5JPMB

Structure of the complex of human complement c4 with masp-2 rebuilt using imdff
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
739
structure length
738
Chain Sequence
VNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALSLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
source organism Homo sapiens
total genus 189
structure length 738
sequence length 739
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
B PF01821 ANATO Anaphylotoxin-like domain
B PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.30 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 5jpmB01
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5jpmB05
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 5jpmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jpmB03
2.60.120.1540 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jpmB04
3I9GL 5I1GH 5JZ7D 4CADA 2C3GA 1QFPA 3ARFD 1WBZB 3NFPB 5KVFL 3SE9L 1G9MH 5K9JL 4FZ8H 4HCRA 2E7MA 3MRDB 4XMPL 4HKBB 3HZKB 1M7XA 3G5YA 1MHHA 3L5XH 3O3AA 4PLOB 3PL6B 4LAQH 5GGTH 3TYFB 3SKNB 3HE7D 1G9NL 3MRHA 4JY5H 3WFEL 3GMNB 5H37G 4LSUH 5GRUH 1M05A 5D7IE 2FJHB 1NUGA 2YPLE 3MLZH 2NY4D 4HFWA 5F1KC 4GS7C 1A2YB 4QOKE 5ICZA 2PO6A 1ONQA 3KWWB 3GSOB 3UYRH 2GEEA 3L3KA 2KZWA 2K3TA 3P11L 5IHUL 5KVGH 1N4PB 1G6RL 4O5LL 6FABL 2FHCA 5SX4I 1R5IB 4FABL 5EZJB 3CX5J 5C9JA 4S1SH 1GGCL 3MNVB 3PP4H 4JJ5A 3WO4C 2ERJC 3FO1A 2I25N 2FSEB 3GUTA 1HNFA 4GRWF 1NGPH 3HR5A 1BVLA 3NZ8B 3G08A 5C0JB 3TJHD 1Q9WB 3BN9D 3MJ9L 1XIWD 4G6FD 1QA9A 1K4DA 1M7IB 4WI9A 5KVEH 3ULVD 2JJUA 4KV5E 4E41E 2Q76A 4ZSOE 1CQYA 3UXFA 3ZDXE 3VW3L 4WIQA 5BQ7B 3VFNA 4L3EA 4WU5B 3HS0B 4ZTOL 1FCGA 3CFCH 4JFOB 4QXWA 2EXYC 3MGAA 4MSWB 3TO4C 1BFOB 3BT2H 4Y89A 1IT9H 1TJGL 1OARH 1CD1B 4MBGB 3KXFB 1QLEL 1T5WB 1MHEA 1XAUA 4R7DB 5FM5M 3UTPE 3PP3H 3IDYB 2EKSA 4PGCB 3W82A 2D2OA 2IWGA 3CFDB 5JMRA 3VXUD 2EDXA 1A1NA 2D4FA 4MNHB 4XPTL 2C4FU 2NY6C 3N85L 1HHHA 1OM3H 4PTUB 4MJ6A 1TQCB 4XP9H 5IM7B 4RAUA 3V5DA 4YAQA 1P53A 3BKJH 3L9RA 1H8SA 4X99A 3RUGB 5ESAA 3TEUA 5HYEA 5J13C 1A3LH 1TTUA 1IGYB 3HRZA 4MHHI 3P0YL 4X6BA 4R2GB 1FVEB 1OGAB 4IHOA 2NR6C 4U2ZA 3QI9A 3QEQA 4LVHB 1J87A 4WO4D 4Y5YA 1QO3B 1MFAH 1FCCA 1REIA 3HG1B 1JPSL 2ADJA 1JUFB 1EO8L 4QRPE 5CEXB 3GSNL 3MYZA 3O2DA 3ORJA 1F6FB 4LCWB 3NN8A 4ZO8A 2FO4A 1PDKA 3MXVH 4XNXH 1IC4L 3FKUS 5JUEL 1DQQA 2XWJA 3LEVH 3LIZL 5J6HB 4ZD3L 1OAUL 4YBQD 5J11B 3H7LA 3WS3A 1UKQA 3TT3H 1FJ1B 1OHQA 4X6DE 3W9EA 3E3QE 4YK4B 3JWDH 3FFCB 1JNJA 1QSFD 1MZCB 1TXKA 5EB9A 1YZZA 1F5WA 1YNLL 5IQ7H 3PQYB 3TZVA 1MVUB 4YHML 4HUVA 4YEEA 2BXZA 2L0DA 4JFQB 2CMRH 3B5TA 4X6CB 2IFFH 4N9GA 2HFGH 1K4CB 8FABB 3CSPA 2VAAB 4XNYL 1CD9B 2DKUA 3G6DH 1KTDB 1T6WA 4X5WA 3RVTC 1T0MB 4D8PA 3HPLB 4G9FD 3QDJA 1D3CA 3RTQD 5LWYL 2R4SL 1IGIH 1OL0A 3MBEC 1A0QL 3C2AL 3SDAA 5FUCC 4LIQE 1ETZA 1TJIL 4PJEA 4JKWA 1OW0A 3UJJL 1IEAB 3SQCA 1BF2A 3WBDA 4OI7A 4I3RH 4PBXA 5DJXA 3QQ3A 1MHCB 4NNYA 3I75A 1S5IL 1MCOL 2P5ED 2B0SH 3TPUA 4D0CB 3MRGA 1G6RA 5JW4R 2CLVA 4KJPD 4P99A 5DLML 4AT6B 3GSVB 5E9DA 3EYSL 2VR9A 4S0SD 2XI9A 3GFUA 4ZAKD 5I73B 4L8SB 3LH2H 1TNYB 3MR9B 4LSVL 5D7LD 4GW5B 4DVBA 5E1AA 2IMMA 4H5SB 3MOBH 5EZIL 4WNQA 3QUMH 2WBJC 5FGCB 1S7SB 3HAEA 4OGAD 1QSJA 1R3IH 4JFPB 1RIUH 4F37K 3MJ9A 3O6FC 2VXSH 2VXQL 4GUPB 1W0VA 4FG6C 5I1LA 1B90A 2Q8BL 1O1SB 1WFOA 2XQYG 3ZE0E 1UGNA 3KPOA 4LGSB 1G7PB 3LQMA 3SJVA 1I9IH 5BZWB 4JGJA 5KTEH 5C08B 1UM5L 3OG6B 3HC4L 2HP4A 2HG5B 2X4QA 3GMOA 3KPMB 4PRDA 4GKSA 4OZFA 1KENL 3UPRB 3D2UA 1YDPA 2PW2A 3TCXA 5J1AB 3IJSB 1CLOL 3BP6A 3MJ7B 4NQDB 4IOFD 2RHEA 4WFGE 2W0PA 3VG9B 3RRQA 5I1EH 2WMPA 3MUZ1 4QGYA 4S2SB 1D9KD 4R0LB 1DFBH 2I26N 5IJKA 5DRZA 1TZIB 3NIDF 5BW7A 1YYMH 1JGLH 4NQSB 2GITA 4AMKH 3L3HB 3LKQA 4HAFA 4JKPL 1MCPL 3MCLH 4X8JA 1BGXH 5FYKL 5FYKU 5DJ0A 5DQ9A 1Q9KB 4OM0L 3C6SB 1RUKH 2UV3A 5JR1H 4GTPB 1P6FA 3T3MF 4OZIE 2ICWB 3EO1A 3C72B 1WCBB 3JWNC 1FG9C 4IRJA 2WLZA 1AGBB 4FQJL 5IW1B 4U4BA 5D7JB 5GISL 3ZE1E 3KXFE 1GVIA 3HAEG 3I2CL 3GSNA 4XHJC 3VFPB 3T09A 2E8YA 1FV1B 2BVUA 3DOSA 1F6AA 3KR3H 1CFNA 4OLVL 5TDOA 5HPMB 3IDJB 1N5YL 4FXGA 1MCFA 1CGXA 4HZLA 5I9QB 5CP7A 4OB5L 2ZG2A 3D18A 4KKIA 5CP3H 5DVKA 2VL5A 2PXYB 3RUGE 1I1YA 4P4KB 5GGSA 5KOMC 2X9YA 4OZFG 4KJYA 1FP5A 2YPKA 4QRUB 2ZOLA 3VXRD 5CBAB 2HFEA 1OGAE 4LBEB 1YMMD 4XMKH 4F8TA 2OSLB 4P5TA 2P24B 