5JPMB

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 189
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 5jpmB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpmB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpmB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpmB04
4A6YB 1OLLA 3OAUL 5A40E 3DROB 2GEEA 4R8WL 2YBRB 2XZAL 1RFDL 2QQKL 3L9RB 5F70A 4E0RA 4Z7UA 2HJLA 4PUBL 4LMQI 4I0PB 4RGOL 4IHOB 4BYHA 2OR7A 1PKQE 3KDMB 1BX2B 4Y8AA 4HZAA 4X0KA 5I19L 4NQDE 3W11D 4FQIL 5E5UB 2O93L 5BS0A 4XCFL 2JJWA 1AGDA 2OXHA 1T6VN 3K8LA 3P4NB 3F62A 4LLMA 4R26L 5T1LA 3H2WA 4AL8L 2BVYA 1TZHB 4F2MA 2FX9L 2B39A 2H6IB 1A7OH 5F7DB 1IGIL 3VRJB 3VH8A 3P2TA 2YUWA 5SWSD 1MY5A 2VLMD 4G8GB 3PL6C 3ZKSD 1A3QA 1EZVX 3RZCC 3UJTH 5TE7L 3ZHKA 4MJIB 4FQLH 4HG4K 1CE6A 4OKDA 4HKJB 4J3TA 1WBXB 3EDJA 2R1YA 4Y4KB 5HBBA 3EUUA 2OXGA 3MPCA 4NZUH 1GGCL 5DMYA 2CIKA 2CDFB 4L8BA 5DQ9B 3GBML 3BGMB 2OCFD 4PJ9B 1JCRB 4ODSH 1WVZA 1J8KA 4TQEL 4YE4H 5BO1L 4KDTC 1LDSA 2Q8BL 2JCCE 4PJIE 2R9HD 3CFEB 1AP2A 4JE4B 5J1AB 2XN9E 4KRPC 2YD3A 1NBZA 2F53A 2OQJA 3KNBB 4BK5A 1VFAA 2YRZA 3WE6A 2B4CH 3VFTA 1XGRA 4FQHA 4K7PL 1P4BL 4F7TB 4WI6A 1A3LH 1D7FA 1P9MC 2CGRH 4PJDA 1RAMA 1N0XL 3MXVL 3PZ2B 3FQUB 2ADFL 4WFGD 1D5ZB 5DVOA 4LLVA 1MF2H 4WHDA 4XWOD 4HXAH 4J3UA 4ODXA 4P5TA 1I7RA 2VDLL 1YMHA 3ALXA 5SWQB 4LLQB 1OWWA 3CUPB 4AT6B 3KWWA 4R7NA 1QBLH 3G6DH 4HWZA 2HMIC 4MAYB 1G7QB 4KJWC 2VQ1B 4NQSA 1H8NA 3I6LD 3GSNB 4FXKB 3OKDB 2PO6D 4RWHA 3WFCH 4KKCD 4OCRH 5IFAH 2EC9T 1CXKA 1MPAH 1GZQB 3W9DB 1AQDA 5HVHB 4H0IA 1QQDA 3LKQA 4KK9C 1QSFE 5FO8B 1P9MA 1N6QL 3FQRA 1QLRA 4HC1H 4GW4B 5FK9A 4WW2A 3LB6C 1I9JL 4J3WA 1E4WH 4OZFB 1ACYH 5GGSA 1MHEB 4NYLA 1A7QL 4JFYB 5C0DA 1CXFA 3H7LA 3QEHA 3EOBA 2HTKC 5FYKL 1C7SA 3IJHA 3QWRD 4D3CL 1Q9LA 2H6HB 1HXYA 2M8XA 5CD3B 2IH3A 4LGSB 3V6FB 4MAUL 1NMBH 4KMTH 4X4YA 3GK8H 1ZV5A 3O6FB 3PL6D 1KCSL 1BIIA 1NCWL 3RZCD 2XTLA 1DQJB 1UZ8B 1SQ2N 2F53D 2ZUUA 4NT6B 4P46A 4GG8B 1LD7B 5JPMA 3HUJB 1F8TL 1UM5L 4G8EA 1ETZA 1VPOH 1QFWM 1VA9A 3P77A 2EDYA 4O02L 5E94A 3SE8L 2M2DA 3CC5A 1BQHG 1IC7L 4KKAC 3S3PA 3ZO0A 2VXTH 2G9HB 3PWUB 5DTFB 2X9WA 3IFPA 4M62L 3KJ4B 4N1EA 3QULB 3RAJH 5F7NC 2D7PA 1GPOL 1KIPA 4KTEH 1TPXB 4BM7A 2VH5L 3KLAB 4PJBE 4X4MA 4XVTL 4KRPD 3BP7B 3HMXL 1P4IH 2YPVH 4QRPE 3D3VA 3NCCB 1CDGA 3MOBL 2A6KB 3C6SB 3OKEB 4NZRH 3RX7A 4XTRC 5D2LF 1FFPB 5BW7C 4JPKL 3ARGA 5DMJB 4DVBA 2IG2H 1UQSB 3CH1A 3RJDA 5ITFB 3OAUH 4ZXBA 4H20H 4R8WH 5A2IH 1CD8A 4YBLC 4DUWA 4V1DB 2V5MA 2XZAH 3BEVA 1RFDH 2QQKH 2Z8RA 3H9YA 3M17A 4PUBH 2VYRE 4P2QD 5L8KB 4RGOH 1QFWH 1GC1C 1YN7A 5BRZE 2HMID 1BAFH 1I8IA 2AVGA 3NABL 2KH2B 5CEYB 4ODWB 2EH8L 4KJWD 3KAAA 1Z5LA 4XCFH 1BEYL 4JJ5A 4N8VG 4R26H 3FB5B 1UJ3B 5L6YL 3KVQA 2WWKT 4ZDHB 3BH8A 4YO0A 4NCC2 4AL8H 3T77B 5C0NC 4KK9D 2FX9H 4IRSA 4S10A 1TNOB 2BSSA 1IGIH 1W0VA 1XAUA 1M1SA 1MJ8L 3LB6D 4GRLC 3JVGA 4JQVC 5ID0B 3VXUA 1GJIA 5TE7H 1TETH 4L8DA 3Q0HA 2IFFL 5BZWA 4OUUB 5BXFB 4Z5RA 5MI0B 4DK3A 4YHZL 4YDJB 3P4OB 3BMVA 4ZODA 4PGEB 4LNVA 3IGAB 3ISWA 4NQDD 2HTKD 3LPWA 3L3HA 5EU6D 4WWKA 4H26B 3SKNA 3BPOB 1K8DB 1K4CA 3WNMA 3S96B 3U9UA 2DLGA 4YBQC 1AQKL 1FZOB 2UZIL 3GJFH 5KN5B 3K4AA 3DHMA 5EA0L 2BVEA 1P7KB 3VRIA 3TVMC 2ARWA 1D5IL 1U8IA 5GSVA 4TQEH 2YD1A 1AD0B 2Q8BH 4M6NL 3BYYA 2PR4L 1AO7D 5E8OA 3SN6N 3R8QA 1JTOA 1J5OL 1YYLL 4ISVB 3RTQA 3VG0L 3SDXB 1BVLA 3T1FA 3UYRL 3SJVA 4W68A 5TFSL 4K7PH 1P4BH 1NC4B 3QAZB 5F3HB 3PQYB 4KKAD 4PLJC 1U92A 3C5SA 1Z0NA 1N0XH 1TN7B 3MXVH 3ESUF 2JJUA 3H42L 4TUOA 5JQ6L 5I1LA 4L3AA 1CG9B 1XCQA 4F7CB 3TVMA 3NMEA 4HBQA 4OFVA 2WBKA 3TNNB 4X9BA 4LBEB 3ZTJH 3SE4C 4NKDB 2EECA 3ILQC 3KYOA 5AWNL 1KB5A 5C9JA 1U8HB 4PGDB 4XTRD 3EDKA 2OR9H 4LPXA 3L5IA 3LN4A 4FFZH 5D5MB 5F88B 1Q9KB 1I7TB 4ZUWB 1IGYB 5ENWA 2IFGA 1N6QH 3K3QA 3IFNL 1S7UA 3VXUD 3GSXB 4X9GA 4WFFE 5D7KE 4C56A 4X6DA 1SA5B 2XKNA 1KG0A 5DD6A 4ZUVA 1A7QH 4UINL 1Z9OA 2RBLA 4FP8L 4R4FL 1FNEB 3RPKA 4JM2B 3I3BA 5CBEB 1T0MB 2DQGL 5FYKH 5C0CA 4K23H 1NL0H 4D3CH 2GY5A 4NDMB 2B20A 5DHVA 5C0ND 2VDRH 4WI4A 3V7AE 1OP9A 4MAUH 4JKMA 5FCSH 2UWEF 5DRNB 3KYMA 1KCSH 4PTUA 3N85H 2A9NL 2GSIA 4GRLD 1IAKB 5C71A 5IG7A 4FMKA 1WAAE 3LQZB 2BFVL 5EZLA 4X5XA 2BXYA 5LXGL 2X70A 3K2UL 4NQXA 5FGCE 2DB8A 3SJVD 4NQCE 3P0GB 1KJ3L 3MRBB 2BVUA 1T0NB 1Z0MA 4JRXE 3IDGB 3PZ1B 3L6FB 4O02H 3HZKB 3SE8H 4YBQD 1IC7H 3BDBA 3GSWB 2BHYA 4ZH1A 5IKCA 5J1TC 4FQ1H 5F8RC 3TVMD 1SY6L 1PKOA 3LAFA 4J8RB 1YYMH 4MS8C 5F89B 4QOKA 5JHDE 1HH6B 1CFQA 4N0FA 5DVNA 3R1GL 4HAFA 4LSQL 1KYOK 2D4FA 4U6XA 2BB6A 3HMXH 3CSGA 4JZJA 3TV3L 4GTRB 4P4RB 4PRDA 2R0LL 2XQYG 4EI6A 3G5XA 4XGZB 4JPKH 4ELME 1KSRA 4GOSA 3NGBB 4Y4FC 1BLNB 2FZ3B 4PLJD 1R3JA 1HQ4B 3SY0B 4Y19A 1RJZB 4BFBD 1W72B 4QY8B 3TBSA 2JB5L 1S9VB 4WY7H 2LAAA 3NABH 4YUEL 3X14B 4HAGA 2EH8H 3ILQD 1VEPA 5B3NA 3K81A 2HVJA 4S1SH 4PJAF 2X7LA 9CGTA 1HE7A 3O3AB 4PJHF 1BJ8A 4GW5A 1HIML 1KJ2A 2HFGL 3HPJA 3E33B 1NEZG 2PMVA 3DSNA 3SGDI 5FECB 1ED3A 4PR5A 4YHZH 4E42B 2C3VB 4Z0XB 3VGFA 3QDJE 4H1LA 2QQLL 1ZAGA 1F02I 2BOCB 2DM4A 1IGTA 1N4XH 4N0RA 1AQKH 4NFCA 2UZIH 4XZUA 2EDLA 5EA0H 4KZEL 