54 A;  2CV0 A;  2GXA A;  1ETV A;  4GDF A;  1B9N A;  4KIF A;  3A4C A;  5C44 J;  2M45 A;  3QP5 A;  5E3N A;  3I58 A;  1G2H A;  4A3J J;  1IF1 A;  2FMY A;  1FZP B;  3OYE A;  2IAI A;  3OYC A;  1ZRF A;  3SDG A;  1DDN A;  4BBS J;  2QQB A;  2RVC A;  1FMV A;  3GLL A;  2X6W A;  4RB1 A;  2Z9O A;  1UJ8 A;  3KP7 A;  1BJA A;  1ZEL A;  2VJJ A;  2M7A A;  3CCJ I;  3TW6 A;  2DYR H;  3BTL A;  4JK1 X;  2EWN A;  2NVU B;  1T2K A;  4KN4 X;  3WU0 A;  5EG0 B;  4XID A;  3I3L A;  1TP4 A;  1MJ9 A;  4KMU X;  4ABZ A;  2GZW A;  2EIM H;  5L3C A;  1ZQ3 P;  2K40 A;  2VKV A;  2L4M A;  1OMI A;  2M4K A;  2XVC A;  3FMQ A;  1RET A;  1U8B A;  3L2Q A;  3BG6 A;  5FLV A;  3K4C A;  3EUH A;  3O6B B;  4C9Y A;  3PJR A;  2MAB A;  5F0F A;  1XGS A;  2IPQ X;  2O61 A;  2CO5 A;  3ZQI A;  3CC4 I;  2W48 A;  1UB9 A;  3VYU B;  3BG3 A;  3J7Z I;  1R71 A;  5ILS A;  2XF7 A;  4HPQ A;  1U6G A;  2Z33 A;  4IX7 A;  1B6A A;  1MMN A;  3KP4 A;  1OR7 C;  2F5E A;  5GAE J;  1HW2 A;  1UMQ A;  2XRO A;  1D0X A;  1WRJ A;  3BR2 A;  4D9J A;  4HQE A;  3CJT B;  1GV5 A;  4KYW A;  4FT8 A;  3K6G A;  3ZMT A;  5M3M J;  2UWM A;  1KYW A;  2ELH A;  2P5L C;  2WY8 Q;  5D6E A;  4LLG F;  1FPQ A;  4CYC A;  2E2J J;  1VI0 A;  2NOJ B;  2K3F A;  2JTV A;  3FBN B;  4E7H A;  4PSW A;  1MBK A;  4IKF A;  2LTP A;  2ZSH B;  2WAF A;  4N4O B;  3S14 J;  1JI8 A;  3S3O A;  3GTJ J;  1WH5 A;  3DEW A;  3PFY A;  3ZMZ A;  2DQL A;  2FNP A;  1GXP A;  3IHU A;  1LFB A;  5GAG J;  1X1P A;  2CMP A;  4J19 A;  4PJM A;  2KDZ A;  3GTQ J;  3KYD B;  4HQM A;  5LLQ A;  1GLN A;  2IT0 A;  2LP0 A;  2QSH X;  4XLF A;  3PL8 A;  5K7H A;  2DT6 A;  2WAE A;  1NH3 A;  2BHY A;  2KIF A;  2L7K A;  3NAU A;  5DUI A;  5CLS A;  3LSP A;  5LBQ A;  1HDP A;  3A0B C;  3GZ5 A;  4YG2 F;  2Y75 A;  5FRN A;  4F3Q A;  5FD6 A;  3IAM 2;  1R36 A;  4XMY A;  3VOE A;  3FXO A;  4I76 A;  3HOS A;  4UVB A;  3I59 B;  1S3J A;  1QZE A;  2IS2 A;  3MZ8 A;  2HTJ A;  4ENN A;  1U78 A;  4IJA A;  4M9Z A;  1U8R A;  2LYC A;  2Q2E A;  5J40 A;  1FOX A;  1MKM A;  4LK0 F;  1UHW A;  4UU9 C;  1T08 B;  1WH7 A;  4L9V A;  4U0Y A;  1SVO A;  5CPR B;  4A3B J;  4X6A J;  1Z1D A;  4KMF A;  3CMY A;  4ZJZ A;  1UST A;  1RKT A;  4U0V A;  4IZZ A;  3LST A;  3KEY A;  4RM3 A;  4PK4 A;  5IOY A;  1CQT A;  3DWL E;  2HTS A;  4RDU A;  3OYA A;  5LHH A;  4IRG A;  3GFJ A;  1IUF A;  1AKH B;  3K2A A;  2HFH A;  2DMN A;  2DQR A;  2QSF X;  3IC7 A;  1YIJ I;  1RRJ A;  3NEU A;  2LBF A;  2QBY B;  2JQ7 A;  3WG9 A;  2ZXI A;  1MW7 A;  5AIQ A;  4ZH4 F;  4NC6 A;  3G2B A;  4WX9 A;  3U2R A;  3PIP F;  2CQX A;  2QKL B;  2IGM A;  2K9N A;  3HGG A;  2DOE A;  4AWX B;  1ETO A;  5E1Z B;  4NB5 A;  2XF6 A;  1P7I A;  4Q47 A;  4A12 A;  3VWB A;  2YPR A;  5J1U A;  3OYK A;  3DEE A;  4G6T B;  4ESB A;  2Y9Z A;  3SYT A;  5D4R A;  3K1P A;  2KKO A;  3DKY A;  3U1K A;  1UFM A;  4D7M A;  1IGN A;  3KP2 A;  2E19 A;  2YUS A;  3HGY A;  2ISZ A;  1JHH A;  1WJE A;  2LK2 A;  3BOQ A;  3HRM A;  1VQM I;  1TNS A;  3GXO A;  2OTL I;  1KZH A;  1HOM A;  2DOF A;  3QQA A;  2A73 B;  5J1R A;  1V5F A;  4LGW A;  1X1A A;  