4FQXB 2A77L 3HG1E 1NCWL 5ANMA 1N26A 1KIRA 3TIDB 1DEEB 1VCAA 4LCWE 3I6GA 1GZPB 2LVEA 3FOMA 2WIIB 5INCB 1EVUA 2EH8H 2H6PA 5ADPL 1JPGA 1A9BA 2BC4A 4MJIA 4MCZB 3QPXH 4LCCA 2PYFB 3MUHL 3BEVA 2WWKT 1P4BH 2X1WL 3EOAB 2IEJB 1J8HB 4U1SB 3DIFB 5EU4B 3U7AA 1C8PA 3FFCE 3Q3GA 1TIUA 3DPYB 1DE4A 3KDMA 3PQYE 1WAAF 4HH8A 5AAMA 4DTGL 3EYUH 1TVBB 3A6OA 4JFEA 4X6CE 2ZIRB 3GHEL 1J7VR 4YEFA 1T20B 4HLJA 5IB1A 3O2WH 1ITBB 1N6VA 5E8NB 2NLJB 5IVOA 4LMQE 4NHCH 3DBXA 2YRPA 3VRIB 3WL9A 2EO9A 4PRAB 1LP9A 4U1MA 1NGYB 3G5VA 3BZEB 3L5WA 4PGBA 1FHGA 1NCUA 1H36A 5DJAA 1B3JA 5IB5A 4R96A 3BWAB 1DSFH 4C4KO 1U8HA 2CKBB 4NZTH 5H8DA 1TETL 3HC3L 3QEHA 4WI6A 3UROR 4NOBA 3ESVF 1H37A 5C0DA 3K46A 3IKCA 1TNOB 3JV4B 1OAQH 3C6LC 1E27B 3C09B 4HIEA 2AKRA 2O26U 5KSAB 3EYQC 1F11B 4PJBB 4N0CC 1LE5B 4I48B 3O4LB 2B7DT 3MACH 4F3FB 3HI6H 1V7ML 4GG6B 4UOW0 2PW1B 2DI8A 3MRLA 3DVIA 3P9WB 5TF0A 3KPRA 4H1LA 5IHLB 1A3QA 4HGWA 1TVHA 1OSPL 5FGCE 1G7QA 1LO0L 3IKKA 3QCUL 3INUL 4X80H 1A9EA 2F58H 2K7PA 2YUVA 3CLEL 4KJQD 4EBQL 4XPBL 4I0PC 5EBLB 3ROLA 3OR7A 4PJ5D 1FZMB 2XA8L 1C16B 2AEPL 2UZIL 2EYRB 5ESVB 4FTVA 4MA1B 3CVHA 2YD6A 1FVCB 2BJMH 1VDGA 3TBVB 5FDYA 1AJ7L 4J12A 3CDGA 4NKMA 4P5MA 4XBEL 5C08E 1RURH 4WHTB 1NBZB 1I85A 1KNOA 5FKPA 5JORB 3TFKD 3R1GH 3QAZB 2AJXH 4LLVB 1NDMA 3PIQA 4J23A 3L7FA 3LQZB 2F5BH 4JR9H 5CJQH 5HDQH 1RZIA 4YIQA 3O2DH 4NQDE 2G60H 5F8RC 3HRPA 1GXOA 2XWTB 4PLJD 3IJYB 1CXKA 1MIEH 2R69H 2CJUH 2D7TH 3D39B 4XZUB 3RPIA 4KGJA 3OKKB 1YUHB 1ZWIA 3MRBB 3OXSA 1JNNL 4C1SA 4D4DA 4UTAH 5ISZB 1SQ2N 1JRHH 3V0WH 2Q7YA 3KJ6L 2K7QA 5IF0A 4WY7H 1T1ZA 3AMLA 2BOCB 2HKFL 3RIAK 1I75A 1QLFA 2VWEC 1HILB 2YBRB 4PLNC 5FF6A 3KPQB 1KTKE 4XNUH 1XF2B 1EHLL 5IQ9A 4FQCL 4JRYB 4ZXBD 3WS6A 4XP5L 2IPTH 2RFXB 5ITFA 1U3HC 5DWUL 4L9LA 1YMHB 1RJYA 1V3JA 3TVMA 4HIJA 4R3SA 4L3CB 4TTDC 1HHJA 1Z9OA 3LHPH 2A6KB 2VB5A 5GJTH 2A6JA 4A2MA 5F21B 4HKXA 2DTMH 5DS8A 3BW9A 4I9WD 1DQJB 3ILQC 4XPAH 3NVQA 3GIZL 4G3YH 4MDJA 2P46B 3THMH 3ARBC 3CFEB 3OKOA 5C0BD 4PJXB 3QUYB 3UC0L 1T2QL 3VWKD 2AEIT 3U6RB 5DD3L 5DMYA 1ZANH 4Z7NF 2AAVA 3I3BA 2G9HB 4HT1H 1YYLH 2FWOB 4OT1H 4WW2A 3WO3B 5F7YC 2V2WA 4JZJA 4LKCA 2VNCA 4LSPH 3VJ6A 1DLFL 4FN0A 1JGUL 4UIMB 5JPNA 2XYCA 2AXHA 4PJ7A 4GKNB 5IW6B 1JPTH 4JQIL 1FO0L 1QBML 4BZ1L 4NRYA 5CEZD 4RAVA 2VJXA 1EAPA 1U93B 4HS3B 4LLUA 1T03H 1FFRA 1OF2B 3C60B 4WJ5B 2NY0B 5KS9E 3SDCC 4X4XB 3QIWA 4RGOL 2V5YA 3LS5H 4NO2A 4RNRA 3PF2A 2EEDA 1CU4H 3BP4B 3CDYA 2YSSA 3FOLB 3O45A 1GYAA 4TPRL 4QRQA 2OX5A 4OCRH 2J8UB 3EO0A 1AGCA 1CGUA 4M6OL 5CD3B 4G8EA 3WD5H 3F7YA 3MROA 3GO1H 3MO1A 2XIDA 2V5MA 2BX5A 3R8BB 3NGBC 3FN3A 3QCTH 5EU5B 5IBUB 3FN9A 3PNWB 1R0AH 1P84J 3O81A 2VXUH 2CDFB 4RGNB 3FZUD 2MPAL 3X13A 3S8WA 4RIRB 5DJDA 1TITA 3NACH 1RJLB 4X9IA 1BJ8A 3T4AB 1Q9LA 4GRLA 4HFUH 2R0KH 4M8QB 1T1YB 1VFMA 1UFUA 1KTLB 4UIKL 3KYNA 4GXUN 2AK4D 1HZFA 4PV8B 5EC1A 5HHVH 4P23C 3PGDA 4XVJH 2NTFA 4PJBE 1I9JH 3K3QA 4MD0A 3T2PA 1C7TA 3O4LE 5J9PB 4NZDA 5HHMD 3SO3C 3LKNA 5FYJL 5HYJD 1PKQA 3EZ8A 5FYJU 4GG6E 1BD2D 4MMZC 2BFVL 2E5EA 2IEPA 4PJDF 3OR6A 4Y19D 3MLPA 1CZ8L 3W5NA 4JQXC 4J3OC 1IRAY 1JGEA 1JJUA 2BMKB 3OAYH 4EI5B 2E7CA 4NFBA 4FQ1L 2X4TA 3K80A 5E2TL 1FZJB 4HKZB 5F1IA 1EJ6A 2FGWH 4XP9L 3MSPA 5DUBA 5FV2A 5GGRB 3RJQB 2WW8A 4PB9H 3SOBH 2VDPH 1CK0H 3M45A 2ZCLH 2EH7H 4IRZH 1RZ8B 1UYWH 2NY2D 4I0KA 1BLNB 2BSTB 2I07A 3TO4D 3VXMB 5I8OH 2XKSA 3ULSB 5JQHC 2HMIC 2Y1VA 4EN3B 4NRXB 4NC2B 3AMKA 3P4OB 4LSTH 1IGJB 1CN4A 4ALAH 3BSZH 4IDJL 2GJ6B 5TDNB 4Y4FB 3ARWA 3K81A 5B8CA 1DBMH 4LHUB 5FHAL 3D39E 2G0DA 4OFYA 1W2KT 1W8OA 2EIZA 4LLWB 1Y6MR 2DWDA 4PBWD 3IDGB 2H6FB 2NY6D 2H45A 3GB7A 5ISZE 1X6LA 1JGVL 3TT3L 3D0VA 3W0WB 4JGUA 1F3DJ 1IFHL 3TIEA 3S98A 1NGXB 1A6VH 2C1OB 3VFOA 3DTXA 2VDQL 3BH9A 3L5IA 1FE8H 5D6DC 2CMRL 4V1RA 1NFIB 3UCRA 1NC4D 1XH3A 1XT5A 3WSQL 4RDQG 3ETBF 3DVNA 4M4RA 4P2OA 4JRYE 5IVZB 3MRRB 5SWQB 1JF1B 3QUZB 4BK5A 3PDOA 1X5YA 3UDWA 1T3FB 4FFVC 3WHXB 3A6CL 2CK2A 1Z2KA 2F54D 4KMTL 1ZA6B 1AHWC 1D8EB 1GCFA 1J0YA 4JPWL 1V7NL 5GS0D 1X9QA 3DXAB 3ARDB 2DQJL 4ORGB 4PJXE 2XOTA 1CICC 1IGTB 3TBYA 4G8IB 3O3BA 4LSSL 4MAUH 3QWOB 1BQUA 2HYMA 4P5KB 5D1QD 3SCMC 1FFPB 3QH3A 5B3JE 3S37L 4M7LL 4JDVB 3O11B 2HWZH 5T1DH 4UILL 5EO0B 2Q86B 5J4MA 4H1LH 3O41A 3HN3A 5D7IA 4LIQL 1LP9F 3FQXB 5SWSB 4IRSA 4OCMC 1CFQB 3B3IB 4D2NA 2UVEA 4LPTA 3ULUH 1DUYB 2BVQA 