4GTTB 5J0BA 3HZVB 4OI9A 2J8HA 5J8OA 3O6MH 4QOKD 2QLVB 3MLYL 2J8UA 4MNHA 2W91A 1HHIB 3QPXL 2PR4H 3VFNB 1L0XA 4LL9A 3PHOB 4H8WC 1J5OH 2PETA 1YYLH 1F4HA 3VG0H 5D9SA 4X6EB 3BW9B 3UYRH 3Q6FB 1FGNL 4IOSD 4GAJL 2DLHA 2R8SL 1EVUA 4GW1A 2NY6C 4OKVA 3WUWG 1DLHB 2VITB 1T04A 4YDIH 3KYNA 3WFEH 3H42H 5TDNB 4F15B 2K7PA 4Y7MA 4JG1L 2VL4A 1MHCB 1UCBL 4E41A 4MS8D 1AD9B 4QTHB 4EDXB 5ESAA 1H5BC 2ADJA 4P3CL 2X4QB 1DBJL 5KZCB 3TWCL 3MRCA 1FDLL 5AWNH 5A2JH 5JXEC 4QYOA 1T2XA 4G8GE 2IF7A 1AI1L 3TO4B 3LKSB 4BQBA 3QUXA 3PIQB 4FMFA 5DJXB 1U3HC 4WTWA 4KWUA 4Y4FD 3DX9A 4OGZA 1Q9WA 1T83A 1WZMA 2DLIA 3OKOA 1FZMB 4L3EB 4M7LT 3IFNH 1FYTE 1D6VL 3D39B 4N5EC 5CGYC 2Y1VA 2BDNL 2CLZB 5F7MC 2VZ1A 2Y4SA 5GGRA 1H5BA 4N0CC 4JFZH 4FP8H 4R4FH 3S4SB 3BZFB 1ORSA 2DQGH 2VZTA 5I1AB 4GUPA 1H36A 2X5PA 1NEZA 4APQB 1ZHKA 1G7PA 1NJ9B 3B9VA 5T1MA 1S5HA 4MXVF 3MCG1 3QQ4B 5KG9A 5IV2B 1U3HA 1L7TH 3C5JA 4Y5YB 4JFFB 4ZQKA 5H35A 1BGXL 4M7KL 5HHOA 3EOTH 2A9NH 4HF5L 4YDKL 3FHAA 4BSJA 1M7XA 2OL3H 4ZMAT 1QG3A 5HHMB 1N5AA 5LXGH 3MNWA 3UPRA 3K2UH 3ZSTA 4KMQA 2FYYA 1NAKH 3IB4A 4XAKD 5B22A 1W8NA 1RVFL 4Y89A 1Q72H 2WQRA 1KJ3H 1S9KC 2A6JB 3GHEL 2BCKA 3TIEB 3ALPA 5E9DA 2PNDA 1S7QB 4WNQB 1W6JA 1DVFC 4U1NB 4FTVD 3JTSA 1GGIL 4Z7WF 2VDKL 5MENB 3SCMB 3R1GH 1N6VA 4FXLA 2AJXH 1CXEA 3VFVB 1Y0LA 3TV3H 4F57H 5JOPE 1JRHI 4AZ8A 5DRWA 1KIRB 4HZLB 3O41B 2R0LH 4CL7A 1CZ8L 4NM8H 5TPWH 1BZ7A 3U0WH 2NY6D 1FL5A 4NQCD 1G9NL 3HC4L 2APFA 4Y2DA 5EO9A 3ARWA 1M7DB 2VLJA 4JRXD 3RVXC 3RWGB 7FABL 1J0JA 4JANA 3D0LB 3MLTA 1C16A 1DVFA 1FVDA 3MV7B 5ID1A 3VI4E 1E6JL 3ARDC 4YUEH 5GJSL 2Z91B 1T0PB 4XPHL 5HYFA 5JXED 5C2BL 2FECI 2VZ3A 4ZO7A 1TN8B 2P5EE 3OSKA 1U3HD 3GSRB 1B0GB 1NMCB 4HWBA 3KPMA 1T3FB 1MI5D 3NN8B 5HHOD 2ITCA 4HPYH 2HFGH 1BZ9A 1G0DA 3BKYL 4KKNA 4BZ2L 5LQBL 43CAA 1HZHL 4H25B 5IVXA 4N5ED 5CGYD 3EAKA 5JQHC 4Z7QF 1ZA6A 4UUJB 4N0CD 4KI5C 5GXBB 4PGJA 4IMLA 3TBWB 3QDAA 4UNTA 5CBAB 2QQLH 3FN3A 3BKJL 2DS4A 4IS6A 2C4FT 4QRQA 2H32A 5E9DD 3VA6A 3QA3A 1TNNA 3MSPA 5IM7B 4KZEH 5GGTH 1FBIL 3MJ9H 5E2WL 3AM8C 5DGQA 1YA5A 3MLYH 4PRPB 2X4UA 3MLXH 1FO0B 5SX5H 3V52L 3QPXH 3BN3B 4PGBB 4PP2B 1DL7H 1JRHL 2V2TA 4Y1AA 4BUHA 4V1DE 1B0RA 4U6VL 4TSBL 3KPLA 4MD0A 3DVGA 4GS7B 5T3ZL 2BVOA 3DVIA 1UM4L 1FGNH 2R8SH 4GAJH 3LN9A 2UV3A 5JZ7C 5KS9B 2OM5A 2Y06L 2COQA 1N95B 3GIVB 5DI8B 2RHEA 1W6KA 2VUOA 4MNQB 1U8LA 3HC0A 4G9FB 1FZJA 3ARBB 2I07B 3MREB 5B38A 4QCIB 2IPKB 1JYXA 1UCBH 4JY6A 4M93C 1DVFD 4LVHB 4L8CB 1H15A 2Q20A 3AM8A 3IU4L 3CFBB 4P3CH 3SGEI 3RRQA 1RZ7H 4HIEB 2FECL 3BSZL 3FAWA 1EGJA 1AI1H 2HLAA 4KU1A 5FOJA 1HN1A 3LKPA 4F33A 1A6AB 3VXNB 1PX3A 2DQIH 5HGHA 3RVXD 4MNGB 3V4PL 5IFHL 2MTPA 4R97B 1GC1L 1ZSDB 4WI7A 3SGDH 4DCQB 2DQFB 1D6VH 4HUUB 4LLWB 4NC2B 1LVEA 3BP4B 4NQEA 3H7BA 4F7EB 2BDNH 1B9ZA 4M8VA 5D7LB 3WNKA 4ODHL 2GFBB 2WIIA 3WS6A 3HUJF 2DJ4A 2IANA 3RUGB 1AGCA 1YEDA 2AEPL 1SA4B 3QWOA 2VIRA 3L5XL 4JPVL 4R90H 1EEYB 1N4PB 1BGXH 1KLUB 1KPRA 3SDXE 3BDYH 3OKMA 5DZNA 2CLVA 4HF5H 1JP5A 4Y1AD 2EDKA 3QUZB 4KI5D 2NLJA 3GMQA 4U3HA 5JIIA 5KVFL 1QBAA 1T1ZA 1KPVA 3LKOA 3O4LB 1RVFH 5C08A 3PGDA 4QGYA 3HE7C 1SYVA 5EU3A 3EDDA 3AS3A 3HAEA 5L8LB 4GO6B 5EIIB 4CJ1A 4EBQL 2DICA 4Z78A 2NX5A 3MFFB 1D3CA 2KL6A 1BF8A 2DN7A 5BZDA 3V0VA 1GGIH 1NBVL 2VE6A 3IKCB 3BRGC 4YDOB 5C9KA 2N7AA 2VDKH 4N9GB 1JHKL 1KB5L 4JFHD 3MR9A 1EA9C 2H41A 3AREC 3FO1A 3QWQB 4PIRF 5TH2A 3WEXA 1BJMA 4HK3N 3PGCA 4DZ8B 4U05A 3W5NA 1CZ8H 1FHGA 1H0DA 3QIUB 5JZ7D 3V8CA 5IEHA 2X6MA 2MMXA 1G9NH 4NN6C 1WC7B 3HC4H 1IAMA 4BFEA 3EYFA 1EEZB 3FQNB 1TQBC 2R2CA 2PW1A 1T80A 1MREL 7FABH 3DVNB 4NQED 4J6RL 1NANH 2DJUA 5HJ3B 3H8NA 2UYLA 4RZCA 4MWFB 1CGUA 5IOPA 2EIZB 4CU8A 1U8PA 1CE1L 3MTRA 5GJSH 1T5XB 1KJVA 3AXLB 4XPHH 2VR9A 4PRBB 4HGKC 4RGNC 5C2BH 3ZYOA 3RGVC 4BH8B 1JGEB 4UQ2B 2AJSL 1I1YB 3OKKA 3O8XB 4NZTL 4WU7B 3GI9L 3RWCB 1QRNB 4KRMB 3D18A 2CK0L 2V7HA 3UZQA 3CX5J 4YEFA 4GSDL 2HYMA 2XXCB 3BKYH 3MV9D 4BZ2H 1GGTA 2VUYA 2VISB 5CS7A 1ZT1A 3HZMB 3OAZH 1WWWX 1KB9K 3MJ6A 1T1YA 4BFGA 1EAJA 5D4QA 4OF6A 2CIIB 5CMAA 5C08D 2HWZL 1NQBA 2E5EA 4ZUUA 4BOJA 4RGMB 3W0WA 3FN0L 1IL1A 1FFNA 1IAOB 1E4XL 4G43A 1MCBA 5D93B 2NX5D 3FJTA 2QR0A 2P5ED 1RJYB 3ZE1F 2G2RB 5E2WH 4AEFA 2I9TA 4D2NA 1I1FB 5HHQA 3V52H 3HE6A 4FXGB 2OLDA 2E7MA 2YD6A 4OIIL 4AIZA 1JRHH 1T89A 1DDHA 5IBLC 2ICES 1KCRL 5J6HA 4U6VH 4TSBH 2PUQT 2VZSA 1FVEA 3TBYA 5C0GB 1UM4H 1K6QH 3STZB 3HE7D 3GSOA 2ZUQB 3LKRA 1EFXD 2Y07L 1U3JA 1TN6B 4IMKC 1KIUA 4XC1L 1MWAA 5H2BA 2R29L 2XV6B 2YD7A 1S7VB 1CDBA 1ZE3C 3MUGB 4PRIB 3ALWA 4AH2A 1CLCA 3IU4H 1CDYA 3O2WL 1AGBA 4GTSB 1SJHA 3ARED 3ZT7A 1QVOA 2BC4B 1UB6A 1X9QA 4Y2OA 4R3SB 1T4KA 4F37F 1ZVSA 3BSZH 4OCWL 2ZG2A 4LCUA 1D6EB 1OGAE 4LHUG 4R6UA 3SOBL 4DKDC 1KJ2L 3WMSA 4EEEA 5KANI 4W4OA 2PYFB 4DEPC 4G8FB 3V4PH 3DX8A 5IFHH 1GC1H 4U6HA 3RBGA 5JW5A 4LF3A 4XCNB 3RNQB 15C8H 2B5IB 3SDDC 3ARFC 1SYSB 2DF3A 3GMPB 2XPGA 2B2XL 3HS0B 4HKZB 1K8IA 4Y5VB 3WFDL 2JIXA 2GITB 3IJYA 4RGND 2BOBB 3SDYL 5HGAB 4PJEA 5ICZA 3W0WD 3RGVD 2ZISB 1X5GA 2AEPH 1A1MA 3IFOB 5DK0A 5LAXA 1FL3B 1UKSA 5IMKA 43C9A 3L5XH 4YX2H 1O5DT 4X98B 1KV3A 1MFEH 