1WI9 A;  3I64 A;  4FAS D;  1V55 H;  3BY6 A;  1IDZ A;  4GO1 A;  2ZFW A;  3B6A A;  4GYG A;  2EFW A;  3ERM A;  2NNY A;  1JT6 A;  1SMT A;  3ONQ A;  3QYB A;  2OCE A;  3ZOB A;  3EUA A;  3OYD A;  1S5L C;  2GA2 A;  4N4N B;  2RGV A;  5FLM J;  2E7W A;  4XKB A;  3CCY A;  2VUM J;  1XDU A;  2XB5 A;  3GW2 A;  4XOR A;  4EMS A;  5C4J J;  3GWZ A;  3CO6 C;  1EH6 A;  1YYV A;  3EPZ A;  3FIS A;  1W0T A;  1IXR C;  1OCO H;  1YX3 A;  3G1O A;  4PCQ A;  4XLA A;  3G3Z A;  4XRF A;  3JRI A;  1VQP I;  1VQL I;  4N0B A;  1Z77 A;  4A5M A;  1R58 A;  1GHC A;  1DUX C;  3KET A;  3VPR A;  5HDK A;  1IN4 A;  2V26 A;  4B48 A;  3DKX A;  1ZH5 A;  4LB5 A;  1C5A A;  3T8T A;  2KIM A;  4UB6 C;  1R5H A;  5TJJ A;  1ZAO A;  4BHC A;  4XNF A;  4II3 A;  3HOU J;  3KP5 A;  1H89 C;  1V5G A;  3IWZ A;  1FBS A;  1VF9 A;  2DTZ A;  1ZGW A;  4PJL A;  1Y0N A;  3R61 A;  1S7O A;  4JYK A;  2L54 A;  2COB A;  5A2Q K;  1GVD A;  1SFK A;  1YIO A;  1X4P A;  5GAD J;  3WGG A;  4E4H A;  2VON A;  4DOZ A;  1VQ9 I;  1ZRC A;  2HOT A;  1POG A;  4DZP A;  3GFI A;  2IS6 A;  2IXS A;  2EIJ H;  4BJ5 C;  1RZ4 A;  3OYH A;  3O2P E;  4HX4 A;  2ZME A;  1OFC X;  5HOO A;  2DCE A;  5FFX A;  1T39 A;  3RPQ A;  1RUO A;  5TRD A;  1U0J A;  5KNL A;  1D1B A;  4M73 A;  4HG2 A;  5B1B H;  5IY5 H;  2Y31 A;  1T33 A;  4DBR A;  2M5W A;  2V6E A;  1FSH A;  2QZ8 A;  1KGS A;  1G3T A;  4PFP A;  4EM2 A;  3JAM Z;  5EGO B;  2Z5U A;  1OCZ H;  1P7J A;  2R7D A;  5GTH C;  4NHJ A;  3QYE A;  5HNF A;  1LEA A;  3GFL A;  5FGM A;  1MND A;  2DT7 B;  2Z3Y A;  2OCC H;  1SMY F;  1MBH A;  2D5V A;  1XSD A;  2D1H A;  4RAY A;  1RNL A;  5BS6 A;  4CGZ A;  1U3E M;  4ASN A;  5KHD A;  1G4D A;  1VQ8 I;  4PFO A;  2CFX A;  2HVQ A;  2EK5 A;  2V4J C;  4K2E A;  1D5V A;  3ZQC A;  3M8J A;  2K7L A;  4WB2 A;  1Z6T A;  3CCL I;  1A6I A;  2DYS H;  1P6R A;  2PX9 A;  2X51 A;  5DCM B;  1SFX A;  3GTP J;  3RIR A;  2DMQ A;  2X48 A;  3IWF A;  1I5Z A;  1ZLJ A;  3C1D A;  3KZI C;  1KJS A;  3LA3 A;  2YU3 A;  3Q9V A;  4XN0 A;  3E6C C;  1I3A A;  3ULQ B;  1ZHF A;  3G1M A;  4PGH A;  4RS8 A;  1DQU A;  1DU6 A;  1YTY A;  3LSJ A;  2DJI A;  4BS9 A;  1FT9 A;  2M30 A;  4M6V A;  1SD5 A;  2VE9 A;  1JT0 A;  4I02 A;  5B1A H;  2HEO A;  4IQJ A;  4HW0 A;  5J8F A;  2DT5 A;  2CG4 A;  5CVV A;  2IW5 A;  3BR0 A;  4IRI A;  3CU7 A;  1MDM B;  1XGN A;  4O6J A;  4XK4 A;  1FP2 A;  1AU7 A;  2R5Z B;  4BDZ A;  1D0Z A;  1ODD A;  4D7N A;  4B47 A;  5K5O A;  5F64 A;  4FCY A;  3QU6 A;  5HDN A;  3CC7 I;  3WU1 B;  3AKZ A;  2XHK A;  4WCG A;  1TZL A;  2HI3 A;  3RCO A;  1MIJ A;  5E3L A;  4EGY A;  2UZK A;  2NVQ J;  2IGO A;  5JPN B;  4UUV A;  1PUF A;  1K7A A;  2P6S A;  4N9H A;  3BR3 A;  1A31 A;  3IAS 2;  1IXC A;  1BR4 A;  3NRV A;  1PYV A;  1WJC A;  3BQZ A;  4Q4Z F;  1ETY A;  4HNT A;  1YFH A;  4UB8 C;  3VDX A;  3KYL A;  4S05 A;  2CQN A;  4P39 A;  2N8G A;  2BHZ A;  4LLL A;  3E5Q A;  1X3Z B;  3R4K A;  2A61 A;  3Q0U A;  4RBO A;  3TOB A;  4HAM A;  3DLL F;  2HR3 A;  3GTO J;  4YIR X;  3GFM A;  1P92 A;  3WHB A;  3K4M A;  1XCV A;  2V1D A;  2L01 A;  1S29 A;  4NBQ A;  