1R3IL 3MBED 5EU7C 4NN7C 4QOKA 2XZQH 2VXSL 4OBSA 4KU1A 3IFLL 5BRZB 2QR0B 3CVHH 5J1SC 2FB4H 3QIUA 1I3RA 1TDQA 4EJ1C 1ZEAH 1VFAB 2J8UE 2EDOA 2VDLH 2BNRB 4GS7B 4JM4H 2QADC 5H2BA 3DI2B 2FX7L 2QEJA 3DRQA 2V3PA 4X6EA 3VD4A 4WRLA 3VRJB 1QBLH 1RFDH 3BISA 5GGSY 5BV7H 1Z6JT 2FZ3A 2YWYA 1EFXA 5ELIA 2EC8A 4MNGA 4HLZG 3DUHA 4QCIA 4RGNE 2WBJD 3I6LE 4KWUA 4GXUM 2QSVA 3LEYH 1MJJB 4ZSOA 1AXIB 1A6UL 1RZGB 1JNHB 1ZSDA 2HLAA 4H8WL 3GSRB 2CDGA 3MCLL 3U1SH 4XNMA 5IFHL 3QNZB 3SY0B 4UNVA 3U4AA 3K1DA 1H3PH 4Y4KA 2ENYA 5FOJA 4JDTH 4PB0H 2FNBA 3L3OB 3TESA 2HT2D 3B2UC 2GSGA 5DJYA 2OR8A 2E9WA 2G75B 1OGTA 5E2VL 2B39A 1H35A 1EHAA 3HE6D 3CMOL 2EDEA 4PV9B 4A6YA 2YKLH 4G8GB 2RBLA 3O8XB 4RFNC 4GBXA 4Z95H 3P4NA 4LF3A 4H0HB 4NSKB 2H3NB 1JRHI 5HVGB 4GH7B 2AXGB 2YUXA 2OTWB 4JVWA 2VDOH 5A2LH 5IR1A 5CGMA 4Z0BL 4L9PB 2XA3A 1KGCE 4OIBA 1NGZA 5FAAA 3E6FA 3KR3L 2JJTA 5FFLA 1RAMA 4QXUH 1HN1A 4J4PC 5EH1A 3QUXB 1LO3L 3ZDYE 2Y6SD 3CAFA 1MCWM 5E5MB 3VFSB 3HZYB 4HUXB 3P0GB 4JVUA 2R2BA 3GMLA 4GOSA 5EIQA 4BH7A 2CDEB 3VXME 4ODUA 4MDIB 3B9KC 3DSWB 2OI9C 1J1XL 4QRPA 3MUGA 12E8L 5J13B 3MLSL 3WJLC 2OMBA 3KPTA 1AH1A 5H35A 2YZ8A 1XR9A 3STZA 3BD4A 2GJ6E 3FB5B 5H94A 4LNVA 3V52H 4LVNC 4X6DA 1O7SA 5C0IB 2XY2A 1KYOJ 1T0NB 2BVYA 1UZ8B 3ESUF 3FN0L 5GS1B 4FQQB 1ED3A 4UB0L 2RJMA 4O2FA 1XF5B 5EDXA 2WSKA 1UVQB 5ILTL 4KTDL 3W0WE 5DVOA 4H25A 5C6TH 5C71A 1AC0A 1ZT1B 1LEGA 4WDIB 5EU6B 5TH2B 4P4RB 4M7KH 2Z31C 3T2NL 3CFJA 2DAVA 4ODXB 4F15B 1BQSA 4OCWL 4EDXA 2CGRL 3HXCB 2WIMA 1HOCA 4IMLA 4M1DH 3S3PA 2BHZA 5T3XE 4UT7H 5EUOB 5EZLB 1XGYL 1NEUA 3V0AC 3SKJL 4HHAA 1V3KA 4WW2F 3E34B 4PJFB 4JO3L 5ALBL 3QDMD 3M17A 4ZYKA 1RHHB 3GBML 1MFCH 3UO1H 1MFBH 3UYPA 4F58L 5DYOA 1XGRB 4PJ7F 1KJVA 1YY8A 1HSBB 3QULA 4PLKD 4UTBL 4N9OB 5ICYA 1R5VB 2BRRH 5F9OL 1GHFL 4OFVA 3TYGH 1WBZA 3NFPA 1WTLA 3DXAE 4BKLB 2F0YB 5EOTB 3MRDA 4HKBA 3HZKA 5AEAA 1S9XB 3FL7A 2EKJA 3PL6A 3B5HA 3TYFA 4M6AA 3SKNA 1KCLA 5E2WH 3GMNA 3L1OH 5DFVC 4OLEA 4S11A 2E6QA 4KUZH 3HLAB 3NCJL 4LPCA 2PO6C 4KHTL 4L4JA 4PD4J 2FJHA 4PP1C 4LRIA 5SWSE 5I19L 4GXVL 4JREC 4JPKH 5E8PA 3KYKH 1R5WA 5AWNL 3HMWL 3KWWA 2F58L 3GSOA 3U83A 1FNSL 2X70B 5BRZE 4H26B 1U8PB 1CLYL 3O6FB 1R5IA 1W6JA 4N0YH 3QR2A 5EZJA 5EPMB 3EOYG 3C6LD 4J3XA 2BNRE 1GXEA 3MNVA 5GS2H 2R1WB 4HUWB 1KC5L 4QWWD 1VACB 4YDIL 2FSEA 2VIRB 5T5FH 1A6PA 4BQ8A 3CLFL 3IAQA 4JM2F 4OCXH 3NZ8A 5C0JA 1G7JB 2AJUH 5KZCD 4YXHL 1Q9WA 2BNQB 1UM4H 5GSRB 1CVSC 4F7TB 2G60L 3VU2A 1M7IA 4XP4H 4RDQF 5E0QA 4PJGF 5HYJE 3OG4B 3BRDA 2AJYH 1J10A 1MIEL 1ZA3B 3SFYB 1F8TL 2XWBA 3HUJF 1VPOH 5E24E 2QQLH 4WU5A 5IWLA 5C09D 4JFOA 2DRUA 3SDYL 2QKIB 4NGHL 5HDOA 4MSWA 4CVZA 2VLJB 1BFOA 5HD8D 3BAEH 1AGFB 1CD1A 4NCDA 2DM7A 3S88H 3KXFA 1XGUB 4LK4A 1T5WA 4G8GE 2QL1A 4R7DA 4G7VH 1A6AB 4Z76B 4GAJH 2PR4H 1F4HA 5DD6B 4PGCA 4YDVB 4PJAB 4DK6A 3DO7A 3QWRA 3AUVA 2P7TB 3GIVB 5AZEH 4MNHA 2HLFC 4PY8I 3VGHA 3LZFH 5CZVL 3S96B 1F4AA 2GTZB 2QHRL 5IM7A 3IRPX 2CIKB 1R3HB 4CU8A 1L0XA 1HZHL 3ZHLA 3QI9C 3RUGA 1CDUA 4K3JL 3BZFB 4P2YA 4Y5YC 1HH6B 4OUUB 3U4EB 2A9ML 2FECL 1XF1A 1IGYA 2AEWA 4NQCD 1JI1A 3RVWC 1FVEA 1OGAA 2FHBA 3CC5B 1QO3A 4S1QH 1F13A 4Q6IB 1YJDH 1CCZA 1JUFA 5E1HB 3NCMA 2JCCB 4HT1L 3VE0A 4LCWA 1YC8A 5LGHH 4F37F 4MZ2A 4NJ9H 2R0WL 5J6HA 3BH8B 4J1UB 3TZVC 4WVRA 4TTDD 4DUXA 2BVPB 1FJ1A 4KK6C 4PJ9B 3U7YH 3FFCA 4M00A 1X5GA 1TZGL 2DLEA 2EDKA 4NNXB 4YDKH 2V17L 3ILQD 1T03L 2ZP0T 3PQYA 1VGEH 3PWPB 1MVUA 4F9PC 4XCFH 2VQ1B 3EDEA 1PSKH 4TYUA 2NXZB 1OTSC 4X6CA 2E6JA 3ARBD 3TF7C 2FO1A 5D2LB 2Y9RT 4MGXA 1G9NC 1K4CA 4RA0C 8FABA 1J0KA 2F8VA 3KQ4A 3D3VB 2R56H 3BESR 2P44B 3MZTA 3BPNC 2VAAA 4Y2OA 1IILE 3SDAC 2XPGA 4HWBH 5EUOE 1KTDA 2VAJA 3PZ2B 1RZ7H 4JPVL 1T0MA 1OW0C 1J1OL 1EEYB 4PJFE 3GKWL 3I85A 3BZ4B 4M6ML 4YE4L 3SDXB 4HK0B 2EDFA 1Q9OB 4EZMA 5K93A 4YUEH 4JG0L 3ARYA 4UV4H 4UAOB 3SGDH 1IEAA 4TSBH 1DJSA 2ZPKH 4ZUSB 3LQAH 1F90L 3VMOA 1DQDH 3SDCD 1MHCA 2ZCHH 4CDGC 4J3UA 5EUKB 2R0KL 4D0CA 3TNNB 2DD8L 1IM9B 2XN9B 4FFZH 4XAWL 4V1SA 5FUCE 2XZZA 4AT6A 4JN2A 3SQBA 3FT4A 4ZOBA 2C3XA 2CUHA 3GSVA 5JHDD 3OJDB 2E7LC 3NMEA 5BJTB 4WI8A 1CXEA 4L8SA 5CD5D 3ARED 1NAKH 4GW5A 5ID0B 1T80A 2Y4SA 2EECA 3TO2B 1IAKB 4LQFH 1S7SA 5D1ZB 4M9OA 1E6OH 3DRTB 1NUDA 2CKBL 4GUPA 3SO5A 1BQHB 3KJ4C 4GW1B 1UKTA 4TRPH 1V5JA 4M48L 4HPYL 1NUFA 4CU7A 3UTTD 1HXYB 4HH9B 1ZLWH 1MFNA 3S36X 1G7PA 4ENEC 