4ZFOA 1CICC 1CGXA 2ATPB 3HE6D 2ZIRB 4Z7UB 4JN1L 5DMKB 4D9RD 4TRPL 3SDDA 4UILL 3X3FL 4X0KB 4X5WB 5KVFH 4DWHA 4HQQL 2W65A 4QXTB 2H9GB 3LPGA 5D7JC 4LSPL 1X5JA 2AEQL 5HTSA 1A4KB 4PJXA 2IBBA 4D0DA 3P0VL 5DJ2B 3TNMA 4MD5A 1X5AA 1J0HA 3QEGL 5E95B 5T1LB 3MGOB 3NH7L 1OAQH 5EN2B 5F1IA 4EBQH 3NA9H 3QJHA 1VACB 5E0QA 3MLWL 2GI7A 2PYED 1S9XB 5CJXC 5C0JA 4LVEA 4NRYA 3SGEH 1JHKH 1KB5H 4X6CA 4LQ1A 4U1KB 1F6LL 5IBLD 3NPSB 4L3EE 2Y36L 3QQ3A 4ODUB 5IB3A 5C0EA 1NC2B 4QNPF 3WCYA 2YSSA 2YN3A 1AHWC 3QJFB 5DJAB 3TBTB 1FNAA 2R1YB 3MROB 1ZK9A 3H9SB 3CVHH 1RI8A 1VFMA 1WZKA 1FNGA 5FDWB 2C7UB 5K9KB 3EJYD 5DJCA 3CU7A 1MREH 2CKBB 2AK4E 4J6RH 2IEPA 2P8MB 2W0LA 2VLKB 1GGBH 2X4OB 1K4DA 1JPSH 4Y4HA 3GNMH 4JG0L 3FQWA 1JWUB 4K55A 2CH8A 2FEDC 3KGRA 3QIWA 4JFFE 3G6AA 4LPVA 1YNLL 2WUCH 3VCLB 5IHLB 2WNGA 4G6ML 2Z92A 4QHUB 1JYNA 1R5WB 4ZPTB 1VFAB 5T3XD 2AJSH 3WE6B 1NGQL 2LVEA 3GI9H 1QP1A 4NKQB 1X7QB 3EYQD 5HHME 5T1KA 2Z35B 1QFUL 2CK0H 1SM3L 3NZ8B 3Q3GB 5CEZD 1U8NB 1U91B 4ZAKB 4GSDH 1D5XA 2WK2A 5ACMA 4MCZA 3SDDD 4LAQL 5DDHB 3ARFD 1I7RB 4EKXA 2DMKA 4Q9RL 3TZVB 1NGXA 3EGSB 3V4VL 5IJVA 2EYTB 1XF5A 2HWZH 4LFHG 1J9CT 3GMRA 1MRDL 2FB4H 5D2NC 1WCBB 3CDCA 1BQSA 3OV6A 2HJKB 1S7RA 1E4XH 3QDMA 4NO0A 1DLFL 3G6JB 2NY5L 4NN5C 1MSPA 4M8QB 1RZKL 2WAHA 3DOSA 5FV2A 1CICD 1NLBH 5I0DA 5CIPA 4D9QE 3V6ZB 2HRLA 5KJRH 1NCAL 4PBVC 1MRFL 4HH9A 2VLRD 1CGTA 1TQCB 3MLVL 4LLAA 3MRNA 1KCRH 2DQUL 5C0DB 5M95B 5D1XC 2DLFL 5D7JD 2HJFA 1RK1B 5J1SC 4U4BA 3V4UL 1JZ6A 4HG4J 2XA8L 4XC1H 1BQUA 2R29H 1HXYB 3MV11 5B3JF 1LEGB 1XF4B 1C5DB 2OTUB 1U58B 3ARRA 3A6BL 3L3KB 3O2WH 3MCLL 3VXPB 1HWHB 4YHNA 1R3LA 5I8CA 3PGFL 2H2PC 2AJVH 4OCWH 1BHGA 4I18C 2HKHH 1MCLA 4HWBL 3FQXB 4BOKA 3SOBH 1KJ2H 2FEEL 4LSTL 3NVQA 5T1KD 1RUML 3QI9A 4PD4K 5IJKA 2DMCA 2DRUA 4QXGH 5E94B 4NUJB 5KSBA 3O3DA 1E6OH 1CS6A 2OJEB 4L4TB 4NQUA 2Z8SA 4H1LH 1MEXH 3R4DA 5GSRB 2R2HB 3NPZB 3PWPB 4JM4L 1RZ8B 1BM3L 5FYLD 1BBJB 1WV7T 2FEDD 4NKMA 2ICEB 4JO3L 2XKUA 3SDYH 2DYPA 2VNCA 4NNYB 3ZKMC 4R0LB 3RWHA 4MD4B 3DX7B 2X4TA 3QDMD 4NO0D 1VESA 4YQXL 2AI0L 1BD2A 4B5EA 1OGAD 1J8HB 4OGAC 2FIKB 1NSNL 4KZDL 2NPLX 4JN1H 4LSRL 4F7PA 3CMOL 1JWMA 4TRPH 4UILH 1G7LB 5FHAH 3X3FH 4AJ0A 1WBYA 5DLML 3PV6B 2KZWA 4MSWA 4LSSH 3K4DA 1MVUA 2D0FA 2Z93B 1ZA3A 2DOCA 3BQUB 3ULVC 3P0VH 1U93A 2J3SA 3QEGH 1F5WA 5BCAA 5I1KL 2Z9TA 3NH7H 5LGHL 3VXRE 3BH8B 3SDCA 3RL2A 1UMPA 3IF1B 4QHMB 5ICYB 1HHHA 4H8WH 5I76B 2D7OA 2FO1A 1EGJL 3LS4L 1BVKA 2QTEA 4X6FB 3UDWA 2Y36H 1A9EA 1B2WL 1HINL 6FABL 4D8PB 5D1XD 4P23C 5HGBB 3RIAF 3TN0C 1RQ5A 1ODAA 4Y5XC 4FZEL 3STBA 3AGVA 1BMGA 2YPLD 3KXFA 1JBJA 2Y9RT 3TA3B 1M7IB 5C1MB 5DVLA 5C6TL 1AGFA 5HDBF 4GXUN 3I2CL 4JG0H 4WV1C 3ARVA 4Y88A 3L95B 2H2PD 1BQHB 1YNLH 3S5LB 2DYPD 1V3LA 5IW6B 4G6MH 4C59B 4NNXA 1N6UA 1NGQH 1BD2D 1UXSA 3JXAA 4LQFL 3DBXA 4Y5XA 1QFUH 1JHTA 1SM3H 3UXFA 4LIQH 3OZ9H 3C60B 3HTLX 3DRQB 3C5SB 3QB7C 4JY4B 1YJDL 3RA7H 1G7MA 4LAQH 2BEDB 2BNQE 3CAFA 4Q9RH 1MCNA 3V4VH 2J5LC 4LNGB 1MUJA 4WV1A 2FNBA 5F1KC 1KEGL 4RQQB 1I1AC 5MEQB 3FOMA 1KJMA 3ZKMD 4UT6H 3QG7L 4WTXA 1GGUA 4YAQA 2DLTA 3OBAA 3K2MC 4UOW0 1DLFH 3O4OB 4LKCA 1LE9B 2Q3ZA 3PWNA 4OD2B 5IWLC 2NY5H 5GIRA 4OGAD 1RZKH 1EO7A 4AENB 1QBML 1DQLL 3SBWC 1RZIA 5L2KE 1UB5A 5DEFB 3RDTA 3QUMA 4NKOB 2ITDA 4N8VB 5ABDE 5E8NB 1JZ4A 4OZ4B 4C56B 3MLVH 3HFML 1TMCB 4X7EC 5DVKA 4EVNA 2UWEE 3VJ6A 4XXCC 2XYCA 3ULVD 5GGVH 4CMHC 5D1QC 3KXFD 3IFLL 1B4JH 1S7TA 5AUMB 1H8SA 5DVMA 3RWEB 5DHVB 3UTTA 4K3EL 3B9DA 3VDCA 3HG1D 1TIUA 3A6BH 3JWNC 3KYMB 3G5ZB 4B7IA 2D9QB 3ZKXB 3RUGF 3VWKA 3IAQA 3I3EA 4QRTB 4IRJB 3PGFH 3CLEL 3CNKA 4RIRB 1MCWW 5EZLB 1IJ9A 2NTFA 3TN0D 4X7SH 5FA3B 4HWBH 2X70B 1MH5A 4LSTH 4WCYH 2AV7B 2HFEA 2X9XA 3VXMD 5D1QA 5I0ZA 2ZOLA 4KC3B 3GSUA 1OAXL 2HG5A 2HVKA 2H6PB 3C08L 3OAYK 3PJSA 5EDXA 5ILTL 2WWKO 2YRPA 1NFIA 1AKJD 1UFUA 3D48R 2AJZA 4P2RE 4JM4H 1BM3H 2EXYD 2H32H 1PDKA 1CFQB 3D69A 1RZGB 3VGEA 3U4BH 3C9NB 2A1WL 3G9AB 4YQXH 2AI0H 1LNUA 2XXMB 1GXNA 5ICXA 1I4FA 5TGBB 2P24A 1PJ9A 1KC5H 3MO1A 4PJAE 1IAII 2G5RA 2KDGA 1EHXA 1A0QL 3BEWB 4Y19B 1NSNH 5GRJH 4KZDH 2LVCA 4PJHE 3LRGA 2EDRA 1PQZA 3HC3L 3CMOH 2RCSH 3ET9F 5DLMH 1HQRA 5J57B 1JPTL 1I1AD 1F4WL 1I3UA 5IR1B 2NY4C 4QRPA 1MWAL 2EDEA 2Q86B 1A9BB 4Z8FH 5SV4A 4PJ7F 2Z31C 3D25A 5LGHH 3DIFB 5L2JA 3UTTD 3O45A 2X42A 4P9ML 4U1LB 5CSZB 4PJ8B 3REWB 4WUUE 3OGCB 4POZC 1FNFA 3CU1A 3VWKD 4EN3B 1G84A 1ZXQA 2CRYA 1EGJH 2W0FA 5E8EA 1I7UA 3SFXB 3E37B 3EJZC 5BRZA 2A0LC 1RUKL 4LEXL 1U3ZA 1FIGL 3LEVL 1B2WH 6FABH 3RBSA 1TJIL 3T0EB 3RPIB 3ARUA 3T65A 2VDPH 3OJ2C 3SDAA 2Q76B 1JWSB 5D1QD 4M1GH 4FZEH 5E6IB 1O1RB 2IADA 4P48A 3X12B 1F13A 2BSTB 5HDQL 3WS3B 1UENA 5C6TH 1KACB 3VXRD 3TJEL 1NKOA 3WN5C 3UPCA 4Q6IA 5C0BE 4H5SA 5JXAL 4IRZL 4NO5A 3VW3H 5EC1A 2VQTA 3C5ZC 4JFDB 3V7AG 3PZ3B 3C2SA 4ONGL 5CAYB 1X5IA 2G75A 4LQFH 4U0RB 3R0NA 4PLOB 4ZFOL 5IFJB 5IBUG 4S2SA 2G0DA 2H45A 1U2CA 2VSDA 8FABB 1YJDH 2NXYD 3C8HA 2A77H 3LEYL 2AEIT 2DWDB 4L4JA 2I25N 4E41B 1ZGLA 4K9EC 2FHFA 5DXWA 2ADJB 2P43B 2CDEA 3HAEH 3B3IB 3QXWA 4I4WA 3C5ZA 4PJGB 3EFFB 3X3GH 2WBJB 3QG7H 3U46A 5DYOB 1Q0YL 