4HDV A;  3BTJ A;  3OIQ A;  1FNN A;  3QPS A;  1FYM A;  2PBI A;  4ENJ A;  2X1D A;  1DPU A;  2LRE A;  2BE5 F;  2FOW A;  1YHQ I;  3QAH A;  4KT5 C;  4YFK F;  3H5R A;  5HLH A;  3CD6 I;  3ML6 A;  1JJ8 C;  3WU2 C;  3CCU I;  3HL2 A;  3LSM A;  3JCU C;  4ZYA A;  1Z3X A;  2XAG A;  3T1B A;  2WAD A;  3C7J A;  2VQC A;  1ULY A;  2XSJ C;  1W7P A;  4X1E A;  3JTH A;  2R0Q C;  1ZG1 A;  3KCC A;  1QA6 A;  1TW3 A;  2BGC A;  4V2G A;  5K5Q A;  2A6H F;  4YFN F;  1E2X A;  2BVM A;  1ETK A;  3I9V 2;  2M7B A;  4QWQ A;  5F27 A;  4BQA A;  1FEX A;  1T0F C;  5L3E A;  3L2C A;  3N97 A;  3KEO A;  1YLF A;  3KZY A;  3S32 A;  1QNT A;  3H3U A;  2Y0M A;  3FHZ A;  1IXS B;  3CCV I;  3HEF A;  1VQ7 I;  3PUF A;  2O9L A;  1EV7 A;  2ESH A;  4G6D A;  4D0P A;  1U9N A;  3TP0 A;  2F6C A;  3R6S A;  1IAW A;  3J7A Y;  2A05 A;  5HLG A;  3TOA A;  4UV9 A;  1S7E A;  2EFO A;  3BJO A;  1W4M A;  4BHP A;  1Z3Y A;  2DOD A;  1U5T A;  1W7P D;  1Z7L A;  2LLK A;  3FMR A;  1R7J A;  3M7G A;  3Q9S A;  4AM3 A;  2G0E A;  1Y8Q B;  4I6Z A;  5M5X J;  4RB2 C;  3SEQ A;  4M9X A;  3CP2 A;  1XC5 A;  4MQV A;  1MMS A;  1PP7 U;  3HM5 A;  1Z91 A;  3LA2 A;  3E97 A;  3LSG A;  1JE8 A;  1KQ9 A;  1ZG5 A;  1ETX A;  2TDX A;  4G7H F;  2EQR A;  4BGD A;  1D1C A;  3DF8 A;  3BP8 A;  1UG0 A;  1IDY A;  3CZ6 A;  3A01 A;  1TLH B;  3D0S A;  4CCK A;  2EIL H;  2VOP A;  2JMW A;  3EDP A;  3MKZ A;  2VT3 A;  4FIS A;  3HPG A;  2G7H A;  4J00 A;  2UV1 A;  4HSR A;  3FKJ A;  3V42 A;  4LK1 F;  3J80 Z;  1I1S A;  3RPU A;  2FUG 2;  1MH4 A;  2X4H A;  2EV6 A;  1Y1V J;  4CSW A;  3ABL H;  2GA1 A;  2DN0 A;  3S2W A;  1WCM J;  2B9S A;  1O4X A;  1DU0 A;  4FE4 A;  3ZRG A;  1VQN I;  5GAH J;  2V6C A;  1GVJ A;  2Z1D A;  5IP6 A;  1W36 C;  2NYX A;  2XDV A;  4ANJ A;  1LQ1 A;  1OCT C;  1EH8 A;  2XIG A;  2VC0 A;  2AQE A;  1J0R A;  2ICW G;  3PFI A;  2HKO A;  1KU3 A;  5FRM A;  2P5V A;  4I0B A;  3W3C A;  2P5K A;  2W84 A;  4DYR A;  3GUD A;  2HPI A;  5D5V B;  4DBQ A;  2P7V B;  2XKP A;  3H1C A;  1RES A;  1P9Q C;  3QRF F;  1X3U A;  4BXU A;  4DYQ A;  1E17 A;  4PJ0 C;  2CV2 A;  2L7M P;  2JA7 J;  2CW7 A;  4PJN A;  5GPC A;  1RPW A;  3T0Y A;  3RPU D;  3NQO A;  1X3W B;  3O3K A;  3VB2 A;  4LG3 A;  1DGR M;  1F9N A;  4LIV A;  2NOG A;  4NDL A;  3T8R A;  1DP3 A;  3DPT A;  5IYD J;  1B72 A;  3U9G A;  2CSO A;  2UXN A;  4W1U A;  2CUF A;  2QQ9 A;  3DBR B;  1RC9 A;  4F55 A;  5E3O A;  3JRC A;  4MQ9 F;  3HSE A;  1LNW A;  3CJQ B;  2LKS A;  1J5Y A;  3H9J A;  2XF5 A;  3FXQ A;  1XN7 A;  3K4K A;  2VBZ A;  5DD4 A;  2JRT A;  3QOE A;  1WVR A;  5EEA A;  3J81 K;  2R7U A;  2MC4 A;  3QPH A;  3FKI J;  4L0Z B;  2CUJ A;  2F4M B;  2WTE A;  3GO5 A;  2R7W A;  2AS5 F;  1AOY A;  1UCR A;  3OIP A;  2F5C A;  4PUS A;  2LNB A;  3VSL A;  5JFR A;  4JQF A;  3SQN A;  2M0M A;  1Q1V A;  2XAS A;  4XR6 A;  2DA5 A;  3GLX A;  5E1X A;  4YFX F;  3L09 A;  3CES A;  3QYF A;  4IHT A;  1F36 A;  4YEL A;  1E3P A;  2K85 A;  4DZJ A;  4ESF A;  4OAY A;  1OYY A;  1QVU A;  9ANT A;  3CDL A;  2HOA A;  5ICC A;  1G3S A;  3SZG A;  3TDU C;  1XD7 A;  3GCM A;  4E7K A;  