1A7RL 4GW4B 2ZKHL 2R2HB 5D96B 5BZWA 3B43A 5C08A 2HG5A 4S0TD 4PRHB 4AIZB 2ZCLL 3KPMA 2B1AH 3CUPA 2OQJB 4I0PB 3TJEH 3UPRA 3GBNL 2DLIA 5EN2B 3UPCA 1CG9B 2GCYB 2DQCH 1MCDA 4XP6L 2OYPA 5BW7C 4XVUC 3IJSA 3MJ7A 2DQDH 4NQDA 2BNQE 4X7SH 4S2SA 2JIXD 4QKXB 3HC0B 3HI5L 4R0LA 7FABL 4TVPE 3FJTA 1OP3K 1TZIA 2H1PH 1T2JA 4W4OA 4NQSA 3L3HA 3MOAL 4R6UA 3H9YA 4GG8B 3UTSD 2FBJL 1HHKB 4KMQA 2IC2A 4MXVF 1Q9KA 4Z7VB 3C6SA 4FQIL 1D5XA 5I1HH 1BEYL 1MELA 3O6LL 4MD5B 4KKJA 1CVRA 1F4XH 1A6WH 1WCBA 2VLJE 1QSED 1AGBA 4RX4A 5T1LD 5IW1A 4NO0D 3T0VA 5D7JA 3KPSB 4Y1AB 3QXDB 3ARRA 1IC5H 1T1XA 3TBWB 4NQCB 2PETA 3BIAX 4R97B 4KQ4L 3RL1B 1N59B 2PTTB 3VFPA 4PJAE 35C8H 5TPWH 1FV1A 5DMGC 4FQHB 3C08L 1D6VL 1RQ5A 1KPVB 5BS0B 5HPMA 4HPOH 2UYLB 5DZLA 5IG7B 2DKMA 2QHLA 3BZDA 5JTWA 2XTLA 3H3BC 3FO0H 4V1DA 1U3HB 4UOW1 1NGQH 2BDNH 3MMEB 4P5TC 4Y4HD 1FBIH 3OB0K 4DKFH 5E7FA 4V2BA 3WE6B 4OQ1A 4WUUD 3LOWA 4QRUA 1PW3A 5CBAA 4LBEA 4YHNA 2OSLA 2ESVD 1J0IA 1KN2L 2P24A 3ARTA 4FQXA 4PJ8C 2EEBA 3SGKC 4RRPA 1YPZB 3K74B 1DEEA 2JCCE 15C8L 3TIDA 1DBKL 2AXFA 1GZPA 2WIIA 5INCA 1ZLSL 3S36H 3CU1A 4Z7WB 4MCZA 1U92B 4KTEL 2PYFA 5CWSA 3EFFB 4FFVD 4KK9D 5E6IC 1AKJD 2E9JA 3EOAA 1J8HA 1DVFB 4U1SA 3DIFA 4M7LT 1I3GL 3MV7B 2K9UA 4J6RH 4K9EH 1MSPA 4YLQT 5I2IA 3PWPE 3TPKA 5C07A 5FA3B 2MQCA 1MCEA 5ITBL 2VLKB 1NCAL 1TFHA 3RI5F 4OKVB 1CICD 3D3VE 5E8NA 1OT2A 3DX8B 4LLYB 3SCMD 3MV9D 4XCCL 3VRIA 3MRKA 3RGVB 1KPRB 2OBGA 4PRAA 4XC3H 2YA1A 1NGYA 3IVKB 1YNKL 5TDPB 3ZL4H 4Z77A 3BZEA 3SDXE 2P47B 4KKAC 5IK3B 3BWAA 1B0GB 4HD9A 4K55A 2CKBA 3DV4B 3QDGD 5JOPD 4ODSL 4KY1H 4KRPC 2X9XA 5IUSA 3REWA 4ETYA 3WXWH 5LKNA 3HNSL 4Y8AA 4N1CA 2YRZA 4BQBA 1VKXB 3RIFK 1SVCP 3JV4A 3EO9L 3GZKA 1BIIB 3ZZ1A 5INDB 1ACYH 1E27A 2XN9E 4LVEA 2I27N 3ZE0F 2YPVL 4RRPG 3UTTB 2D7NA 5KSAA 4LKXB 1F11A 1LE5A 1KJ2H 4EDWL 4F80A 4I48A 4ZPTB 1J8KA 4F3FA 2BVTA 4DKEH 4DGVL 2W9DL 5I71C 1UZ6F 2W1NA 5FUOH 5CINL 5GIRB 4Z7QF 2C7UB 4P23B 5HHXH 1MJ8H 3LD8C 2Q6WB 4HUNB 3CH8A 1U9KA 3SO3B 3HZMB 5EBLA 1PBYA 2EEAA 3KGRA 1FZMA 5DJ6B 1C16A 1I85C 5ESVA 1MNUL 4JO1H 1FVCA 5FGBA 1A7NL 3TBVA 4WUKH 1KCRL 4BUHA 1LK3H 2HKHL 1U3YA 5CS7A 1RVFL 4LOUD 4WHTA 4PRHE 5JORA 1NEZB 1EGJL 4LLAA 1W0WB 3KLDA 2EDNA 3B2UD 1LEKB 1CDIA 4LLVA 1CLCA 3LQZA 3RY6C 2NCMA 4ZFGL 4JJHA 2HH0H 2XWTA 3PV6B 3ZE1F 1JE6A 5DA0B 4BJLA 2IH1B 3C8KB 3MBXL 5T1KD 3GJEB 3D39A 1A4KB 1ADQH 3OKKA 5JXEC 3MRBA 2XNAB 4U1KB 1YN6B 3BUYA 4ZTPH 3QG6A 4O58L 1QFHA 1MJUL 4KXZH 2GAZB 4Z7VE 4CMHC 4QXTB 4K8RH 1GC1H 4AYFA 5FV1L 3WS6C 1WIUA 5E8EB 2ITCB 2PUQT 3AY4C 3VXSB 2ADIB 2BOCA 4L9LC 2VR4A 1HILA 2YBRA 2D03H 5IMLB 3RKPA 1P5VA 3KPQA 1XF2A 3KPSE 1WISA 1UWGL 3IU4L 3B9KD 4Y1AE 4R8WH 2DI9A 2RFXA 4NQCE 4WI4A 3IAGC 1YMHA 1S7RB 2VXTH 1JYWA 4XT1C 3G5ZB 4JB9H 4RFOH 2A6KA 3UTZB 2VWEE 5BS0E 4R4BB 1H3UA 3RA7L 1MFDH 3GSQB 4YC2C 3GMRB 1DQJA 1HKLH 1Q94B 1T7VA 2Y36L 3WFDL 4KQ3L 2BEDB 3GI8L 1AY1L 3CFEA 4PP2B 1YEGL 4M5YH 4PJXA 4WW2C 3QUYA 4JZJC 4XPHL 1TENA 3U6RA 2Z31D 1RIHL 3NZHL 3BP5B 2G9HA 5T3XL 2QLVB 4QTIL 5LBSL 3MV01 4MVBC 2FWOA 5E8OB 5TE6L 4JFDA 2D7MA 1N6QL 4X4ZA 2H9GB 1YPZE 2EDHA 2LE9A 3K8MA 1P7QD 3CSBA 1KEGH 2AJSL 5E2WL 4UIMA 3MLTB 5I8EA 5C7XL 4GKNA 4Z7WE 5IW6A 2HRPH 4UDUB 1QUNA 1WFTA 3FHQA 1BMGA 1U93A 4HS3A 5CILH 1OF2A 3C60A 4WJ5A 3LS4L 3MV7E 4X4XA 1KBGH 4ONOA 1DQLL 3BP4A 5CZKA 2ZCKH 2VLKE 3HB3D 5F70A 4MMXC 4XVTH 2J8UA 5T33L 1AP2A 3BOVA 4MB4A 1T83C 5HI5C 3P9MB 4NN7B 1DCLA 3IDNB 1XFPA 5KVDH 3Q73B 3K7UA 5CJOL 3P77B 3RU8L 1G0YR 5L8JB 5DJ2B 3PE9A 4YDJA 3MX0A 5DFVD 1OP5K 4YBLC 2IBZX 2CDFA 1I1AC 4PGZA 4PG2C 4QRRB 2PO6D 2QADB 2Q8AH 4RIRA 5I0DA 1N64H 3D9AL 5TF1L 1RJLA 1E4WL 3JUYA 4LVOB 2X09A 3PHSA 3N9GL 3RWDA 3T4AA 4M8QA 1T1YA 4JM2C 1KTLA 3RBSA 2FBOJ 4Z8FL 4KK8C 4MNQB 3DNKA 5DUML 3MLVH 2NZ9D 4PV8A 1FDLH 3MLUH 2FEDC 3UTTE 2A2QT 1S7TB 5J9PA 4ONHB 3JZ7A 5LQBL 3R0NA 4PBVC 3T08A 1MQKH 1SQCA 2R4RH 3GHBH 3JSSA 1S9KC 4LU5L 5A3IC 1T2XA 5IBTH 1N8ZA 3T77B 5JW4N 4NQVB 4G6KH 5E56A 2J5LB 4IMKA 4L3ED 5EOCJ 2BMKA 4EI5A 2DQEH 4KRLB 4RBPH 1U8JB 4JFXB 1FZJA 4N0RA 4KVCH 25C8H 4TQEH 1FH5L 4I1NB 3JTSB 5GGRA 3GM0A 2EE6A 3CZFB 5HGAB 4PR5B 1G84A 2WWMD 3NA9H 4ZDHB 5TE4H 3VXMA 5IBUG 2J2ZA 3ULSA 3UX9B 4G5ZH 4EN3A 4NRXA 5TGBB 4CVWA 3P4OA 5B8CC 5E4EB 5EZOL 3QPQC 4OIIL 4OTXH 5DMIH 4K3EH 3DX9B 3S5LG 2VYRE 1SEBB 3JTTB 4Q0XL 3MA9L 1LTXB 3OSKA 5DJ8A 4MQXC 1F00I 