3BZEB 3OHXA 3AVEA 4HKXB 3H9HA 5EU5A 3MRJA 1KTLA 2FJFB 3F65A 1QBMH 3VFUB 3AAZB 3OKOB 4LLUA 2DQDL 1F4YH 1TVBB 3EDEA 4XXDA 1RHHB 3VFMA 3ULUL 3WNNA 5DJ6A 3GSVB 4ZUTB 1IM3B 1CD0A 3BPCA 4XVJL 1Y18A 3UTZA 1QO3A 4FFYH 1HI6A 1YEEL 2Z31D 4GBXB 4HBCL 2IALA 3IFLH 4OZHA 4LLYB 3FFCB 4WO4C 5L0QB 1I75A 5C0AB 5FFLA 4CVZB 3EO9L 4KQ4L 5GISL 1IGJB 4POZD 3MRMB 4Z76A 4KVNL 2X9YA 3EJZD 1RUAL 2A0LD 4U49A 3CLEH 2IEJB 2ED7A 5ISZA 4YHYB 3MBEB 1A7BA 4Z7WE 3MNWB 4QF1A 1CVSC 1NAMH 4PPTA 3CJJA 4X9HA 1OM3H 2RAMA 1ND0B 3LV3B 3KJ6L 1F3DJ 2ENYA 5HYJB 1LD9A 2UVFA 3IDIB 2VDOH 3QH3A 1ZT7B 1OAXH 4MA1B 4Z7UF 2X4NB 1NI1B 3C08H 2QADB 4G7VL 4O2FB 5FCUL 4QO1A 2X10A 1XT5A 3BKML 3A6CL 4NQVB 1DR9A 1CDJA 5E7BA 3GUTA 3ZKNC 3G6JE 3WUWB 1XGPB 4PTTA 3KPQA 3C5ZD 2EYRA 2GTZA 4I48A 4FQ2H 2I26N 3WL9A 2A1WH 1Y0LB 5IB2B 1IFHL 2CLRA 2QKIB 3U7WH 2RR3A 4PRHA 5ETUA 4PV9A 1IEAB 3BUTA 2JB6B 3GM8A 1CXLA 1FL5B 1HSBA 2GTWA 4DGIH 3VGDA 4JVUA 4U7SA 3C2AL 4OGXH 5BJTA 5I73C 5JIPA 3FFDB 1A0QH 4X9FA 5KW9L 4AYFA 4OLZL 3NIFF 4DFHA 5INDB 4JFEE 3HC3H 1PY9A 1PEWA 2LU4A 3DMMA 3PF2A 3X11B 2PTTA 2PXYB 2AEWA 1OSZA 5MEPB 5JHDA 4HHAB 1CXHA 1JPTH 5EC2A 4Z7QE 5IW1A 2JK5A 5GGUA 1MFAH 3OJMB 1I9IL 1AC6A 1XIWC 4QRUB 4GG6B 4P9MH 3CFJB 5MERB 2V5RA 3WHXA 2NY2B 3B9KA 1LHZA 4FQXB 3MRGB 4FFVC 1UKTA 4LCWD 3UBXI 4PGZA 4AEIH 1D5BB 4YDLB 5J3HD 3B5TA 3VXSE 1XR8B 5J11C 1RUKH 4RFEB 1IAIM 5ISZD 4LDLB 5HI4C 3G04B 1TJIH 1U8OB 4M1CC 2D9CA 5JOFB 4P57A 5FB8A 1S9YB 5FF6A 3EYOB 2HA1A 4L4TE 3GSQB 4KHTL 1JCKA 4G42A 4PJDF 1NBYA 4JQXC 4WO4D 2ZCLH 1WJ3A 4L29A 5HDQH 1JMZA 5I2IB 2IAMA 3QEUA 1FFOA 1XR9A 3TJEH 5F1OB 2OS7A 5F93C 4TVSa 1TJHL 5JXAH 5KSVB 2GCYA 4IRZH 1YEFL 4GMTL 1N3NB 3GRWA 4G80B 5IMMA 5T3XH 1EO5A 3QDJA 3MACH 5ELIA 5IEKB 3P4LA 4PRHD 4XP1L 4YEEA 1AE6H 3KPLB 1G7IB 2DWEA 4L9DA 5CEZH 3ZE0F 5JDSB 4XPFL 5EO0A 4TNWF 5F6HI 2PCPA 4RAHA 4EI5A 1FLRL 2BSRA 2YPKA 3LSOB 3MV8B 4UQ3B 5EU7E 4WW2F 5A1AA 1CTNA 4GKNA 4XNZB 2V8KA 3QG6A 3GGWA 4XHJC 4A6YA 3ZKND 3MNVB 3UAJC 1O7SA 3DROA 2F19L 3TCLB 3NIGF 4GXVL 4U1IB 1GOFA 3L9RA 5C0BD 3SO3C 2K3TA 4HKBA 4I0PA 4IHOA 4F9LC 1Q0YH 4M9OA 3KDMA 1OB1B 1BX2A 4MXWH 4CN4A 5HHXH 1N4QB 4PG2A 2CJUL 3PP3K 1W2KT 2P5WD 3B9KD 4K71C 5KSUB 1VHPA 4Y4KC 3KG5A 2ESVE 4WI8A 4ZSOE 3P4NA 3IS1X 3GMLB 4OZFG 3G5YB 1C1EL 5FYKU 1TZHA 3MLRL 3ULVL 2APWA 5F7DA 3VRJA 4G8GA 1YEEH 5EUOB 4F9LA 4MJIA 4WENB 5GRVK 2P8LB 2IAMD 2VIRB 3CVIL 4WHYH 1V5JA 4HKJA 1WBXA 1LP9B 4KQ4H 1DUZB 4NIKB 5FM8A 4FFVD 4Y4KA 1Q8MA 4KVNH 3QCTL 4NN7B 1RUAH 2CDFA 2LTQB 5DQ9A 5HI4D 3DHJA 3BGMA 2V5TA 5JNYB 3GMQB 3TO2B 4PJ9A 4OGYL 1VGEL 2X41A 3FHQA 1VCAA 5FYJE 3RNKB 3KJ6H 3CFEA 5CHNB 2VWEC 1N59B 5HHPA 5J1AA 1HH9B 5D72H 1LTXB 3KNBA 3QQ9C 2VZUA 4G7VH 5FCUH 3KLHC 3QEQE 3BKMH 4KROC 3A6CH 5IQ9B 5HVHC 1TCRB 4F7TA 1GYAA 2X4PB 1OAYH 5HGDB 1P84K 3IDJA 4GKSB 3FQUA 1D5ZA 5F7KC 3G5VB 2ID5A 1IFHH 3GB7B 1GHQA 4RISH 5SWQA 4LLQA 3CUPA 2YKLL 3O9WC 3QUML 5B39G 1MCIA 3C2AH 4OV5B 2O5ZH 3R0MA 1G7QA 4MAYA 2VQ1A 1OL0A 3GSNA 4FXKA 3OKDA 4OLZH 2GK0B 1JZ8A 4OZIB 5AAWA 3W9DA 1FC2D 4XHJD 3UAJD 3WJJC 1Q94B 4U2ZA 4QXUL 3DXAE 5FO8A 3UTSD 5E99H 2V3NA 4XX1E 4GW4A 5EFIB 4MMXC 3RFZC 1J0KA 4OZFA 3LMJL 4MJID 1TNYB 4XP6L 1MHEA 4Q2ZB 4P4KC 4JFYA 4HDIB 4Y4KD 2VN7A 5J12C 1H3BA 3NFNB 3T4AB 1BP3B 5ANMB 1QNZL 4FZ8L 1XF3B 3ZE1E 5CD3A 3V6FA 3WJJA 1RV6X 4OV6F 1JPFB 1OW0A 1FFQA 2X4RB 3S37L 1VGKA 3O6FA 2N4IA 4KHTH 5DD1L 3U30B 1TPXC 5E2VL 1DQJA 1UZ8A 4BQ9A 4MVBC 2BNRE 4XWGL 1QD0A 4NT6A 4LPTA 4FQCH 4GG8A 3LN5B 3QNXB 1QPXA 1J0YA 2V5SA 4XNQB 5EBLB 4C55A 1IM9D 2QSTA 1WIPA 3N50A 3OJDB 4WWID 4M02A 1TJHH 2LQRA 4HUKB 4TULL 4GMTH 5JW4M 3OG6B 2G9HA 3PG2A 3SGKC 2E9IA 5DTFA 1F2QA 1Q9OB 5F97E 3BGFB 3QULA 4JRYB 4DK6A 2C1OB 4XPFH 1CL7L 3TCXA 5F3BB 3KLAA 2IPTL 2E7LA 1MWAB 2JE8A 3BP7A 1EX0A 3UTOA 3KLHD 2A6KA 3OKEA 4X6DF 2IC2A 4KROD 3V0WH 1FFPA 1BVZA 1WUNT 4AH2B 1N26A 1ADQH 1UQSA 4XNMB 5ITFA 5B39A 1LEIB 4GXVH 3DV6B 1QVOB 4OSUL 4V1DA 1VADB 4MLIA 2CD0A 4LCUB 1KCKA 1DBAL 5DJDB 3MUHL 4OCSH 4FRWA 5C6WH 2EE2A 1MFBL 5INCB 4Z7NF 3O9WD 2CJUH 3SQBA 1QYGH 5CEYA 2ZSWB 1NDMB 4ODWA 1YPZB 3T3ME 3IDXH 4M9PA 3RZWA 1MCSA 2O5XL 3BPOC 3BRDA 3FB5A 1UJ3A 2VRAA 4ZDHA 2VLLB 1DFBL 1CGVA 2MKLC 1KUMA 1C1EH 1OT1A 3T77A 2Z8WC 3JZ7A 1UWXH 5DJ8B 3ULVH 1X4ZA 1K8IB 3O6FD 3SQOH 4HUXB 5ID0A 1A7PH 5I8EA 3BWAB 2VZVA 4OUUA 3E6HB 4P4KD 43C9B 3E32B 4YDJA 3P4OA 4UOW1 1DQMH 4F3FB 1P7QA 1GCFA 2APVA 4AK1A 4PGEA 3IGAA 2E9JA 3TPUB 4E5XB 4L9LB 3QAZC 4H26A 2I9LB 1K8DA 3S96A 3DURB 1FZOA 2F54E 5F9WB 5KN5A 3ILPB 2YUXA 5K59F 1P7KA 5E1AB 1L0QA 1R0AL 5I1CH 3CPLB 1JNLL 4OJFH 1C08B 2VKXA 2A6IB 4D0DB 1FSKB 1AD0A 3F12B 5DMGC 2YZ1A 4MVBD 4FABH 3H9ZA 3CFKA 5SWSB 1EPFA 5CP7B 4ISVA 1SHMA 3SDXA 4Y16A 3O6LL 5L88L 4J23A 3OB0K 5JMOC 4OF0A 6CGTA 1MAKA 1NC4A 1GH7A 3OR7B 3Q2CA 3QIBC 4K3GA 1IKNC 5C07E 4PRAB 1CG9A 3HR5B 4FQJL 4F7CA 2XY1A 2P8PB 3TNNA 2YKLH 2C3HA 4LBEA 1V7NH 1ZLWK 4RFNB 4JM2C 3QUMH 4N0YH 1N0LA 4NWTL 4NKDA 4HH8A 3SEPA 3BWUC 1U8HA 1R24A 4PGDA 2F8OA 4LHUB 1LDPH 4HCRA 5D5MA 1Q9KA 1I7TA 5F88A 4ZUWA 1PAMA 3GMMB 4WEBL 2R0KH 3KR3L 3WLBA 3OMZA 4JKPL 1X5ZA 