1B9M A;  4A69 C;  3CMA I;  1WQ2 A;  1D0Y A;  3JR9 A;  3WGI A;  4F93 B;  1Y6I A;  2ELJ A;  3C2H A;  3K2Z A;  5AIP A;  2HZD A;  2MD0 A;  4BU2 A;  4I2O A;  4MO7 A;  2D1V A;  2C6Y A;  4HV5 A;  2W24 A;  2P0W A;  5EG0 A;  1M1E B;  4EJV A;  5M3F J;  2M34 A;  3OWT A;  5B66 C;  3A0H C;  2X1C A;  4RLQ A;  2HOS A;  2V7F A;  1JKR C;  2K3P A;  1OCP A;  1NK3 P;  1A35 A;  4QLC U;  3L2R A;  1I50 J;  4QSH A;  1YJ9 I;  2RC4 A;  3VYR B;  3HPH A;  5ED4 A;  5GPA A;  3HQB A;  3I4P A;  1IW7 F;  3DP7 A;  1MMA A;  2EPF A;  1NTC A;  1LJ9 A;  2IS4 A;  2Z99 A;  1R4M B;  3I56 I;  2GLO A;  3FHN A;  3MFK A;  2R92 J;  4BJ6 C;  1BBY A;  4M9S A;  4PZJ A;  4AYB N;  4V19 K;  3IKT A;  1CFA A;  1V54 H;  2DO7 A;  1Y39 A;  2DDA A;  5FB2 A;  3HOV J;  4GRI A;  2PJR B;  1MH3 A;  2EA4 A;  1SVM A;  4Y13 A;  2L2O A;  5EF6 A;  1QZZ A;  1ZRD A;  3QOP A;  4NNJ A;  1BI1 A;  1WJB A;  1SAU A;  1YQA A;  2EFQ A;  2Z16 A;  1XMX A;  3KFW X;  4ENM A;  3ZQL A;  2NS7 A;  2ZC2 A;  2QLZ A;  2Z2S B;  3MWM A;  3RQI A;  1LFP A;  1U2W A;  4HDU A;  2A07 F;  3W2W A;  4KIB A;  2JA6 J;  2V1N A;  3AL0 C;  3LA7 A;  5LGT A;  2VJI A;  2E7X A;  4D5F A;  2R3S A;  2VIX A;  2K4B A;  2E36 A;  3IH2 A;  2LKX A;  1BW6 A;  3QWL A;  4LJZ F;  1X4O A;  1FBU A;  1SEU A;  3A02 A;  2A3S A;  3JRG A;  1NHA A;  2ZJQ F;  3JRH A;  1HKT A;  1OIS A;  1TQP A;  3FXU A;  4P5O A;  3ELK A;  4M72 A;  4MFE A;  2GXG A;  2ZNY A;  3PUB A;  1KU7 A;  3BZC A;  4LOC A;  3VEP A;  3WTW C;  4J01 A;  2NNN A;  1PUE E;  3HSF A;  4PGG A;  2MYS A;  1TTY A;  2EZH A;  4BXF A;  3SFI A;  3Q5F A;  1TNT A;  2YR2 A;  3AG1 H;  3I59 A;  3PM1 A;  2HDW A;  5JVG F;  4A3E J;  3DQV C;  5LEK A;  3S1M J;  2P81 A;  3W6J B;  3RZD J;  2UUZ A;  2NRA C;  1IUY A;  4XRS G;  3R60 A;  2JSP A;  2LF8 A;  3M8F A;  2HVS A;  1LDD A;  2O3F A;  3F8C A;  3L2U A;  3SDB A;  3NAR A;  3H5A A;  3PQJ A;  1FYK A;  2CW0 F;  3BR6 A;  4XKW A;  1FIP A;  3DXJ F;  3AG2 H;  2H6C A;  3CLO A;  4ZYE A;  2XRN A;  3TO9 A;  1LB2 A;  2KMU A;  1I1G A;  3FXR A;  3BJ6 A;  2E1M C;  3HTS B;  4E70 A;  3OR2 C;  1AKH A;  4LIT A;  1MD0 A;  2LY9 A;  2KIQ A;  2W25 A;  4WF2 A;  5FJ8 J;  4L5I A;  2FE3 A;  2MSY A;  3OL3 A;  5D4S A;  2QBY A;  1EF4 A;  1YG2 A;  3WG7 H;  4B4C A;  2M9H A;  3HYI A;  4RLF A;  3K4N A;  5D5W B;  1YIT I;  2STW A;  3P5J A;  4MEY F;  2I10 A;  3PQK A;  1S8N A;  2PN6 A;  3BTC A;  2B0L A;  3IP4 B;  2JA2 A;  5E8I A;  1O3T A;  1XCB A;  2V9K A;  1SC7 A;  4IHW A;  3OMY A;  4BY7 J;  1MBJ A;  1BOB A;  3GTL J;  1REP C;  4UY8 I;  2V1U A;  3FX3 A;  3W6V A;  5KAF C;  2L0K A;  2FA5 A;  5HNH A;  4ON0 A;  2HGC A;  2TRT A;  4MTE A;  4KT6 A;  4AYB A;  1ACI A;  4P96 A;  1SD4 A;  2WAQ N;  4A3M J;  2VQG A;  2OBP A;  3B73 A;  5HVQ C;  2XGD A;  4Y17 A;  2M0C A;  1LVK A;  2AQF A;  4IHY A;  3WOD F;  3GX4 X;  3WTV C;  1E3H A;  4EJT A;  1P2F A;  2VBY A;  4XSZ F;  1WWX A;  1ZRE A;  2BY0 A;  1EKE A;  1X58 A;  2KJC A;  1I3Q J;  4AUX A;  4A3C J;  4IPA A;  3RJP A;  3FIW A;  5HOD A;  3OV8 A;  4H0E A;  2VC1 A;  1K78 B;  3H9G A;  4OMY A;  3ABU A;  