2GJ6A 4Y4FA 5TDNA 1Z0NA 4LHUA 4OZ4B 1H3AA 1AR1C 1II4E 5IVXF 4AEIL 1G7HB 2HLFD 3IXTB 2VZVA 2R9HD 4R4FL 4AH2B 4EXPX 1P4LB 3V5KB 4XTRC 5DQDH 2UVFA 5DD5H 3QI9D 5DD1H 4XPGL 2XRAL 2XQBH 3QEQD 1NGXA 4P2OC 2C1OA 2SEBB 1EBPA 1NFIA 3A6BH 5CSZB 3UDWC 5L6YL 1IMHC 3U0PB 3WIHH 5IVZA 3MXWL 4DKDC 2LU4A 1PYWB 3MRRA 4JFHD 5SWQA 3N1MC 4BH8B 2M26A 3EDDA 2Z31B 2A1WH 2ESVE 1T3FA 1U8LB 2AGJL 3PXJA 4G6JH 3QG7L 3VDBA 4U0RC 3WHXA 4G6AD 4M4PA 2EXWD 1C1EH 1ZA6A 1FVDB 3HNVL 4FQ2L 1NMBL 3TZVD 1OAYH 3GMMB 2YMXH 3EZJB 4FP8H 4L8BB 4KK6D 2YEZB 4YHLL 1GAFH 3DV6B 1ORSA 1NLDL 4JFZH 4LPXA 2QSTA 3ARDA 3DXAA 3Q6GH 4ORGA 1Z3GL 4DN3H 1IGTA 1DQDL 1OCWH 5HI4D 4G8IA 1OTSD 2D0GA 4P5KA 2X10A 9CGTA 1SM3L 1FFPA 3QDJD 4IRSC 4JDVA 4OD1L 4P2RB 4O02L 3O11A 3QRGH 2O61B 3SDAD 2DQGH 2ZG3A 1KB5B 2OR9L 1NLBH 4K94L 4MU9A 1MWAL 1WITA 5SWSA 2LFGA 1CFQA 3B3IA 1DUYA 3SE3C 4GSDL 1TCRB 2EDTA 5JIIA 1F3DH 1OP9A 5IBLC 1PX3A 5FEBA 4U6HB 2J88H 2MQ3A 5BRZA 3WIFB 2QR0A 1CGYA 4JHZA 3L3KB 1EMTL 4JREB 5E9DD 3VXPB 1VFAA 2BNRA 3C5ZB 5EU7E 3T0BA 4KK5C 2EDJA 4NDMB 3V6ZB 3VRJA 3FO1B 4NUGL 1A3RL 1RZKH 2A6IA 2L7UA 1VFOA 1IBGL 5AG9A 5JXAL 2JK5B 3QJFA 2IG2H 1OB1A 1A4JB 2OR7A 2YS4A 1MRCH 5DFWH 1KN4L 2OJZL 4BZ2L 3RDTC 4QRRE 5CMAB 4GMSL 4LLMB 2Q87A 1RZGA 3SJVD 1I9RH 4ETQA 4Y4KC 1JNHA 3MJ6A 1TNMA 4D3CL 3GSRA 5IHZA 2NY1B 3QNZA 1FGNH 4MNQE 4OV6F 3SY0A 4L3EB 2JKXA 1WIOA 3AM8A 4ENED 1IAIL 3D2UD 3F7VB 1I8IB 2QJDA 4GBXC 4XCEB 2H32B 5JW4M 5DK0B 3LN5B 3EYOB 2W92A 3P30H 2HFFB 2G75A 1B88A 5FO8B 4PV9A 4G8GA 3O8XA 1HYSD 4N5UA 5E2UH 2YZ1A 4BQ9A 3OXUA 1CLZL 2YD3A 2JJTC 4TVPL 4NSKA 4YHPA 2H3NA 3MODL 2DM2A 2YD8A 2IBZY 5JDJA 4YXKL 2AXGA 4KXZI 2OTWA 4I3SH 3NIDE 4UBDC 4NWUL 4AL8H 4M5ZH 4OF8A 5CIPH 1JZ7A 1A1NB 4BELD 3PZ3B 4NIKB 3QCVL 2YA0A 3QUXA 2BRQA 2NNAB 4IIQC 5E5MA 4IRJD 3HZYA 1VENA 4HUXA 5I8KH 5DEGB 5IESH 1MIML 4P9ML 1BECA 4OCSL 2X4PA 3WKMH 2CDEA 4NYLB 4CDHA 4CVUA 4MDIA 2DIAA 1FRGL 1H39A 3UJIH 4QNPE 1NDGB 5HVHB 3KAAA 3E3QC 3OKMB 4I4WB 2GY5A 5DD0H 1IGCH 5HHQB 4H88H 4JHAL 2BHYA 5GRVK 1LVEA 1AO7D 4P9HH 5C0IA 1T0NA 1T4KB 3GRWH 2OZ4A 1I8LA 1UZ8A 5GS1A 4FQQA 1JHKL 4GAGH 4XBPB 2WUCL 4TNVK 1NCBL 1XF5A 4F2MB 1IGFH 1UVQA 2V8JA 3CJJA 4TOYH 5I1IH 2IGFH 2C9AA 4EEEA 3BDYH 4UQ2A 2YRLA 1ZT1A 4P5TD 1AQKH 4WDIA 5EU6A 5TH2A 4P4RA 2GUOB 3H2WA 5FB8B 2V3NA 3VXTB 4ODXA 2VDNH 4PJXF 2YXFA 4C56B 3LPFA 4HK3J 3U4BH 4MQ7B 4RWYL 3GJFH 2Y06L 1KXQE 5EUOA 5EZLA 4MJID 1YEJH 1Q38A 4POZD 5EA0H 2ZUXA 5EO1B 3P4LA 1FLRL 2O5ZH 1U42A 3UJTL 1L7IH 1RHHA 2J4WH 5JW3H 4Y16D 3WJJC 4XVSH 4Z18A 5HI3C 4FS0A 5E4IA 1HSBA 1LD9A 5C0AB 2DS4A 4JFED 3PL6C 2W0KA 1WAAE 4JY4B 3L3JB 4AG4H 3W2DH 4KKCC 4BKLA 4CAGA 3D85B 4J3VA 5DJXB 1CE1H 3QQ3B 5EOTA 4W6XB 1S9XA 5ENWA 3DHMA 1JHLL 2R29H 5MENA 4OLXL 5B22A 2J8UF 1CF8H 4M43L 4LRIC 3QHFH 2FX8H 4P2RE 3SKOB 3HLAA 1PJ9A 3Q78B 3DX6B 4M03A 1I1RA 2OP4H 3LSOB 4H8WC 5HHXL 5F6IB 4KKAD 2ICWI 2OXHA 4L9DA 5F6HI 4DVRH 2X70A 4KRPD 4PRNB 2P43B 4H26A 1U8PA 4JGMA 4P3WA 1DBAH 4WHCA 3O6FA 3Q1SH 4XPFH 5MEOA 4GTSB 3TV3L 1CGVA 3QEGL 2CK0H 5EPMA 1K8DA 4DAGH 4MA7L 5F72S 3HXFB 1IQWL 2R1WA 4HUWA 1VACA 2VRAA 3KPRD 2VIRA 4JO4H 1RUML 5HGGS 1XGTB 1G7JA 2NY5L 4R7NB 2BNQA 4PJDB 5GSRA 1T0PB 3ULUD 4PY7B 3BUTA 3BE1H 2F9BT 2B1HH 2HT4C 1BIHA 5IWLC 3RL2B 3V8CA 1MHPL 3ISWA 1BM3H 4M8VA 2ZSWB 4OFPA 1ZA3A 4LEXL 3H6JA 4WI5A 4D9QD 4JANB 2WY8A 5FM4A 1ZVYA 4K2UH 2N4IA 5DJ0B 4D9LL 2QKIA 4URTB 4L3EE 5I15H 5DJZA 2OK0H 4KAQH 3SKUD 1UC6A 1XGUA 4YQXH 4YWGH 3EW3B 4RMUA 3LY6A 1FN4B 4Z76A 1BFVH 1ZVSB 1TQCC 5E08L 5CCKL 5DD6A 4PJAA 4QEGA 1JL8A 1RUPL 5KSVB 4W6YB 4OV5B 1A7QH 5K9QG 1YY9C 2P7TA 4JKLA 4OD3H 3GIVA 1OWRM 2VXTL 1OPGH 3IU3A 4MS8D 2MTPA 4OFDA 3S96A 1MI5D 2GTZA 4NKQB 1K3IA 5TDOB 2F74B 3G6JB 1TJHL 1R3HA 2CIKA 4R2GC 4FXGB 1MCHA 1OD7A 1JWSB 4LVHC 1QQFA 1SBSL 2HTKC 3BZFA 1HH6A 4L8CB 4OUUA 3U4EA 3CMGA 4KVNL 1U6AH 3PUCA 3CC5A 4MX7B 1JCSB 4NWTL 3WUZA 4NPYA 2F19H 2FR4B 4FQLH 1T7XA 5ETUB 4Q6IA 3TVMD 4KKNA 3SDDD 4OZHB 5J11C 2JCCA 3A0OA 4M1GH 1TNBB 4HQQH 4BYHA 3RVUD 5GGVL 1UA6L 3I6GB 2LVCA 1QFUH 2V9TA 3BH8A 1MRFH 3MLYL 4J1UA 5E6ZA 1UWEL 2BVPA 4PJ8B 4PJ9A 4F7PA 4DQOL 3V9FA 4NNXA 1MF2H 5IHBA 2IH3A 2VQ1A 2D4DA 4S1RL 3QO0B 3KDMB 1AXTH 4F57L 5D2LA 3MLXH 3ULVL 2CPCA 1MREL 5E6IB 3D3VA 2W9EH 2CLZB 3CXHK 5BMFL 4C56E 1WSST 4Y7MA 5L7XH 2GYSA 1ZGLB 1IE5A 1I3VA 4MVBD 4P59L 1CDHA 4WFED 