3GIZL 3GSXA 3QXAB 1RJLB 4XP5L 5CKGA 3T0VA 4LLDB 3PXHA 5J13C 4XP6H 5CILH 4FFWC 4H0GA 4XCEB 3PWLB 1P4LB 4JO2H 4OLXH 1CGYA 1S64B 1I8LC 4M61B 1A6WL 1FNEA 2CR3A 3HB3C 2X1OA 1FVCB 1JI1A 4JM2A 1T03L 5MEOB 1S9WB 5E2TH 1T0MA 1JPST 2J8UF 4CAGA 3BX7C 4D4DA 4GAGH 1QNZH 2AJYL 4NDMA 5EU4B 4FZ8H 4JKKA 5IJVB 2PO6B 3TYGL 3CDYA 1MJUH 1T22B 1UWEL 3GMRB 4XMLH 2K7QA 1KZOB 3SE3C 2GJ6E 5DD1H 3FMGL 3DXAD 5IUSA 2KUTA 2ZP0T 5E2VH 3AS1A 1U9KA 4Q0XH 5IP4A 3LQZA 2C1PB 4XWGH 2Q8AL 5I1IL 1JGDA 5JUEL 4PJFB 1NC4D 3MRBA 1T0NA 3IDGA 3PQYD 5CIPB 3L6FA 1PSKL 2V5YA 3Q73B 3DSFL 3HZKA 4OM1L 3G9VA 4TULH 3GSWA 3KPSE 2E9BA 2RFXB 1X81B 3Q79B 3MRNB 2FL5B 3NFSL 1ZLVK 1YY8B 4J8RA 4HUVA 5FIEA 5SWZE 3QO0B 2AXFB 2KQNA 3N1QC 5F89A 3H6JA 4YXKH 1L7IL 1CL7H 2JJSA 1S3KL 2V8JA 4RA3A 4PP1C 1CK0L 1HH6A 5DMGD 3T1WA 4JVPA 4ZFFB 3P73B 1X4XA 3C8KB 3PL6B 2C3XA 2ENSA 4P4RA 3RZCB 2BNRD 2Y25A 3F6IA 4XGZA 5C09E 5F6IC 1BLNA 2FZ3A 3QIBD 1HQ4A 3SY0A 4ETQA 4ERSH 4OSUH 5I8CB 3W39B 2Q1EA 1W72A 4HK3J 2VXSH 3O11B 4N0UB 4YFDB 4QY8A 3E2HB 1S9VA 4BQ6A 1MFBH 3QI9B 2ZCKL 4JM2D 1MOEA 1J11A 3IXAA 3X14A 5I8OL 5EH1A 1X44A 5DD3L 2O5XH 3O3DB 1RJCA 3D2UB 1KGCD 3E8UL 1FN4B 5KVGH 3O3AA 2BVPB 5BVPH 4KRPB 1WWAX 3NTCH 4Z7VB 4URTB 5DJZB 4ETYA 2OSLB 2JELL 1EHLL 1ZGLM 4OM0H 4DOHB 3ROLB 1T20B 1RIHH 4I2XB 4XP4L 4FFWD 4D9LL 2F0YB 5FECA 3D85D 3O3BB 4E42A 2C3VA 4I3SL 2BXZA 1RZFL 3HB3D 4Z0XA 4P2QB 1PZUB 4MBGB 1ROWA 5FYKE 3GRWL 2BOCA 5D6DA 2ATKB 1I1CA 4NKIH 4GRWB 4NOBA 4F15C 1MFDL 2Z0BA 4KKLC 4LVOB 2R69L 5D7IB 3OF6D 5E4EB 3TT3L 5E08H 1T1WB 1S78C 4RFOH 3C6LB 1U93B 1NCBL 4TN9A 1HHIA 3VFNA 4BZ1L 3PHOA 4JFQB 2APBA 4A6YL 3O6LH 4X6EA 5L88H 3LH2L 3BW9A 5D6CB 3UMTA 3DJ9A 2EYSB 2DBJA 3WJLA 2Y7QB 1DLHA 5DJ0B 1SVCP 2VITA 1PKQB 1D8DB 4ZPVB 4NQDB 1H8OA 5TDNA 4AIOA 3KPRE 5EU6B 3LKNB 1MHCA 4FQJH 2F54D 4GG6F 1AD9A 1I3VA 4QTHA 4EDXA 5CP3A 4PP1D 2X4QA 3BXNB 4NWTH 3VWJC 2NXZC 3FONB 2A83B 4L5FL 5LJYH 1HK6A 2R0ZL 1KCUL 5IVXF 1KN4L 3C87A 3TO4A 4FQPA 4I77H 1YMME 3PIQA 3TIDB 5DJXA 1AO7B 1AXIB 4JJHA 4X5LA 4JFXB 4WEBH 1LP9E 4L3EA 3DUHA 5TQ0L 3V6OA 3D39A 4XP5H 4NBXB 1T2QL 4JDZB 3T2NL 2CLZA 1KULA 1TVHB 1FL6B 4OF3A 3S4SA 3VFSB 3RY5A 1OPGL 3BZFA 1XCTB 3L1OL 1JZ5A 2PF6A 3AMKA 1T03H 5I1AA 2ICCA 4L4VD 4TSAL 4APQA 1EXUB 1NJ9A 4G7YH 1J1OH 2NQCA 5HVFB 1WFNA 1MFNA 3ROOB 5IV2A 1LO3L 3QXVA 4Y5YA 3OJVC 4JFFA 2JCCB 4PJIB 3W82A 3DVFA 3DARA 2XN9B 5IHZB 3FOMB 5E7FA 1CDIA 3KS0J 4KXZI 2ZKHL 2J6EA 4YBLB 5I1IH 1WIOA 5GRUL 2DQJL 4DQOL 1NCNA 5JUEH 1J1PL 5T33H 2N1KA 3MYZA 1I9EA 1PSKH 2A6JA 4I5BB 4OM1H 2NY1B 3TIEA 1U8KA 3PP4L 1JCQB 2N56A 4KKLD 3NFSH 3KQ4A 1S7QA 4WNQA 4U1NA 2ED8A 5F1NA 1S78D 5IVZB 3D1MC 5EZIL 1L7IH 5MENA 3J7HA 3GSNL 1CK0H 4X99B 3SCMA 1OTSC 4CN6A 3VFVA 4GRLB 5E8PB 5K9QI 1KIRA 1QSFB 4HZLA 3O41A 3CLFH 2P7TB 3I6GB 3MUJA 4CNIB 1AIFA 3F6LA 1BIHA 1IC4H 1M7DA 1TCMA 2KQMA 2YD9A 2FLBT 3RWGA 1QLFB 3D39D 3INUL 3D0LA 4I1NB 5DGRA 1NUFA 3MV7A 4D0BB 1G6VK 1JPGA 2ZCKH 3VWJD 5IHBA 1F58H 2NXZD 1UA6H 4ZOAA 1AXTH 1U8MB 5I8OH 2Z91A 4O9HH 3IAPA 3T0DA 4LEOB 1FFRA 3HN3A 3GSRA 5BV7L 3HXBB 1T3FA 2A9MH 3NN8A 2DKUA 4HLZG 4HK0A 4X4XA 1YECL 5EOTB 4H25A 4KTDH 4XP4H 2BHUA 5GS0D 4UI2A 1EMTL 2DIBA 4JB9H 1N7MH 2ZUTA 1RULL 4UUJA 4G3YL 4D9LH 2V2XB 4I3SH 3TBWA 1RZFH 5E00B 2V8IA 5CBAA 3L3IB 3UC0H 4UBDC 4CMMB 1IQDB 3B43A 2AV1B 1EO8L 1D9KB 3ARBC 2OX5A 1H3UA 4BJLA 1FAKT 3O2DA 3MODL 1HILB 5IM7A 3S35X 3EYUL 4PJBB 1HQRB 3TT3H 5FM5M 1HYSD 1A2YA 3GMNB 3FOLA 4PRPA 1FO0A 1NCBH 1LO5B 3U2SB 4PGBA 4PP2A 4ACPA 4U1MB 1WEJL 2VB5A 3D25B 1IQWH 5HHNB 3DI2B 4PJ5E 4A6YH 3NFPB 3LH2H 1DQTA 4YHKH 4HIIB 1R5IB 3BE1L 4G8IB 5KS9A 3GIVA 5DI8A 2WIMA 4MNQA 3ARBA 1YPZE 5BRZB 3EOAB 2I07A 4R97C 3MREA 4QCIA 2IPKA 5E8DL 1BWWA 4UB0L 3DRAB 3JBG7 4L3CB 3CFBA 2R1XB 3WKNA 1OTSD 4HIEA 3Q1SL 2R0ZH 2BY1A 1KCUH 2J7LA 1X6LA 3QUKB 25C8H 2GT9B 2HLFC 4XCCH 3QDGD 4DTGH 1A6AA 2VXQH 5DF0A 1XGQB 4S0TD 3R06A 3U6RB 2GYSA 5A2LH 4NCDA 4MNGA 1ZLSL 1MJ7H 5TQ0H 1PYWB 1ZSDA 4DCQA 2DQFA 4HUUA 4LLWA 3MOAL 3BP4A 4F7EA 3T2NH 2EE6A 3QUZC 4U7KA 2G75B 3FN9A 1CFSB 5D7LA 2GFBA 2Q7NA 4CVXB 3LZFL 1INQA 3VD3A 3L3OB 1OPGH 4UV7L 2F8XC 2OZ4H 1L0YA 3SKUD 3UX9B 4ZYKB 2XWTA 4K2UL 3CX5K 5K33A 5GHWL 5HDOA 3E1F1 2YK1L 1LO3H 4PB0L 5BMFH 3E3QC 5SWSE 1EEYA 2VDNL 2VLME 3F7RA 4A2MA 1B6UA 4Y4FB 4I4WB 3CX2A 1KELH 2ZKHH 1OP3K 3U46B 4MB4A 3RIFF 3QUZA 4JDVB 5GRUH 5ITBL 1MY7A 2DQJH 4XH2B 4DQOH 5EU5B 1KTLB 1ZHLB 3O4LA 3QIUC 4UBDD 3BJLA 4P2OC 1OP5K 4MNQD 4G9FD 5EIIA 3ARBD 3BO8A 1GIGL 1UH2A 4M6AA 5IIEB 3PP4H 3CIQA 3IKCA 4HIJB 5EZIH 5EIQA 2UVEA 4N9GA 4PY8I 3GSNH 3AY4A 3I9GL 4X80L 4S1QL 1QSEE 2QSCH 3CK0H 5LKNA 4OF8A 4M7ZB 1IBGL 4HCRL 4DZ8A 3O8XC 4C4KT 2ARJB 5GRZA 3OKLB 3QIUA 1JZ3A 3T0WA 3B8SA 1NGPL 1EJOL 1WC7A 4WFGE 2APTA 1X4YA 4GLRI 1H3TA 4PJEF 1EEZA 3FQNA 3INUH 3DVNA 5HJ3A 4QF1B 3HXDB 5D7LD 4MWFA 1XZ0B 2EIZA 4UDUB 5BS0E 4CU6A 1MHPH 5DT1L 5DEGB 5KBNC 3I6LE 1T5XA 3AXLA 1QLEL 4FTVB 4LASL 4F9PC 4YDVA 4BH8A 1JGEA 3FB8B 2HLFD 4UQ2A 1HOCB 1I1YA 2ZG1A 3O8XA 4WU7A 3FO0L 3RWCA 5D93C 1QRNA 4KKIA 5F7EL 4TTDC 1HNFA 1CBVL 1KEMH 4KJYB 3MLZL 3NIFE 3GI8L 3WYRA 