2XGE A;  3C2B A;  1AHD P;  4BDY A;  4IVN A;  3FBI B;  3W2A A;  2V9P A;  1B4A A;  1VND A;  2W1O A;  3DTK A;  1J75 A;  1IN5 A;  2ELK A;  5E1W A;  2VB6 A;  1ERD A;  2KFD A;  2ID6 A;  2W57 A;  1BM9 A;  5E3M A;  2TCT A;  4HF1 A;  1SD7 A;  1OR7 A;  1B8I B;  4KFC A;  2RNG A;  3CUQ C;  2CGP A;  2YU9 J;  5DUK A;  4TV7 A;  5LGN A;  5HS7 A;  1VQ5 I;  3HOT A;  4OIP F;  5EEG A;  3NWS A;  1V3F A;  2L5Q A;  3B6C A;  2HQR A;  1LFU P;  1OJL A;  2ISY A;  3G1L A;  3JRD A;  3O8H A;  2PMU A;  4E7I A;  1HW5 A;  4DGW B;  4LB6 B;  2JUG A;  2HKX A;  4RM2 A;  2PI0 A;  4UUS B;  3OS2 A;  2DA3 A;  5F1J A;  2IGK A;  3DTI A;  4MNU A;  3OYI A;  1IV8 A;  3K70 C;  3GBG A;  4ZC3 A;  2XC7 A;  1X19 A;  4RAZ A;  3AL0 B;  2OF7 A;  1N25 A;  2DFI A;  3S1Q J;  5IYC J;  5CJ9 A;  3FK6 A;  3M9A A;  3DBH B;  2DA7 A;  4C2T A;  1TQM A;  5IPA A;  4BEH B;  1O3Q A;  2QF7 A;  2R7O A;  1KU2 A;  4HLX A;  2K9L A;  1V4R A;  1FWZ A;  4M71 A;  1BR1 A;  2VJ4 A;  2DPU A;  3JRB A;  2VXZ A;  2J5P A;  3DEU A;  3E6D A;  1B1B A;  5EGO A;  1BN5 A;  3W2V A;  3DTE A;  5LFA A;  4ZZL A;  4OIQ F;  2MD5 A;  5FKL A;  1W5T A;  2VPR A;  2VKE A;  3H3Z A;  3W6K B;  3PSI A;  4C3H J;  1O7F A;  1JUM A;  4C2U A;  2HOE A;  4I7H A;  4JX6 A;  2H1K A;  2NVY J;  5HLI A;  1YW7 A;  4C30 A;  2WAQ A;  5J4Y A;  4IXA A;  1MBG A;  1FOY A;  2DBB A;  3PNY A;  5B3S H;  3PIO F;  1SFO J;  3LSH A;  4HZF A;  3PSF A;  4L18 B;  5DCM A;  3HTU A;  4B43 A;  4ZYH A;  3G6E I;  3CDI A;  1ETW A;  2JUC A;  3K0L A;  4DW6 A;  3CCQ I;  2HQN A;  1YJW I;  4FXK B;  1JUS A;  2ACJ A;  1JGS A;  3LQR A;  4EJU A;  4UXN A;  5ICF A;  4P3B A;  1G3Y A;  2E1M B;  2H27 A;  2PMH A;  3R0A A;  5A2Q Z;  1CF7 B;  1WGX A;  2JT1 A;  1Z05 A;  2QCO A;  2LFB A;  4BHB A;  2FD5 A;  4I6O A;  1QPM A;  2DFH A;  1TWH J;  4FQG A;  4MIM A;  5FFZ A;  3HBL A;  4G9Y A;  4A3I J;  1MDM A;  4UNO A;  3CJR B;  2OV7 A;  5LD2 C;  3C2G A;  2KPM A;  2H09 A;  2R5Z A;  2HZT A;  3FMS A;  3H92 A;  5K1Y A;  4GGG A;  4BBR J;  3Q0V A;  4Y7N J;  3S3N A;  2XUB A;  4UVC A;  5ERI A;  2VQL A;  5LHG A;  4A3K J;  3VFZ A;  2JVG A;  1X2M A;  2JWT A;  2RKH A;  2ID3 A;  2LR8 A;  2HDC A;  4CA0 A;  3BLY A;  4RB0 A;  5JR3 A;  4KDP A;  3ZCO A;  2YS9 A;  3L00 A;  1LE8 B;  2KRF A;  2EJR A;  4R8H A;  2EBI A;  1MJB A;  4XLP F;  5ILV A;  5E79 C;  4XM3 A;  4CCN A;  1MGT A;  5FLX K;  2OJE D;  3V8J A;  5FKK A;  1XX5 A;  2BYV E;  2HPM A;  2WWY A;  1R1T A;  2R7S A;  1WSU A;  5ICE A;  4IL6 C;  1ZR4 A;  1GXQ A;  2IEK A;  4BQO A;  1BOA A;  1W1W E;  2H94 A;  1JKO C;  5C3E J;  5FKM A;  2K9Q A;  2FU4 A;  4OOI A;  5KK1 A;  1A36 A;  3DFG A;  3BT9 A;  3L2W A;  1WZ2 A;  3S2D J;  3MEX A;  3RI4 A;  4O5V A;  3BCB A;  3MVP A;  5F0C A;  1QO0 D;  3TL4 X;  3P7N A;  1Z67 A;  3HB9 A;  4XN3 A;  3LAP A;  5DM7 F;  5DV5 A;  4CYD A;  2A5Y B;  1LVA A;  3V7S A;  2X0L A;  2RRE A;  3SZT A;  2Q8K A;  4S04 A;  1FBQ A;  1GV2 A;  4DIQ A;  5E20 A;  3HDD A;  3M8E A;  3KYC B;  2L3D A;  1IJW C;  3F8F A;  2OD5 A;  1OCR H;  3DLA A;  1R1U A;  3RKX A;  3LSK A;  4PSX A;  3N4M A;  