1EEYA 3EFDH 1KJ3H 3BZ4A 3SDXA 5F7DB 3GGWA 5FO7B 1Q9OA 3QIWD 3KLAA 2DI7A 5JIPA 1JYVA 5IB5B 1IL1B 5C0AE 4KDWA 4ZUSA 3M8OL 1ORQB 3RWFA 3LRGA 1CE6A 4PRBB 5GZOC 4ZPVB 1IAIM 2F5AH 1HINL 5I73C 3TNNA 4L8SC 2XN9A 4OZGF 1S64B 1CR9L 3SN6N 1PG7W 2HJFB 2VABB 1YEKH 1QNZL 1E6JL 3HNTH 3OJDA 5HI5D 3K8LA 1NCCH 1FAIL 3K2UH 1KIQB 5BJTA 1B9ZA 1R3LB 5IMKA 4D9RE 2XG5A 5ID0A 1X3DA 4LNRB 4NKDB 3TA3B 3TO2A 1IAKA 1C08B 5D1ZA 4HWEH 1DCEB 3DRTA 1F58H 3EUVB 4M61B 4KHXL 1TMCB 4GRLD 4LL9A 2DM3A 1BQHA 3Q5OA 1Y6KR 4GW1A 1TN6B 1B6UA 1SY6A 2OL3L 5I30H 2GY7B 1A9EB 4UT9L 4GTMB 5C0RH 5SX5H 1KB9J 4HH9A 3U2SB 1IKFL 1PY9A 4GW4A 1BZ7B 2R2HA 3NFSL 4FTVB 1PLGL 1LNUA 3SJVE 3ARGB 3MCKB 4PRHA 1CXIA 1N4RB 4N8PA 1SEQL 1IKNA 4P5MB 3RAJL 2OQJA 2RB8A 4WCYL 4R0LC 4N5ED 5EN2A 2ZJSL 1CG9A 3DRAB 2PTUA 1H15B 1KLGB 1KCSL 4W4OC 3LKSA 3H0TB 1MLCB 2AQ2A 3PHOB 4PJDE 1YQVH 5GSVB 3HC0A 2K1MA 4UT6H 5LCVL 1MPAH 2JELL 4GRMB 3LMJL 4HZAA 1MFEH 3AS3A 2OZ4H 4YHOL 4GG8A 3KS0H 3RNKB 2AXJA 3D69A 2O5YH 2HVJB 4NKOB 5F9JB 4Z7VA 5L88L 4KPHL 3P4MA 4XRCB 5GGQH 5GS2D 1YECH 4LGPB 3K7XA 5D7JC 3TC9A 5FYLE 4MD5A 5IFAH 1NAMB 5ADOL 3A67H 4QO1A 1CBVH 5IF0B 3FMGH 5F1NB 4OLYL 1WZMA 3KPSA 4CMHB 3OHXB 4Y1AA 4WGVB 5DRNA 3S3SA 3TBWA 3QPQD 4OFYD 3RL1A 3VFRA 1N59A 2PTTA 1BQHG 1INDL 1ZK9A 3RJDA 5ITFB 1YEDB 1CFVH 1RJYB 4PRPD 5BS0A 1KPVA 3G6AB 2UYLA 1C5BL 3GNMH 1AR1D 5KW9H 1Q0XL 5IROA 4ZNCD 5IG7A 1UWXH 3G6JE 1SA4B 3CDCA 4WFFE 1U3HA 4HMCA 4ZUVB 3MMEA 1Q1JL 4MAYB 4FQXC 3U79A 3H3PH 4XTRD 3WE6A 1YEEL 4Q97A 1QKZH 5JHLH 3HHRB 5DMKA 4OFIA 4YC2B 4QXGL 4DN3L 3G9AB 2H2SC 3CD4A 2G5RA 5MEPA 3BGFC 3UZQA 5F9AC 3B8YA 1YPZA 3DO3A 1D5BB 4GTOB 5CKGA 4WW2B 3IJHB 2V2WB 4JZJB 4FFYL 4LKCB 5EUOF 2IADB 2MJWA 1U92A 1JTOA 4HXBH 3VJ6B 1LQSR 1KCUL 4PJ7B 1DVFA 5DHVA 3VG0L 4PUBL 3MV7A 3P2TA 4U6VL 3R0MA 4KI1A 1N4XL 1A6ZB 5DHXB 1V05A 5FA3A 2J88L 1B6DA 1UB5A 2ZUQC 4R26L 1CFSB 2ORBL 3VH8A 4GTQB 3DX8A 1H0DB 4LLYA 2R0LL 4NP4H 5EG6C 3RGVA 1KPRA 4HC1A 3IVKA 5TDPA 4OCYH 4QOKD 1E4XL 2N1KA 1HWHB 2YD1A 1KELL 5IK3A 3EOTL 2APFA 1B0GA 5AAWA 3DV4A 3T4YB 3QIUD 4WO4A 5IBLD 5KBNC 5FHBH 1X81B 4FXKB 4YBLB 2Z8VC 1F4WH 1I1AB 1MCLA 3I3DA 1RMFH 4MA3B 4OLZL 1BIIA 5INDA 3RWGA 3GMPB 4HXAH 1X5HA 4JEGB 1IC7L 3BGMB 1RJCA 2XZAH 3JWOL 1EFXD 4PY8J 1GGIL 4ZPTA 2NTFB 4JM2B 4YR6B 3RVXC 4LEOB 4KI5F 4E41D 1FIEA 1MRDL 2BK8A 1WZ1L 5GIRA 2C7UA 4P23A 1YEHH 5E5RB 2BHUA 5D71H 1FORH 1KEMH 3MRCB 2IPKB 3MYJB 4QF1A 5FGBC 4PJGB 4ONFH 5TFSL 5I16B 2Q6WA 1BJ1H 3HUJB 4LARH 1EPFA 3HZMA 1S5HB 3BPOB 3SGEI 5DJ6A 4HUKB 4Y4KD 2E27L 2A6DB 1LE9B 4PGDB 5DURB 3QAZC 3TT1L 3ZE2E 3BI9X 4FTVE 5DFTA 5E2JA 5FYKE 4TSCH 5CSBA 3VH8G 2VL4A 2FHFA 3NTCH 1OP5H 4PRIA 3O9WD 3UTPD 1NEZA 4GBXD 4P48A 5F96L 1W0WA 4HJJH 1LEKA 2I07B 1LD7B 4HBQA 4XB8A 1FZKA 3WDIA 1XR8B 4TUOB 1GH7A 2VTFA 2Z91B 3PV6A 2FIRT 1K6QH 5F7LB 3UAJC 2FATH 1X7QA 2IH1A 3C8KA 4GMTH 3GJEA 5DD0L 4WENB 3ES6B 1A4KA 2QSQA 4PJAF 4WI2A 2X4OB 3BKCL 2XNAA 4UBDD 4E0RB 1NMAH 2BOBB 2DQHL 3LCYA 3UBXB 1IEHA 1RZJL 2GAZA 3B9VA 1MQ8A 4QXTA 4NZRH 2CLRB 3V4UL 1CGSH 1QHOA 2E9IA 1INEL 5MEQB 5E8EA 2ITCA 3BDYL 3TIEB 4TTGA 4QRPD 2ADIA 3VXSA 1X5JA 1WTGT 2XT1B 4CN4A 4IOSD 3ZKQD 1OAZL 4XP1L 1A64A 3VRLE 3NH7H 1LDPH 5I18H 3U4BL 1X5IA 4RISL 4OLWL 1S7RA 1H8NA 4P2OB 4XHQA 5HPOA 2NZIA 2AEQH 3G5ZA 2YUZA 1KG0B 2NY3B 1L4IA 3L6FA 2Z8SA 1F4YH 2O5ZL 3QUYC 4YO0B 3GMRA 4PS4L 3H42L 1Q94A 2HAZA 4M7JH 4GJTB 1FO0B 1R24B 1Q8MA 4P2QB 5IMOB 1OVZA 3NFNA 4PP2A 1NEZG 3RWEA 3QT2A 4K3HA 4AIOA 4HV8A 3VI3E 2MOVA 1WGOA 3BP5A 5D2LF 3O3BB 3DSFH 3MRQB 3OPZL 5E8OA 5GJSL 1GGTA 1ZHNA 1NL0H 1VADB 3B2VL 4KGLA 5F3BB 4M93C 3EGSB 2VC2H 2QQKL 3MLTA 2J6EH 2CO7B 4UDUA 2VDKL 3HMXL 2X89A 4PJ7E 3VA2C 3CU7A 1A5FH 5HI3D 2A73B 1S7XB 4IRSB 3V4VH 2EZ0D 1S9YB 4HF5H 4JDZB 1B4JH 2YN3A 3PL6D 2O5XH 1JCQB 4IJ3C 1QPXA 4DOHB 1JTPA 2UUDK 2VDRL 3P9MA 1WFUA 4K3DL 3IDNA 4XPFL 5HBBA 4RGNC 3P77A 4KZEH 1LDSA 3KPPB 5H2BB 4DGYL 2Y5EA 2APVA 1KB5L 3GSXB 4H20L 5DJ2A 4JN1H 4DCQB 4M6NH 1FPTL 4WW1A 1M7DB 3KNBB 3OAUH 3SBWA 2MWCA 1EFXB 4QRRA 3KPNB 4MNGB 4QCIB 2B1HL 3CK0L 4H0GA 3E1F1 4JHWL 4K7PX 1I8MB 1RHFA 3ZKND 2QBWA 3NABH 4MJ4A 1OSZA 1HXMA 3V0VA 4MNQA 4U1NB 1BZQK 2IF7A 3QNYB 3RDTB 2CDGB 2D0HA 1HI6B 3O6ML 4WFGD 4NZJA 1S7TA 4HEPG 5GZNC 3U0WH 4ELKB 4ONHA 2X05A 1U91B 1Q72L 1YEIL 2Y5TB 1OAKH 3ZT5A 4EI5C 3MREB 2AI0H 1GGBH 3T77A 4NQVA 3NCBB 3MLRH 