4PRNB 4PJXF 4QRRD 2GSGB 2XZZA 2HFFB 4K7PY 4KXZH 4PJFE 1A6VL 1U2HA 2NY6B 2VISA 2AW2A 3S35L 5FGCB 2F58L 4NQCB 3QUZD 3HZMA 2CO7B 2GJZB 4G3YH 4PV9B 4JRXB 1RD6A 2GUOB 3K7UA 2CIIA 4YIQB 4U2YA 3O4LD 1SY6A 2Y23A 4NUGL 1D8EB 5IB5B 2D7TL 4XNUL 4KQ3L 2DQHL 4IDLA 2A74B 1FGVH 4NJ9L 4X6CF 3BT2L 1IAOA 4MA3B 3W81A 5E24E 3ULUF 4CVUA 2G2RA 1A14L 1I1FA 5JHLL 2OMBA 4KI1A 1MCHA 2F53E 4FXGA 3VDAA 1MI5B 4DW2L 4BSVB 1WEJH 4ELMB 3OWEA 1U41A 1GSMA 4MDIB 4QEGA 3V5HB 2JLLA 3NCJL 5AGDA 3QIUD 4PJDE 4R9HA 5C0GA 1ORQB 3STZA 4DUXA 4RDQF 4P2OD 3KPTA 2MQ0A 3QXUA 1W72L 5GRVL 4G6FD 1TZGH 1S7VA 1BZQK 3VD7A 1U6AL 3MUGA 4PRIA 4BH7B 3PHQB 5E8DH 2B5IC 5FB8B 1Q1JL 4UB0H 2W9DL 1Q0XL 3M8OL 3QHFL 4Y5VC 3FTGB 4OQTA 3UTPE 3CDFA 2BC4A 2NTSP 3Q1SH 4R3SA 4MJ6B 1J0ZA 4L29B 1SMAA 4DOHE 1O6RA 1D6EA 3O8XD 3WIFB 4I2XE 2YZ8A 3QEUB 1QRND 2GK2A 1F3RB 2L7UA 4J3SA 4PJ5D 5HPOA 3N9GL 4N1HB 2PYFA 3VFOB 1FORL 3LHPL 1A6ZB 4XCNA 1MIML 1IGML 4U1JB 3RNQA 3MOAH 3O3EB 3QFDB 2P47B 3LRSB 3NIGE 4OLWH 1SYSA 4C58B 5F7UA 3GMPA 4GRWE 3WO3B 5I74C 4CN1A 3HS0A 3LZFH 4Y5VA 4S1RL 2GITA 5D7IE 2AXGB 2BOBA 5HGAA 1DQQB 1XH3B 2QSQA 3IFOA 3IJSA 1S7WA 2EDDA 2NR6C 4K2UH 2OTWB 3NCYP 1FL3A 5GHWH 2XWBB 3QG6B 3LQMA 4LCCA 2VAJA 4TTDD 2VDNH 4MLSA 5CLWA 5EZJB 2ATPA 4RNRB 3X13B 5LCVL 5F8QC 4OIAA 3QFJD 5DMKA 1FAIL 1A3RL 4HKBB 4UAOB 1CWVA 1PZ5B 4X5WA 5ITBH 1SJVA 5EU6E 4QXTA 2H9GA 5GJTL 3MA9L 5JORB 1A4KA 5DJ2A 3E30B 1EZVY 3ARDB 1K2DB 3MGOA 5EN2A 1G6RH 1ITBB 1GIGH 4NRZB 2EXWC 1VACA 2VABB 2VAAB 4U6YB 3HA0A 1OVZA 4WTZA 1S9XA 5DD5L 3BPNB 4X4ME 1ZT4B 3U9PH 4OCYL 1O79A 2YWZA 1AO7E 3AB0B 3D3VE 5KSBF 4M00A 2DM2A 1JV5B 2HH0L 4U1KA 4X80H 4C54A 4S1QH 3N1GC 3ZDZF 2IQ9L 3B8YA 1DEDA 2H3NB 4ODUA 1D5MB 4U7MA 1IBGH 1NC2A 1GHFH 5DJAA 3QJFA 1JK8B 3TBTA 2D7NA 3HNVL 3MROA 1FYTB 3H9SA 4QRSB 4K3HA 4U3XA 1LO2L 5FDWA 2C7UA 3OKNA 3UO1L 5K9KA 5DJYB 1TENA 2HKFL 2CKBA 2LAGB 2P8MA 4P5TC 4XP9L 2VLKA 1FIEA 12E8L 1UCTA 2X4OA 5DT1H 2EDBA 2FIRT 3T2PA 4X7FC 1JWUA 4WJ5B 3BIBX 4HV8B 3VCLA 3ZYJA 1LO4H 1QLEH 3DRTB 3DTXB 3FRPG 4ONOA 5HHPB 3I84A 4QHUA 1UYWL 4X7TB 3DSUB 1R5WA 4ZPTA 5FKPA 3K4ZA 4K8RC 3NAAL 1QSED 4LK4A 3FO0H 3MRPB 1X7QA 2Z35A 5FHBH 3NZ8A 3LS5H 3Q3GA 3GI8H 1U8NA 3VXUE 1U91A 2OI9B 3IDJB 4ZAKA 1NFDB 2J6EL 5GS0L 1VKXB 1A6VH 1G9NC 4OLUL 4DKEH 4WW2C 3S35H 5DDHA 2F58H 3H0TB 3CFDB 2VXUL 2VSCA 3TZVA 3VFWB 3EGSA 2EYTA 4UOJA 1MIEL 1T5WB 4NUGH 4M93B 5H94B 4OI7A 5GQBA 4K94L 2J88L 5BS0D 2D7TH 3AU1B 4KQ3H 4XNUH 4U1GC 1WCBA 2DQHH 2WM0A 5T1LD 2NR6D 4NJ9H 1BPVA 2HJKA 1OD7A 3G6JA 4QHLB 4KUZH 4M8QA 5KSAB 3ULSB 5EULV 4IM8A 4BKLB 3ULVF 5JHLH 3V6ZA 1ZEAL 4DW2H 4CW1B 4HW6A 4WFHD 1HWGB 3RWJB 2X89A 3SJVE 3MRFB 3MV9B 2XQYK 4P46C 1S5IL 4NCC1 4U1SB 1RK1A 4M5ZL 4YGVA 3H9SD 4GLRH 3T2OA 1DE4B 2EXWD 4M5YL 2F5AH 4UIMB 1U6AH 2VLKD 2E7HA 1LEGA 1XF4A 1Q1JH 1C5DA 2OTUA 4M6MH 2W9DH 1U58A 4YWGH 1Q0XH 1VGKB 3WD5L 3L3KA 5BV7B 1R3KB 3QHFH 3VXPA 2P5EB 5CZXC 1G0YR 4I3RL 3BZ4B 1FJ1B 3QCUL 3FQXA 2WY8A 3ARGC 3LD8C 1OT2A 4FN0A 2WUBL 3D5OF 3B5HA 3VXSA 4ZXBC 3GZKA 3N9GH 4ZAKD 5K9QG 4NUJA 5JW4R 4X6DE 2D31B 3FRPA 5HI5C 3S5LG 3HE7B 3A0OA 1EFXB 3CGTA 4OBRA 1MIMH 1IGMH 2OJEA 1P84J 4P5TD 1RK0B 4N90D 4L4TA 1ACZA 5GSRA 1DSFH 2R2HA 3PWPA 5DD0L 1RZ8A 4YPJA 1BBJA 4S1RH 3DUSB 2NW3B 2ICEA 2E8ZA 1ULVA 3UTPD 4R4BB 1FG2B 4NNYA 4R0LA 1F3JB 3O2DL 4K8RD 4MD4A 3DX7A 4FQQB 5I30L 4JN2B 4GKZB 4NJAL 3I50L 1DN0B 1HYRC 1J8HA 4IRSC 5B39B 4WW1B 1FO0L 2YHGA 2FGWL 2FIKA 3T04D 3D5RA 3LEXB 5LCVH 4MQTB 1NAMB 1FAIH 3JVGC 3K1DA 4NN6B 2X89D 2JKXA 1G7LA 4IOFD 5BQ7B 5I19H 1PX4A 1RIUL 5E6ZA 3PV6A 1TQBB 5GS1B 3D9AL 1JF5A 2WANA 2Z93A 4FQIH 3BQUA 5DSCB 4WWKC 5CJ5A 5GRWA 4X6BA 5CD5C 2WP3T 3S6CA 4ZO9A 5L8JB 3L5WB 4JFPB 2BRQA 3RGVB 4LHJB 5IROA 4QOKE 5CP3H 4B0MM 5DD5H 3IF1A 4N8PA 1NCTA 4QHMA 4OCYH 5ICYA 5D1ZA 1KCLA 5I76A 4XPBL 5I8EB 4X6FA 1LWRA 2IQ9H 4QT5B 3T3PE 4P46D 4D8PA 4JPWL 3RTQC 5HGBA 3DGCR 1P7QB 4O00A 5DR5L 3RVVC 1FCGA 3TFKC 4XX1G 3MLPA 3HNVH 1CCZA 2QSVA 5DUML 1A6TB 3HMWL 2WZPD 3C60C 1GGCH 4V2BA 2DQEL 3TA3A 1TDQA 3GBMH 3F7VB 1M7IA 1RURL 4ZTPL 3HLAB 5EPMB 4YDEB 3JV4B 4XP9H 3IRZA 3PWPD 1XGUB 1UH4A 5BO1H 4ORGB 4KHXL 3L95A 2PYEB 4NPYB 4Z18A 1BQHA 5CZXD 3S5LA 3VD9A 5IW6A 3D3VD 4X9IA 3CFKB 3C09B 3CFCL 4B53A 3NAAH 4Y16B 1GXOA 5I1EL 3ARGD 5HVGB 5T3ZD 4ZXBD 3I6KA 4RX4A 2DI7A 5HI5D 3C60A 4PJCB 3DRQA 4UNUA 5LGJB 1INEL 5GS0H 4JY4A 3T8XB 2ADFH 1GOHA 4KJQC 1XF1A 2VXUH 1FCCA 1FYHB 2VDLH 5IK3B 1T21B 4RQQA 2E27L 3BQUD 2J88H 2K9UA 1E28B 4HS6A 5MEQA 3S36X 1HDMB 2VO5A 4IIQB 3GKWL 3MRDA 4DGVL 3EYVB 3RKDC 2NOJA 5I66B 1R24B 2W9EL 3MQIA 4G6AC 1LE9A 5E5RB 4OD2A 2E7CA 4IRSD 4JCLA 5EWIL 4TVPD 3BUYB 1YC7A 1QFHA 2J8UE 2Y72A 4AENA 4ZUSB 4LSUL 5DEFA 1N64L 3U36B 3WLBB 4F80A 4NKOA 4N8VA 1I9JH 3M45A 4RA0C 5E8NA 5DQJB 4OZ4A 4DEPB 2D4DA 1J1XL 4XAKE 3EO0B 3EJJX 4MMZC 4L9PB 2CXGA 1S5IH 5C86A 3DYOA 2ICWJ 5CKAA 3ARFB 4WFED 4LVNC 4WWKD 5I71C 5F6HJ 5HD8C 2Y5TB 5CD5D 1QACA 5AUMA 4JPIA 4M5YH 3RWEA 4FTVE 1BF2A 3TT1L 4WEUD 5FGRA 2YWYA 3NCYS 2BVTA 3WD5H 3G5ZA 1NCWH 4C1SA 1LEKB 5HHVL 3EUVB 4QRTA 3WUZA 4IRJA 1OARL 2IH1B 4RIRA 2ZUVA 3PWJB 