4NQW B;  4A3G J;  3E0J B;  3BG5 A;  1LKX A;  3LQQ A;  3CP8 A;  4RGX A;  1XG1 A;  2W00 A;  2JSC A;  2FNA A;  1O3R A;  2YSR A;  1XSV A;  3GVA A;  3SFZ A;  3CUQ B;  2XV4 S;  3TW7 A;  2DK8 A;  1S6L A;  4XLC A;  5DEQ A;  1H8A C;  3BG7 A;  4ZZD A;  5F08 A;  5K7F A;  3K70 D;  2QEN A;  2OQR A;  4Z2Y A;  2ZJR F;  4A0Y A;  3M07 A;  3S1N J;  2EZK A;  4IHX A;  3EQL F;  3P9I A;  4QPQ A;  3ZQF A;  3HOY J;  2QA4 I;  3E5U A;  1I27 A;  4KA4 A;  1J2X A;  4JBA A;  3OSG A;  2CYY A;  2CUZ A;  2Y2Z A;  1HST A;  1MNE A;  1G8X A;  5M5Y J;  2VT2 A;  5D6F A;  3UR3 C;  2XPW A;  2FBK A;  2OAZ A;  3S3M A;  4XRM A;  2DXI A;  5CVU A;  1T8I A;  1TQI A;  4FX4 A;  1P4X A;  2LSO A;  4FET A;  4JX5 A;  5JHF A;  4AC0 A;  4DQ2 A;  5E8G A;  1FP1 D;  1YRN B;  2E5Z A;  4LFU A;  3FZV A;  5EYR A;  5EZH A;  4RMN A;  4XSX F;  1TWA J;  4LMY A;  2DW4 A;  3E7L A;  2OU2 A;  2KP6 A;  2LY2 A;  1YW9 A;  4FE7 A;  4OMZ A;  2EZI A;  5F04 A;  2FJ1 A;  1IO2 A;  2PG4 A;  4IRH A;  4B3X A;  3H3V K;  4JP0 A;  2A6E F;  3DV8 A;  3RYP A;  3S17 J;  5F6F A;  1RR8 C;  2L02 A;  5JLW A;  2EV0 A;  1VQ4 I;  2BXZ A;  2ME6 A;  2K9S A;  2KRH A;  2VBX A;  2ZBK A;  2I5U A;  3AG3 H;  5IP9 J;  2DI3 A;  1UEL B;  2HVR A;  2HS5 A;  2VKH A;  3ZQQ A;  4L9T A;  2MLG A;  1BI0 A;  2R7X A;  1D1A A;  4E7Z A;  2HU9 A;  3X2Q H;  1A5J A;  3Q3S A;  3BRO A;  4M3B A;  5D8K B;  1NG6 A;  5LGU A;  1MSF C;  3ASO H;  4M3E A;  1I6X A;  3GTG J;  2ZB9 A;  2GIZ A;  4L0Y B;  4HW5 A;  1PP8 F;  4ZDO A;  3I71 A;  2RQQ A;  1T95 A;  3JTG A;  3WE2 A;  1O7L A;  2P8T A;  1LEB A;  2MBF A;  1ZKG A;  5K5R A;  3HQA A;  2LH9 A;  3E5X A;  3O8G A;  2X1E A;  2J5O A;  1ON2 A;  3LOC A;  5E17 F;  2Y0S N;  2AXL A;  1TWG J;  4BJT A;  3BZK A;  2HYF A;  5LHI A;  4KNY A;  1QQI A;  3TO6 A;  5LRR A;  1R1V A;  3HHH A;  4V2F A;  4ETS A;  5J1Y A;  4R79 A;  2ZKZ A;  2R7Q A;  2DFF A;  1JTX A;  2IA0 A;  3ZMS A;  2XSD C;  2JA5 J;  5L3B A;  2L7Z A;  4P1W A;  3K4J A;  4Z6Y A;  2E1O A;  4BE1 A;  3L9F A;  4ZYG A;  2IJL A;  2L7F P;  1ZAR A;  3WTU C;  4G8X A;  5EDN A;  4BE0 A;  1Y56 A;  2G9W A;  4I01 A;  4WXH A;  5IT9 K;  1SD6 A;  2JN6 A;  4I0A A;  1QBJ A;  2LF7 A;  2R7F A;  2NXN B;  3OOU A;  5DDG A;  4B8X A;  3V7R A;  3D5S C;  2XGC A;  3H35 A;  4HNV A;  2K27 A;  3RKW A;  3OY9 A;  2LG4 A;  2BBY A;  4IOA F;  1TBX A;  3BQY A;  1K6Y A;  1F5T A;  1ZK8 A;  4KIC A;  4XON A;  4XRS A;  4KJZ A;  1ITY A;  1SAN A;  4RGS A;  2KQR A;  3IRR A;  4HX7 A;  1DP7 P;  1XB4 A;  2L9V A;  4G12 A;  5IYB J;  3WTT C;  1IZ1 A;  4ESJ A;  2GOX B;  3TQN A;  3COA C;  4NUB A;  3FM5 A;  1ETQ A;  1YW8 A; 
#chains in the Genus database with same CATH homology