4PJGE 4FFWC 3HUJE 3F58H 3PWNB 5IR1B 5M7QA 1U8JA 4JFXA 1S7WB 5T3ZL 2WANA 3E6FB 4MD4B 3U30C 4CW1B 5B38B 4OUOA 3JTSA 4EN3C 1MLBA 5I75B 4NM8L 2OTPA 3OKEB 5EU3A 5ACZB 4PR5A 4L5FL 3KXFD 4ZDHA 1H3GA 1T1WB 2HFTA 5CEZL 1EUTA 1X5ZA 4J4PA 1B2WL 2G5BB 4Y4FC 3SKMB 5L0QB 3W5MA 3EIFA 1ZTXL 4AZ8A 4IIQB 3QWRD 3T2QA 3DX9A 5GHWH 1QP1A 1SEBA 3P0VL 1UT9A 4OGXL 4M1GL 3L5HA 4OZ4A 1OTTC 3FHAA 1DTUA 3EHBD 4WEBH 3PXHA 1G7HA 4YHZL 4KRNA 1I1FB 2X4NB 3S34L 3PABB 4AH2A 3WJLA 1C3DA 1KCVL 1P4LA 1FL6B 4NNPL 4LLDB 3V5KA 4R2GD 1OGAD 2DTSA 2DB8A 1ZHKB 2HTKD 5B4MC 5F7EH 3HG1D 1UCTA 2NTSP 5DVNA 4U6YB 3WNPA 5CZXC 4LCWD 5CSZA 1QFWL 3VMPA 3U0PA 5TE7H 1OTUC 3ULVF 4K7PH 1HOCB 4AEHL 1PYWA 5D2NB 3BQUC 4HC1H 4LASL 2HTLD 4GQPH 2EDQA 4BH8A 5ALCH 5K9QI 4Y5XA 1CL7I 3L7EB 5EORH 2VITB 1U8LA 3WFBL 5F88B 4HHAB 3FFCD 5D1XC 1QG3A 5F7HA 1FVDA 1P4IH 5I1CL 4O9HL 4Z7UB 2VLME 5JNYB 3AB0C 3PQYD 5FUZL 4GTRB 1Z0MA 3GMMA 1WWCA 1Z5LA 2YEZA 1IAII 4K71B 3QUMB 1AFVH 5ACLA 5ICYB 3DV6A 2ATKA 1WAAA 4JFFB 2VH5L 4HX1B 4P2QE 4NQEB 1KFAL 1RULL 2IBBA 3DHJA 2VSCA 4UINH 4NO3B 5IV2B 2ADGB 2I5YH 4A2LA 3CVIH 1FPPB 4U1IB 1S3KH 4GRWH 4RQQB 4YBHA 4DN4L 4P2RA 4U1JB 4F9LA 2O61A 3VGEA 3AS1A 1KB5A 3OXRB 4OJFH 2R39A 1JV5B 1KJMA 5E99H 2UY6A 1EHXA 3R06B 2WY7A 4PFEA 2Q1EA 3LPWA 4U33A 1TCRA 5TQ0L 4DGIL 2V6HA 5E8PB 1R5WB 4U6HA 3T0AA 1J0JA 3WIFA 5I0ZA 3ZYOA 1I8KB 5GZOD 3TBTB 1A7BA 5CAYB 3VXPA 3UEZA 3ZTNH 4DOHE 3C5ZA 1U8MB 4WEMB 4NDMA 4PJHB 1WWWX 1PQZB 3V6ZA 5DSCB 4QYOB 4N8CH 1NUNB 2ICCA 1LO2H 5BVPH 3GI9L 1IARB 4YFLF 2JK5A 1KTRL 1A4JA 4UU9B 5FYJE 5C0BA 1W6KA 3HA0A 3W11C 4P57B 4TNVF 1W72L 4MNGE 5IT2H 5CMAA 5HHNB 2PCPA 1MCBA 3OAZH 3VWKA 4LLMA 1JNLH 3OZ9H 3AM8C 3ZSTA 4O4YL 3LDBB 4OI9A 1A21A 5IGXL 1NFDA 2R0ZL 2XWBB 5C08D 3OWEA 5DT1H 4G8FB 3U46B 5C2BL 1RU9H 4TSAH 4ODVH 1RIVH 3O8XC 3F7VA 1I8IA 5DR5H 4XCEA 1TNZB 2H32A 1N7MH 1SJEB 5DK0A 3LN5A 4NQDD 4CVZB 3EYOA 2PNDA 2HFFA 4Q9QH 5FO8A 1RK0B 1NBVH 1T04B 3VFWA 1R3KA 4DW2H 4F7MB 2EYSB 5F7UA 3F62A 3TH4T 4M7ZC 5GS0L 4ZOAA 4AJ0A 3QJHA 4RCAA 5I74C 3QUXC 4AENB 1GPOL 3DO7B 4UNTA 1VB9A 1RD6A 3QULB 2IANB 4K7PY 5E95B 4MXVE 5D7KE 2CIIA 1CDJA 1QYGL 1SMOA 2NNAA 1ZT7A 5FYLL 2Y7QB 1DQMH 3WFCH 4GQ9H 5DEGA 1C5CL 3CXDH 1EUUA 4KH2A 3U7WH 4X5XB 1GOHA 1LK2B 2NXYB 5D7JD 3H3PL 4NYLA 5DI8B 4ERSH 5EWIL 3WNMA 2I60H 4ONGH 3RZCC 1NDGA 1UM6L 3TCLB 3OKMA 2RCSH 1NSNL 4I4WA 1I8LC 5IEHA 5GS1C 3VE0B 5DO2D 5HHQA 4G6ML 1N0XH 4UV7H 2PXYD 2YK1L 3NAAH 1T4KA 4P4KD 1KOAA 2JJVA 1S78C 1DEDA 5TQ2H 3T0EC 4HS8L 3EUUA 2VDML 4XBPA 4F15C 1EJOH 4F2MA 3X3GL 1WCQA 4ODHH 2XKNB 2N7BA 4FQXD 4WTZA 2GUOA 5FB8A 1RUQH 3VXTA 4Y19A 4AIXA 3WIIH 4NM4H 4C56A 3F7RA 3SHSA 4MQ7A 4U3XA 4K94C 1L0QA 5ABDE 4F9PA 2BXYA 5D2NE 4QHUB 2XPGB 1DBJL 4OM1H 4WWKA 1J8HD 5EO1A 4WTWA 2VLRB 1BFTA 1FL5B 3G04A 2VZOA 5A2IH 3LPGA 4TULL 4XH2B 4Z7UE 5DRXB 5DJCB 3QWQB 2QQNL 5C0AA 4PYHA 4HIXL 1Q0YL 1PFCA 1T66C 2ARWA 1Y6NR 4JFFE 2HT3C 4P46B 1FIGL 4JY4A 3L3JA 4HBCL 4NQEE 2DQUH 1G0DA 3D85A 1J5OL 4JAMB 2Q20A 3SE4A 1NI1B 5GPRA 4XC1H 3ROOB 4WEUD 5MERB 4XWOD 5AYUH 1FYTB 4O2CA 4JN2B 4OQTL 3FT4B 2IAMB 3F5WB 3WV0A 1A7OL 3SKOA 1CGTA 4NC1C 4WWID 4PIRF 5MP6H 3CZJA 3FRUB 4NRZA 4OSUL 2AJVH 4ZUTB 4LRNH 2FIKB 3DX6A 5LG1A 3ZKXC 1BBDL 5IKCB 1GOGA 3LSOA 4GKZB 2E7LA 2DLFL 2JB5L 5BO1H 2V8IA 1W72A 1I4FB 4JKMA 4MWFB 2V5RA 4FNLH 3ZDZF 1YQ2A 1AI1L 3VFGH 1WZKA 4WTZG 1CS6A 1M1SA 4PRNA 5KSAD 3C8DA 4ZS7L 4KI5C 2NY7H 3MV8B 3O4LD 5D93C 1X4YA 1O79A 1DN2A 1WEJH 2J8HA 4HG4K 1WICA 2F54A 1C12B 1J1PH 3DYOA 4LPWA 4PJHE 4RAHA 1INQB 2N56A 2XTJB 3CUPB 3RX8A 1XGTA 3PGFL 4RMQA 1UZ6E 4R7NA 4PJDA 3RVXD 4IOIB 4NCC2 4PY7A 3T8XB 4RMTA 3CSYB 2A0LC 1JHTB 4N68A 4X9HA 3RL2A 4J8RB 1JK8B 4HAGA 1TQBB 3BKYL 2ZSWA 5H37H 2EIBA 3X3FH 1HSAA 1LO4L 3QHZL 4M1CC 2XV6B 3MC0A 1JYXA 2D7OA 2A9NH 3QUKB 1NCTA 4RFEB 1GL4B 2D7QA 4JANA 5AZ2H 1BZ9B 3CNKA 3IFOA 3DPBA 1D5XB 1UCBH 1RY7B 1QFWM 5I1JL 2AP2A 5CUSL 1QHPA 2PMVA 5D8JL 5FGRA 2ADFL 1CQKA 2UZXB 1FN4A 3D39D 1ZVSA 4JG1L 2XQWA 4QNPF 1T1XB 2IPUK 5KSVA 5F9DC 4OV5A 5L2KB 5ISZD 3N50A 4JY6A 5IVXB 3BO8B 3GMQB 2UZYB 5C0ND 2F74A 2IANE 3G6JA 4M62L 4JCLA 4YXLH 5E8DH 2CXKA 2COQA 1JWSA 4Z5RB 4L8CA 1NAML 1MAML 4M7JL 4Q6IC 4V1DB 4C58B 3SQOL 2X1PA 3QYCA 2FX9L 1AE6L 2X7LB 4MX7A 4JRYD 1RZFH 3PP3K 3O6KL 3S35L 4HCRH 4MA8H 5EOQH 2FR4A 4WV1B 4HDIB 5ETUA 2VXVH 2HJLB 4YHNB 4TUKL 2VLLB 