1CICB 4I3RH 4YHLL 4JZJC 2PN5A 3RTQD 3ZE2E 3O3UN 2EDJA 3UYPA 5FA3A 3RVVD 3TFKD 2FDBP 1JGDB 1F8TH 1UM5H 1WTGT 2AV7A 2VLRB 4HULB 5I8KL 5F71A 2WLZA 2LU3A 3C60D 5D7JB 4LPWA 4M7LL 2JJTC 2KZ1B 2I5YL 2H6PA 5EOCL 1GXMA 5FEBA 4M62H 1QKZL 4HUVB 3PDOB 3Q5YA 5DD0H 1GPOH 2XNAA 1MLBB 2BZDA 1YUHB 2VH5H 1DTUA 1R76A 1OWRM 5DS8B 4XVTH 1RZGA 1QSVA 2NZIA 4HT1L 3GFUA 3C9NA 4BSWB 3Q5OA 5I30H 3MOBH 1MI5E 1U95B 5HHOE 1ZLWH 5TGBA 5IF0B 3EOYG 4RAUB 4LIQE 3QSKB 3T0XA 3BEWA 4ETQB 2JJTA 1QFPA 1QR1B 4KJQD 4OZHF 4C56D 5T5NF 3WLWC 5GGSY 1I85A 3P9LB 1EUUA 1KPUB 1RIUH 1IVLA 1MCWM 2W38A 4ODVL 4TUKL 4N1CA 1JGUL 3D9AH 3IXAB 5IR1A 4XB7A 1ES0B 5E9DE 4K07A 4QHKJ 5C0CD 2X44D 3RKDD 1FRGL 2Q86A 1A9BA 1BEYH 1FP5A 2PTUA 4XNXL 1MCRA 1HEZB 5L6YH 8CGTA 4G6AD 3DIFA 5E2JA 1CFVL 1FT1B 1EHNA 4HWEL 4U1LA 5CSZA 4PJ8A 4WIQA 3REWA 4OQTL 3OGCA 3L7FB 3NCFB 4MJ5B 1YDPB 3VMPA 4HS3B 4BZYA 4EN3A 1MJ8H 1OGAB 1T7VA 1BWMA 4QWWC 4HMEA 4YNYB 4XPAL 3SQCA 2F74B 2IFFH 3QO1B 3T0EA 4JPWH 3RPIA 2NY0B 5DR5H 2Q76A 1JWSA 3TEUA 4U0RC 1VERA 5HD8D 3HMWH 4J1UB 5E6IA 5EOQL 5K93A 3X12A 2BSTA 2DQEH 3WS3A 4BK4A 1JFQL 4R96B 3B9AA 4ZTPH 1JYVA 2YD2A 1VFOA 1D5IH 4HLZH 3L3JA 4L8SB 2OTPA 4KHXH 32C2B 1WFOA 4M6NH 1KLGA 3SPVB 4JFDA 2AQ2A 5I18L 2FH6A 1H9VA 3CFCH 4O2CB 5CWSB 3Q7AB 3QUXC 4NFDA 5IESL 3S36L 5TFSH 5L9DL 1V05A 1MLCB 3CSPA 3VGHA 4AG4L 5HVWA 5IVXE 5IFJA 2ADIB 1T83C 5D1XB 1IRAY 4Y19D 1JHLL 3P11L 3CFIC 8FABA 1BQLL 4GAYB 1JF1B 5JQ6H 2DWDA 2YPLB 4W4NA 3OKYA 4Q97A 5FGSA 35C8L 4LNRB 3B3IA 3KPPB 2BMKB 4PJGA 3GHBL 3EFFA 2WBJA 4DGVH 3U1SL 2CDGB 4UT7L 5DYOA 1OOAA 3BZEA 4HKXA 4I18B 2A73B 5EWIH 1F42A 4WUKL 3BP6B 5TE4L 2FJFA 4LDOB 3VFUA 3AAZA 4LSUH 1N64H 1TVBA 4Y1AE 4KI5E 2FCBA 3WLWD 4EDWL 1RHHA 1KXQE 3JV6A 5C7XL 3GO1L 2LE9A 2YRLA 3HZYB 3T0ED 3GSVA 4ZUTA 1NANI 1IM3A 4UINH 1SQCA 3B4NA 1G7JA 1DANU 4V1SA 4CRPA 4JCMA 3VD5A 4JGMA 4GBXA 2AK4B 2QEJA 4LLYA 2CKBL 3FFCA 1UJTA 4PB9L 4XBGB 5C0AA 1SEBB 2RJMA 4WGVB 5DZOA 5FV1L 4NZDA 3ZTJG 4KTYA 4CVZA 1T6WA 3DWTA 1IGJA 4JFHE 3MRMA 2MFNA 4YR6B 3RWDB 2NY5C 2JF1A 2V6HA 3JUZA 5FOBB 5IT2L 1RZKC 3CZFB 5HHVH 4QWWD 2NY3C 1UGNA 3H3BC 1OARH 2BFVH 4YHLH 2UUDH 3VXTB 1NFDE 1SBSL 3MBEA 3UBXB 1BJ1J 1GZPB 3EU5B 1A47A 2IQAB 4ZFZA 2CQVA 1ND0A 3LV3A 1CQYA 1LQSR 5HYJA 5KTEL 1E4KC 3IDIA 4Y2DC 5EOCJ 1UXWB 4NQEE 4M7LH 3TYFA 1ZT7A 5E4IA 2I5YH 4DN4L 1U8KB 1WITA 2X4NA 3MA7B 4OZGE 1CU4L 4TUJB 4XVSL 4O2FA 1WZLA 1LGVA 1SY6H 1ZHBB 4E41D 3BN9C 1QKZH 1LO0L 1JNHB 4NQVA 5F1NB 5H37H 1RUPL 3MZGB 3WUWA 1XGPA 4LSQH 4K8RL 4HT1H 3FZUC 3HG1B 2R2LB 5IB2A 3QUXD 2QKIA 4NBYB 4HUNB 1IEAA 2JB6A 2ZG3A 2W59A 4XBPB 1ERNA 1AIFB 3MV9E 4P23B 4TTGA 5DC4B 3BIKB 3KPSA 1E4KA 1PEZA 3FFDA 2ICWB 1EAPB 5INDA 2DDQL 5C08E 3X11A 2JB5H 2PXYA 1HSAB 1N5YL 5MEPA 1JPGB 5F72S 4HHAA 1KT2B 1JGUH 2AJUL 5HYSG 1K3IA 1AKJB 1FRGH 1OQOA 2NX5E 3FFCD 2GAZB 4XNXH 5C09A 2BX5A 5C0AD 1CF8L 1G0XA 4QRUA 4GG6A 1CFVH 3CFJA 5MERA 1HIMH 2Y5EA 5E5MB 4FQXA 5TQ2L 3MRGA 4HK0B 5IBTL 4X4XB 1F90L 2BP3A 1D5BA 4JHWL 1NCDL 4GT7A 5HGGS 1XR8A 2BRRL 4RFEA 2ORBL 4XPAH 3G04A 1U8OA 4EUPB 1FNLA 4PY7A 5JOFA 1S9YA 1P53A 3EYOA 5SX5K 5D2LB 3GSQA 1H37A 3BKCL 2J5LB 4K3JL 1WGOA 2R15A 1I1AB 1KXVC 5I2IA 3IDYB 1NGWA 4PYGA 4XNZC 1JFQH 4P0DA 1YEKL 3ZHDA 1A2YB 1INDL 1EBAA 3J8F7 2NY3D 1BOGB 3FOLB 2ERJC 1ZHNB 4IJ3B 5LGKA 5CGMA 5B8CB 5KSVA 3T4YB 1TNBB 1N3NA 2I24N 4G80A 3ZDYF 5I18H 2UY7A 5IEKA 4ZFGL 5FA4B 3EIFA 4RAVB 1G7IA 3S36H 4NWUL 5L9DH 2H8PB 5JDSA 4AG4H 2Q7YB 4Y2DD 2R2EB 2VLJD 3LSOA 4KRNA 1GOGA 1JHLH 3P40A 4CMHB 3MV8A 1II4E 3ESVF 3FT4B 4HMCA 4UQ3A 3JUYA 1BQLH 5TDPB 4JG1H 1UACL 3BN9D 4MCYB 4JAMB 2WW8A 2C5DC 1L9MA 2ZCHL 4NHUB 35C8H 3MNVA 4RGNE 3WS6C 3O2VL 3TCLA 3W0WE 4U1IA 1DBJH 3TWCH 3VXRB 5JA8B 3OXSB 3FZUD 3GHBH 1FDLH 3RWIB 4D0CA 3U1SH 4UT7H 4HIXL 2FD6L 1OB1A 4PS4L 1TJGL 4OD3L 4TVPL 1K5NB 3KSLB 5TE4H 5KSUA 3R06B 4D9RE 1KXTB 4MJ2A 4NN7C 1IC5L 2ZZUT 3GMLA 4EDWH 5C7XH 5SX4I 3G5YA 2LTQC 2VR4A 1YJDC 2C9AA 5DO2D 1INQB 4CJ0A 3KYKL 4G9DB 4NO2B 3CCHB 1P7HL 4XAWL 5EUOA 1UT9A 2XWTB 2PYEE 1O5MB 1PY4A 4KK6C 4PB9H 2P8LA 4EXKA 1G9ML 4J4PA 3RP1A 5A43C 1T7XA 2YXMA 1LP9A 1DUZA 2P49B 4G5ZL 3QNZB 4M7KH 1AY1L 1F11B 3UYOD 1YEIL 5IT2H 4YDKH 4PJCE 5D70L 4KDVA 1CIUA 1KTKE 1SBSH 4ZO8A 5JNYA 4OFDA 3TO2A 4OB5L 5KVEL 3TC9A 1CXIA 1P6FA 2EEAA 3MRRB 2NY7L 5DFTA 3RNKA 4AQOA 3GHEH 5IVOA 5KTEH 5CHNA 3MV8D 1N59A 3BO8B 2BNQB 1HH9A 2NY4B 5FUCC 4AM0B 5FYJL 1ZVYA 4XVSH 1E4XI 2Z31B 3WXVL 1LO0H 5IQ9A 1TCRA 1VFUA 4PJEE 4YC2C 1PVHA 1T66C 2X4PA 1PLGL 5HGDA 1DN2A 3W9EA 5T3XE 4K8RH 4GKSA 3RL1B 1KZPB 2BNUB 3G5VA 1QHOA 3GB7A 4G6KL 2GKIA 2FWOB 5L2KB 1SJEA 5CEZE 5FO9B 3VU2A 5F7WC 4UU9B 1TNUB 5ACZB 4OCXL 5CCKL 4Q6YA 4OV5A 3T0AA 2UWEB 3V95A 2GK0A 4OZIA 1LE5B 1WT5C 2DDQH 3O0RL 3ZL4L 3WV0A 2EO1A 3WIHA 3ZLQC 1UG9A 2V9RA 4PJXE 1Q94A 3HRZB 5GGRY 1N5YH 1E6JH 2AJUH 2IAND 2FH8A 1SMOA 5E6YA 1J12A 5EFIA 3WN5B 1HKLL 4YDVB 1A4JB 1CF8H 4Q2ZA 5BOZG 2HN7A 5TDOB 4NC1C 5DQDL 2DL9A 4HDIA 4KMLB 4X6CE 5IBTH 3NIDE 5LQBH 2VLRE 3NFNA 1HZHH 3T4AA 4JHWH 1XFPA 1NCDH 3T2QA 3HE6C 2BRRH 1WT5A 5ANMA 3WFZA 1JGLL 5AYQA 3FCTB 1XF3A 1T89C 