 3D5R C;  1DGW Y;  4BXF A;  5CKT A;  1Z21 A;  3EPZ A;  2DOA A;  4E7J A;  2HDW A;  4OAZ A;  3DQV C;  1YX3 A;  4XLA A;  2OC6 A;  3SEZ A;  2BW3 B;  2UUZ A;  1YE9 A;  2JSP A;  2HVS A;  2GOM A;  3OYG A;  3L2U A;  2LOO A;  2V26 A;  3SDB A;  3NWT A;  3H5A A;  4B48 A;  3DKX A;  4E7S A;  4XKW A;  3K4B A;  3EUH C;  4KIS A;  4XNF A;  4E7L A;  4II3 A;  5CQG A;  1V5E A;  1V5G A;  2KMU A;  4BL0 B;  4H4K C;  2VQH A;  3H0D A;  2WA0 A;  1QU3 A;  4PJL A;  2E1M C;  2BVL A;  3OR2 C;  2LY1 A;  4LIT A;  3OYB A;  4XQF A;  2VXD A;  2BOL A;  5CQE A;  3OL3 A;  1SFK A;  4E4H A;  1X4P A;  1N78 A;  3OYN A;  4DOZ A;  2W7N A;  2PMZ A;  4RLF A;  3K4N A;  2IS6 A;  2IXS A;  4BJ5 C;  4F91 B;  3OYH A;  1YX5 A;  3IP4 B;  2W4S A;  2JA2 A;  5HOO A;  2DCE A;  2V9K A;  2PJR A;  3OMY A;  4LIU A;  1WJF A;  1BOB A;  1U0J A;  2R4G A;  1N77 A;  5KNL A;  3PNV A;  1D1B A;  1KON A;  4HG2 A;  4CCJ A;  4BE2 A;  5HNH A;  1BR2 A;  2R7T A;  4KT6 A;  4DBR A;  4AYB A;  2V6E A;  3E1S A;  2ZSI B;  2Y0S A;  2VQG A;  4PFP A;  4JOM A;  3L2V A;  3U21 A;  5HVQ C;  1MMG A;  2CH0 A;  1LVK A;  2AQF A;  3QYE A;  5HNF A;  2VL8 A;  2CFO A;  1MND A;  2DT7 B;  4U7B A;  2KHM A;  4X0G A;  1QHG A;  4XLE A;  5KHD A;  3EUK L;  4PFO A;  2HVQ A;  2V4J C;  3H9G A;  3M8J A;  3LL7 A;  2X51 A;  1NG7 A;  2E5N A;  2IS1 A;  2M4G A;  4BDY A;  3FBI B;  3W2A A;  3OS0 A;  3LFU A;  2W1O A;  3DTK A;  4Y4R A;  4XN0 A;  1LDK B;  2VB6 A;  1ERD A;  2BW3 A;  3VSK A;  1E0E A;  2CW8 A;  1DQU A;  1OLT A;  1UAA A;  4II2 A;  2DJI A;  4BS9 A;  2M3A A;  2I8D A;  4IQJ A;  2RNG A;  3HOT A;  3NWS A;  2KL4 A;  2L5Q A;  1W36 D;  2O5R A;  4CCM A;  4XKC A;  2F5V A;  4AVZ A;  4BDZ A;  4E7I A;  1D0Z A;  4DGW B;  4B47 A;  2JUG A;  3AFH A;  4RM2 A;  3OS2 A;  4Y33 A;  2KLO A;  1PJR A;  2IGK A;  3DTI A;  3AKZ A;  3OYI A;  4XOP A;  1TZL A;  3OYF A;  3RCO A;  2E60 A;  3KX2 A;  3K70 C;  3GBG A;  4HST A;  3K4L A;  2IGO A;  4ZC3 A;  2CS3 A;  4E6K G;  2XC7 A;  1X19 A;  3LSI A;  3AL0 B;  4F92 B;  3IAS 2;  1BR4 A;  2KRC A;  3D5L A;  1PYV A;  1WJC A;  2R7R A;  3H9Q A;  4HNT A;  4C2T A;  3VDX A;  4BEH B;  3KYL A;  2K5C A;  2A6T A;  2R7O A;  3OL4 A;  1TT0 A;  2K9L A;  1VZ0 A;  1BR1 A;  2VJ4 A;  4QPO A;  2VXZ A;  3ZR8 X;  3W2V A;  4BUP A;  4ITV A;  3DTE A;  5LFA A;  3K4M A;  3PSI A;  5FRO A;  3CF2 A;  3LMM A;  4C2U A;  3OIQ A;  2OUM A;  2LRD A;  2HNH A;  4C30 A;  2WAQ A;  2X1D A;  3PNY A;  1X1D A;  2LRE A;  4ZTJ A;  3A1Y A;  5KCM A;  3LSH A;  4CZC A;  2KDO A;  2VAS A;  3H5R A;  3PSF A;  3CMM A;  3MMY B;  4B43 A;  4XLH A;  2X85 A;  4NC7 A;  2KZV A;  3LSM A;  3HL2 A;  4ZYA A;  1Z3X A;  5HLT A;  3ZGK A;  2WAD A;  2VQC A;  3MKY B;  2XSJ C;  4OWR B;  2WB1 A;  4U87 A;  1HA8 A;  3BCA A;  1WJA A;  4HRI A;  3MD2 A;  2E1M B;  2VPL A;  2BVM A;  4HNU A;  3I9V 2;  2WY7 Q;  2M7B A;  3DPL C;  1T0F C;  3PNT A;  3BC8 A;  3S32 A;  4B44 A;  4HEA 2;  3RQ4 A;  4CCO A;  4KIT B;  3CJR B;  2OV7 A;  3RSN A;  5LD2 C;  3C2G A;  2KPM A;  1EA3 A;  2F6C A;  3J7A Y;  4AU7 A;  2X6Y A;  4EAT A;  4CH7 A;  3OYM A;  3S3N A;  4FXG B;  2VQL A;  1Z3Y A;  2JVG A;  1AA7 A;  2VLA A;  1Z7L A;  4ZDL A;  4CA0 A;  3A2K A;  3BLY A;  3ZCO A;  3ZXS A;  1FMW A;  3SEQ A;  3CP2 A;  2IGN A;  4XM3 A;  1X1C A;  2VJ5 A;  4CCN A;  3LSG A;  2XAU A;  2HPM A;  5TGT A;  4BGD A;  1D1C A;  1UG0 A;  2R7S A;  3CZ6 A;  4CCK A;  4BEH A;  4BQO A;  2A5W A;  3HC7 A;  3MKZ A;  2CV0 A;  3HPG A;  3L2W A;  4XKV A;  3A4C A;  2ZFU A;  4J00 A;  2UV1 A;  4HSR A;  3BCB A;  3FKJ A;  3V42 A;  4ZDP A;  2L9N A;  3TL4 X;  3OYE A;  4XN3 A;  3OYC A;  2FUG 2;  1FMV A;  2RRE A;  2X6W A;  4BQQ A;  4DIQ A;  4CSW A;  1ZEL A;  2VJJ A;  2M7A A;  4MLO A;  3ZRG A;  3DLA A;  4D1Q A;  3LSK A;  4PSX A;  2Z1D A;  3H5N A;  1W36 C;  4NQW B;  3MKW B;  2Q2E B;  2XDV A;  3I3L A;  4ANJ A;  3E0J B;  2HQA A;  2AQE A;  1LKX A;  3CP8 A;  2LC2 A;  5FRM A;  2W00 A;  2M4K A;  3W3C A;  3DPU A;  2HPI A;  3L2Q A;  3BG6 A;  2R7V A;  3F9K A;  3K4C A;  4C9Y A;  4DBQ A;  3TMO A;  3PJR A;  2MAB A;  1P9Q C;  4XLC A;  3VYU B;  2X6X A;  3OYL A;  2CV2 A;  3BG7 A;  3QOD A;  3K70 D;  3UNG C;  2CW7 A;  4PJN A;  2XF7 A;  1QHH D;  4HPQ A;  3RPU D;  4IX7 A;  1MMN A;  4CCL A;  2LBF B;  4LG3 A;  1DGR M;  1OR7 C;  4QPQ A;  4LIV A;  1D0X A;  1DP3 A;  4D9J A;  3DPT A;  4IQ4 A;  4BAC A;  3K6G A;  2CUZ A;  2UWM A;  2WY8 Q;  2K9M A;  1MNE A;  1G8X A;  2W82 A;  3OR1 C;  4F55 A;  3UR3 C;  2NOJ B;  3CJQ B;  3FBN B;  4NC8 A;  4PSW A;  4E7H A;  3H9J A;  4IKF A;  2XF5 A;  2ZSH B;  3HXL A;  2WAF A;  3K4K A;  4N4O B;  1JI8 A;  3S3M A;  3S3O A;  1IRX A;  2DXI A;  3QOE A;  2R7U A;  3PFY A;  4FET A;  2MC4 A;  2MFZ A;  5JHF A;  2CUJ A;  2R7W A;  3M1C A;  3S93 A;  3OIP A;  2CMP A;  4PJM A;  4YEJ A;  4PUS A;  3VSL A;  2E5Z A;  1MMD A;  4JQF A;  2M0M A;  1GLN A;  4RMN A;  4XR6 A;  2KP6 A;  4XLF A;  2LY2 A;  3PL8 A;  3CES A;  3QYF A;  2DT6 A;  2WAE A;  4YEL A;  4B3X A;  2L7K A;  4OAY A;  4XOT A;  1WJ5 A;  3SZG A;  4F52 A;  4E7K A;  4PJJ A;  2JVH A;  5FRN A;  1D0Y A;  4F3Q A;  2KRH A;  4F93 B;  3IAM 2;  1Y6I A;  2ELJ A;  2Q1Z B;  3C2H A;  4XMY A;  2HZD A;  2MD0 A;  3HG9 A;  4BU2 A;  3HUG B;  3HOS A;  1UEL B;  1J09 A;  2IS2 A;  2VKD A;  2HVR A;  2VKH A;  2P0W A;  3ZQQ A;  2LYC A;  2ZXH A;  3OWT A;  1N75 A;  5JPM B;  3VYT B;  2R7X A;  1D1A A;  2X1C A;  4RLQ A;  5CPR B;  3VYS B;  2V7F A;  2HU9 A;  4E7Z A;  2K3P A;  1NG6 A;  4ZJZ A;  4IZZ A;  2F4I A;  3L2R A;  3KEY A;  4RM3 A;  4PK4 A;  3VYR B;  3DWL E;  2WBM A;  4ZDO A;  3OYA A;  3HPH A;  2RQQ A;  1T95 A;  1MMA A;  4DJA A;  4Y3O A;  1G59 A;  2IS4 A;  2LBF A;  2LH9 A;  2L9S A;  2ZXI A;  3DU6 A;  1MW7 A;  3FHN A;  4BJ6 C;  2X1E A;  3G2B A;  3N05 A;  2QKL B;  2IGM A;  4BQN A;  3HKZ A;  4BJT A;  3OYJ A;  2XF6 A;  4GRI A;  2PJR B;  3VWB A;  2L2O A;  4R79 A;  3OYK A;  3TBI A;  2R7Q A;  3DEE A;  4G6T B;  4NNJ A;  2Z16 A;  1WJB A;  1SAU A;  3SYT A;  3DKY A;  4ZTF A;  1WJD A;  4P1W A;  2Z2S B;  3K4J A;  1S9H A;  1WJE A;  1LFP A;  3K10 A;  3W2W A;  4BE1 A;  3AL0 C;  2V1N A;  4CUG A;  4BE0 A;  1Y56 A;  2VJI A;  1V5F A;  3RTR A;  2VIX A;  1X1A A;  4FAS D;  3OS1 A;  3OOU A;  3FDY A;  4XL9 A;  3D5S C;  3H35 A;  1X4O A;  1R6R A;  3OY9 A;  2LG4 A;  3ONQ A;  1WFX A;  1K6Y A;  3QYB A;  1X1B A;  3EUA A;  4P5O A;  3OYD A;  2CV1 A;  4XON A;  4KJZ A;  3PUB A;  2KQR A;  4N4N B;  4J01 A;  2GOX B;  4XKB A;  3IUO A;  2QKM B;  4NUB A;  3S8P A;  4XOR A;  3DU5 A;  2MYS A;  4YRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...