3OXRB 5ADOL 3SDXF 1ONQA 2CRZA 3RQ3A 1CFTB 1JPFA 2D0HA 5DA4A 2X4RA 1ZOXA 3BKJH 1S8DB 3BKCH 4K3JH 1OP3H 1A7OL 1CYGA 3ABZA 4KK6D 4P2RB 3C72B 4WI9A 3LN5A 3QNXA 4XNQA 1FBIH 5EBLA 2GY7B 3OJDA 1VB9A 4TOYL 3IU3B 3SHSA 3QRFM 2YA0A 2YN5A 1Q9OA 1QA9B 4PJAB 5T3ZH 4JRYA 1YC8A 2G02A 5D5MF 5JMRA 4PJHB 2C1OA 4POUB 4I8DA 2Y06H 4W4OC 5F3BA 4I13B 1TVDA 2XTJC 2BY0A 5GGVY 4LPUA 1WICA 4JHBA 5DRXB 4N8CL 3EJYC 4NRXB 4QGTA 4U31A 4ZOEA 2VL5B 5FYLE 4JR9L 4WO4B 4XNMA 1T66D 4RRPG 2OL3A 3O2VH 1LEIA 4JM2F 4KJPC 3DV6A 2ZUYA 1VADA 3QDME 2EEBA 1OGTB 1G1YA 4DJMA 5DJDA 4HIXH 3F58L 4WUUB 2FD6H 1TJGH 3BOVA 4TVPH 2F9BT 5INCA 1MF2L 3EYQC 2EDHA 2EKJA 2ZSWA 1NDMA 1YPZA 2DM3A 4F8QA 2VQUA 3PWVB 4L9LC 3EBAA 1QBLL 2VLLA 1C12B 3T09A 4M7JL 4YHOL 4ODHH 5DJ8A 5D2NE 4P9HL 4OCRL 3QYCA 5IFAL 5CEXB 3KYKH 1FSKC 4HUXA 4XAWH 5CINL 3WO4B 3IRPX 4TYUA 3IJSB 1CFNB 1S7WB 3BWAA 5EZOL 5TF0A 3E6HA 3CSYB 2YD5A 1G9MH 3WSQL 4JPVH 5C0BB 4LCCB 4F3FA 1HHJB 4C4KO 1ACYL 4DVRL 3TPUA 4G5ZH 5KVDL 4ZTOL 4E5XA 4L9LA 1YEIH 3OPZL 2I9LA 1YEGL 1T7YA 3DURA 3MUY1 5I73B 3ILPA 4LU5L 5E1AA 4OB5H 1A8JH 2IBGA 4JRYD 5E70A 1H3XA 4P3DB 3CPLA 5KVEH 3ULUC 5DRZB 5ESVB 3NCMA 1C08A 2CUIA 2NY7H 1F6AB 2YPLE 2A6IA 3MJ7B 4RFNC 4XHQA 1NMBL 3F12A 4KMTL 1G9EA 5E03A 5KOMC 1TXKA 4WVRA 3V5DB 3WDJA 5SWSA 5CP7A 4ORZC 5FYJH 1F2XK 1QZ1A 3KPOB 1UKQA 3GDBA 1XIWB 1NBVH 4Y4HC 1MCPL 1PLGH 3OR7A 2FO4B 3FAXA 1VPOL 3QIWC 1GSZA 4OD1L 4I9WE 1BD2E 4PRAA 2KKQA 3HR5A 4G6KH 5AZ2L 3BZDA 5J11B 2P8PA 1I7ZB 4P59L 1W0WA 1Y6MR 2DI9A 4H0HB 4OCXH 2XTJD 5DWUL 1DBBL 3K8KA 2UZXB 3Q75B 3ZHLA 4KTEL 3OKNB 5SX4H 5IB1B 3MJ9A 4MB5A 5EBGA 1MFCL 4XT1C 3O0RH 4LHUA 3ZL4H 4CU7A 2ADGB 5LG1A 4M3KB 4NSKA 5C0RL 4P3WA 4R7DB 2ZJSL 1CE1H 2JIXD 4KJPD 3SKOA 4YK4B 3GMMA 3FO9B 3MGTB 2IG2L 2JTDA 1QPPA 4YFLF 2QQQA 1HKLH 3HI6L 4H20L 5DHVH 3QXAA 1RJLA 4LLDA 5FKPB 4NZTH 4XCEA 3PWLA 1P4LA 2AKRB 2FEEI 4M61A 5DQDH 1FVCA 1QFWL 4Y8DC 5MEOA 1S9WA 2XWJB 1JN6B 1Z6JT 1BAFL 4GKOA 4LARL 4Z7WB 1O6QA 3FQTB 4RMQA 1JGLH 5EU4A 2WINB 3HXEB 3ULVE 5ADOH 2PO6A 4JY5L 1T22A 2YC1B 3KXFE 3BD4A 2J12B 1S7XB 2VZOA 2MSPA 3FN0H 3BD3A 3MRKA 3UTSB 3SFYB 2C1PA 4JGJA 2Z4QB 3SO3B 3HG1E 1TETL 4PJFA 4TOYH 4PBXA 3WHE0 4K71B 3FO2B 3B6SB 4OIIH 2EH7L 2RFXA 2CXKA 3WDHA 2FL5A 4ODTL 5EB9A 3ULUD 1YY8A 3VXME 2DKMA 3QWRA 3E2HC 3QO0A 2AXFA 5AAMA 3QI9C 5IJKC 1FE8L 2Y07H 2GW5A 4YGVB 3AUVA 1E27B 3BIAX 5I9QC 4JFEB 4Q9BA 1OAZL 4ZFFA 3P73A 4N8CH 3C8KA 3PL6A 4RMTA 4BQ8A 1J05B 4LHUD 4P5KB 3RZCA 4JR9H 3MNZB 4AMKL 5JO5B 1TFHA 2AABL 5EBMB 4Y4HD 3ZMRA 3BD5A 3QIWD 1LMKA 1IM9B 2XY2A 3W39A 5A3IC 3UTQB 1AC0A 4N0UA 3O11A 3JTTB 3F58H 2X1QA 2G60L 4N5UA 1GVIA 1ZS8B 5FUOL 1QUNA 3VXSB 3MRLA 1P6AB 2AJ3B 1R5VB 5D2LE 4KDTA 3D2UA 1DUYB 1FN4A 4MHHI 3K80A 4QTIL 2E9WA 4Z95L 2BVPA 5MHSD 4M7JH 4LVOC 4YHOH 2B2XH 4Z7VA 4P9HH 5E4EC 5DJZA 4HIHB 2OR9L 3WFDH 2OSLA 4KROB 4FFZL 3C6LC 3ROLA 1T20A 2V17L 4PY8J 5CINH 2OR8A 4I2XA 3UTTE 3WNLA 5EZOH 5DK2B 2XT1B 3E6FB 3O3BA 3SDCC 3WSQH 4JO4L 1A1NB 4OAWB 4P2QA 4DVRH 1A7RL 3BDXA 1ZVHA 5KVDH 4ZTOH 3OPZH 1RU9L 3O9WB 2ATKA 1YEGH 3DSWB 3BP5B 2ZWLT 2YMXL 3E34B 5F7LB 4PG9B 1M71B 3UDWC 4LU5H 4K23L 5D7IA 4HQQH 3DX6B 1NL0L 3BRFA 2DTML 4LSPH 1T1WA 2VDRL 2AEQH 3C6LA 2HT2C 4GMSL 1H3GA 3SKMA 1M6OB 4X6BB 4JFQA 3N85L 3MLWH 5CJBA 3HCVB 5KOVC 2P48B 5D6CA 1ZANL 2EYSA 4P4KB 1MCPH 1KFAL 2Y7QA 5D1ZB 4MXQC 5DJ0A 4WI2A 4X83A 4GJTB 1PKQA 4OD1H 4ZPVA 1QOKA 1V8HA 4NQDA 5J12B 4KFZC 2ARJQ 5C3TA 5EU6A 3UEZA 3LKNA 1IZKA 1P1ZB 2FBJL 5AZ2H 3KLDA 4WDIB 1CT8B 3QI9D 3HI1A 2ESVB 4P59H 4FQ1L 3NCEB 4ZSOB 3BXNA 5DWUH 4R2GC 1DBBH 3FONA 2A83A 1YYML 1FPPB 2QQNL 3T0BA 3D2UD 4XCYB 4HFUL 1MFCH 3TIDA 1AO7A 4PV8B 3F7YB 4MX7B 1WIUA 5C0RH 1S7SB 1FT2B 2ZJSH 2KBGA 1ZWIB 4JFXA 2EXYC 5HYIA 5A3ID 3HPLA 5CJQL 3HI6H 4X8JB 1I3RB 1WBZB 4I9WD 4JDZA 1JTPA 1TVHA 4Q9QL 1FL6A 2XFXB 5ALCL 1Z9SA 3OTTA 4LFHD 3I6KB 4JRWA 3VFSA 1XCTA 4B7LA 2EIDA 4LCIL 4WHTB 3S3JA 3RDTC 2W60B 4WY7L 4OFKA 1EXUA 3OX8B 4I3GA 4LARH 2FSEB 2NY1C 3ROOA 4S1SL 4LKXB 2JCCA 4PJIA 3WDIA 1M05B 4JY5H 2XN9A 5BW7A 5IHZA 3C6LD 4HS6B 5KS9F 1MRDH 4YHML 2E6JA 3MRDB 5HY9B 3QEQB 4I0CC 4YZFF 3SDCD 2YD4A 3ZSSA 3HNSL 2A6DB 3GJEB 4I5BA 3VWKC 4HWNA 1NCAH 3U4AA 3MRHB 1MRFH 2DQTL 1YN6B 2EH7H 1X6NA 3OR6B 2EE3A 1MVFA 2NW2B 1PFCA 2PW2B 2DQUH 4ODTH 5I1DB 1N4XL 3STLB 2DLFH 1ZKAA 1J10A 5IVZA 2QHLA 2HT2D 3FT2B 1FE8H 3V4UH 4NM4L 2MQCA 1OAZH 2XA8H 4X99A 3N0PB 1N2RB 4Q74A 5AD0A 3MYJB 4JPIB 3O6ML 3WIHL 3DSTB 4GRLA 5E8PA 5IGXL 1QSFA 3DXAB 4JQVA 2P7TA 3I6GA 4QLRA 4AMKH 2AABH 3MV01 3ZT5A 4CNIA 1TTUA 2A2QT 3QUYB 4MXQD 3MCLH 3ME0A 4RBPK 1X5LA 3KYAA 4GRMB 1QSZA 2XZQL 1QLFA 3PHSA 5I6XB 4YDIL 4RWYL 2G60H 3WFEL 3RI5K 2V2WB 4D0BA 1RUMH 5H8DA 3R8BB 5FUOH 2GOXA 4R2GD 1G6RB 1U8MA 1GXEA 2P4AB 4MZ3A 4JQIL 5F44A 3VGAB 4LEOA 2WP3O 1D9KC 2NXYC 3IXTA 4Q7DA 4LAJH 4QTIH 4Z95H 3ARPA 1H35A 2XNAB 5F96L 4JREC 4OTXL 2XN9D 4OZHE 3CZJA 4WEMB 2BNRB 3BPLC 3L5JA 4JO3H 5EOTA 2V17H 4YPGB 4A2LA 4XPTL 1U8JB 3ES6B 3S98A 4D4AA 2IPUK 3QIBB 3CVHA 2V2XA 2WSKA 4JO4H 5E00A 4LCWE 5BOPA 1A7RH 1KTRL 1YNTB 4HGWB 1C5CL 3L3IA 3RDTD 2B8OT 4JFZL 3L3GB