4NKIL 3ILPB 4OZHA 3PDDA 5D72H 1J9CT 4NZUH 4PJ9C 2C26A 4P2CG 1G7LB 1PVHA 2AK1H 3PWUB 1YN7B 4MJ2A 2AXFB 2A38A 1A14H 2GI7A 4LCIL 4PJ8A 1LILA 5C6WH 2NXZC 5I1AB 3BGFB 1EBAA 4RMRA 3SGKA 3QDHA 4ESKA 4Q9RL 2J6EL 5CWSB 2E8ZA 2YXMA 1JFQL 2Y07H 3QUYD 1HH9B 2QSCL 3BFOA 3QRFM 3RWHB 2YD9A 3TN0B 4GTTB 2DQTH 3QO0A 43C9B 4CL7A 5I2IB 1HIML 5C07B 5E6IA 2XFXB 2CLZA 5DQJB 5JQ6H 1CIDA 4DFIA 1K5NB 4QHNB 4LDLB 1ZGLA 1P1ZB 4TNWK 4OQTA 3JV6B 5KJRH 4UAOC 3DMMB 4YHKL 1J88A 4JO2H 1OD9A 3MRKB 2AABH 1WFNA 2D9QB 2ZUQB 3C60D 1QPPA 2VLRE 5F7DA 1A7PH 2NY0D 5FO7A 5I17A 3MJGX 4EKXA 4S1DC 4Z77B 5GRJL 2R8SL 4XAKE 1IL1A 1ORQA 1CDBA 2V2XB 4P3CL 5FXCH 4OLUH 5FCSH 4PRBA 1KIPB 4ZPVA 6CGTA 3REWB 2P49B 4LSRH 1P9MA 4XMLH 4FZEH 2KZ1B 4Y2DC 2HJFA 3IRZA 1VESA 3NCEB 2VABA 4ISVB 4MXQC 2NY5C 3U9PH 5D1ZC 4MXWL 1FYTE 1KIQA 4ZUUB 4M3KB 4RGND 2DQIH 2A83B 1R3LA 3IFNL 3I6LD 4ODTL 2WLYA 3I50L 1L7TH 3IDXH 4LNRA 4NKDA 2Z0BA 3TA3A 1C08A 1FSKC 2MCPH 4M61A 5D7SL 5CBEB 4LSQL 3RVVD 1OLZA 1EO7A 1HHGA 1QSVA 4M3JA 5D96C 5D70L 2LABA 5L8LB 5M94B 4D0BB 3TM6A 1IKNC 2W60A 1H3BA 1YEFH 3U2SA 5LJYH 1PG7L 1OAXH 1BZ7A 4YX2L 1NFDF 3MV8E 4YDEB 3SE8L 3HFML 3ARGA 3MCKA 3ARFC 1EDQA 1FGVL 3QA3B 4JPIB 3GEWB 4WI7A 1DBBL 1H15A 1KLGA 3U9UB 5GZND 2D31B 2XTJE 3O0RL 2B4CL 3H0TA 1MLCA 3RI5K 1A47A 2YWZA 3PHOA 1KGCD 5GSVA 2WK2A 1D5IL 1HDMB 4EI5D 4X7FC 2PYEA 4AEFA 4GRMA 2B2XL 4ZNEE 3W9DB 3ZHKA 1TCMA 3RY6A 4EOWL 4Y0GA 4N90E 3RNKA 4FFWD 1NCDH 2HVJA 4NKOA 5F9JA 2GHWB 3BUYB 2XZCH 3QG6B 2X41A 4XRCA 3S9DB 3VXMD 2NY4C 3I9GH 1NAMA 3BGAA 4EN3D 2AJ3B 5JXEA 4R97C 5I1KL 5KVFH 3SE9H 3Q79B 5E94B 5K9JH 4OGYL 5F1NA 3JUZA 2B5IC 5F8QC 4NJAL 3V6OA 5IIEB 3CDFA 3OHXA 1E4XI 2GJ6D 3MRIB 4Y4FD 4LHUD 4O2EB 1IM3B 1BQLL 1BOGB 5IROC 3AY4A 1G9NH 3D0LB 3WFEH 1YEDA 1IQDB 2LQRA 2VR5A 5L2KE 5EOCL 3G6AA 5IVXE 3IETB 5J3HC 3W0WD 3TJHC 5CJ8A 2ED8A 5DXWA 1XIWC 5GS3A 3ULVC 4ZUVA 4E5XB 1O5MB 4MAYA 1MEXL 4G7YL 1KUMA 4N8VB 4K23L 1MJ7L 2JJWA 4V1DE 3JVGA 4ACPA 1QEWB 5I1GL 3IDIB 2RAMA 5B4MD 5T3XD 3P11H 1T89A 1ZGLM 3IT8D 5IHUH 3D25A 1G6RH 4O5LH 1G9ML 3QUZD 4UOJA 6FABH 4FZ8L 2BVOB 3I02B 4FABH 2R23A 5FA4A 3BRGC 2ICWJ 1D5BA 2KQMA 3EDFA 1OTUD 1GGCH 1WBXB 4JFDB 3L5XL 4GFTB 2VZSA 1DVFC 3IJHA 1EH9A 1K9TA 4LAQL 5GGTL 4LGRB 4Q74A 4RMSA 5C3LD 2IADA 1XF3B 3CIQA 3MJ8B 4JY5L 2OTUB 4U6XB 1FFOB 4LSUL 5I8EB 3HAEH 5GRUL 3MJ9H 3DXAD 3ARDD 4M93B 1J8HE 5C0CB 3K4DA 1B4RA 2GT9B 4KJWC 2M1KA 1A6ZA 3MLZL 3GKZA 1MCQA 3VXNB 1MCRA 3RKDC 3RGVC 5C07E 2IMNA 3UYRL 4ZTOH 2BB6A 1CFSA 5KVGL 1AP2B 3KVQA 1H0DA 1PD6A 2F53B 4OZFH 5SWSD 1TJGH 3RWCB 5CJ5A 2HVKB 2WBKA 4N8CL 2JJSC 1WLHA 4S1SL 3PP4L 3OF6D 4WO4C 4IJ3B 4WHYG 1T83A 1QLEH 4YDJB 1FNEB 1NGPL 2JE8A 4UDTB 5BRZD 1TZHB 3FO2B 2BVEA 3S5LB 3T4YA 4U3HA 4NHUA 2FGZA 3N1QC 3OJ2C 1NC2B 4XPTH 3ZMRA 3N85H 4F8QA 5KVEL 5EIIA 4FXKA 3RWDB 2HA1A 1I1AA 2BNRD 4PG2A 4MA3A 4UZGA 1G9EA 1AGEB 3RX5A 4NO5B 3GMPA 4DZ8B 3BGMA 2H26B 3NPZB 3CFCL 2W0FB 4NOFA 5DVLA 3P0YH 2YC1B 3J7HA 2E3VA 4JM2A 3CPLB 4YR6A 2QQQA 4LEOA 5IVNA 4I5BB 3BT2L 2W91A 1N94B 3D5RA 1IT9L 5GQBA 1OARL 1JPSH 2KDGA 1EO8H 3OGCA 3GSNH 3MRCA 2IPKA 3MYJA 5FKAB 2EYTB 4PJGA 5I16A 1CWVA 1N8ZB 1IC4H 5JUEH 3HUJA 3W11D 2ZSVB 3LIZH 3RTQC 1CYGA 1S5HA 4ZD3H 1OAUH 2A6DA 1LE9A 1I7ZB 1NKOA 1OM3L 4PGDA 1UXWB 4Y5VB 4F7EA 1MCSA 1FLTX 2ZUUA 4JCMA 4YZFF 2CR3A 4FA8A 1Z9SA 1YNLH 3BKJL 3CCHB 1ZOXA 4G8GD 4YHMH 3O8XD 2EXYD 4WTXA 3IXAB 1A3LL 3MGTB 4RSVA 4IBLT 1U58B 2P8LB 3U30B 1XR8A 4TUOA 2X42A 2Z91A 2SQCA 2AW2A 3TP4A 1AD9B 4EI6A 1VGKB 4XNYH 5BCAA 1MFAL 4ZAKC 1KCKA 4ZUWB 2DMKA 3ES6A 4YHYC 5DJ8B 4EUPA 3QUXD 2X4OA 1X44A 3P40A 3MXVL 4XNXL 3RJ3A 2P5WB 5HY9A 1JWUA 4APQB 5JHDA 4E0RA 5LWYH 2BOBA 2R4SH 4JHBA 3LEVL 3UBXA 1A0QH 3C2AH 4HUMB 1JPST 3ZKMC 2CLRA 1TJIH 3G6JF 4ZRQA 3UJJH 5F3HB 3JWDL 5MEQA 3MRJB 5F71A 5IQ7L 4M76A 3WUWG 1S5IH 1GGUA 1MCOH 5J56B 4HS6B 1GSMA 2IFFL 5DLMH 2HFGL 2NR6D 3RHWF 1OQXA 3EYSH 4OZHF 1ZAGA 2ZUTA 2BY0A 4NFDA 1KG0A 1UEMA 5GGTA 4LSVH 1UKSA 3G6DL 4IOFC 5EZIH 4YO0A 4HGMA 4G80B 1D9KC 2MNUA 3BQUB 5EU6D 1FO0A 1R24A 1IGIL 5JO5A 4P2QA 5IMOA 3VFTB 2NYYC 5D1XB 1FT1B 4K3GA 4ZMAT 3E6HB 1ORSB 4ZODA 3V8OA 4I3RL 2Q8BH 3AB0B 1BAFH 2CQVA 1RJZB 3CX2A 3VI4F 3MRQA 4B7IA 2B0SL 1UM5H 1XCQB 3HC4H 1VADA 5JA9A 5F3BA 4EUPG 4JFDE 4X4YB 4PTTB 1KENH 2E7BA 3EGSA 5A2JH 1PEZA 2ZOKB 2V5SA 1CLOH 2WUBH 4U1LB 3LH2L 3UBXG 1Y18B 3RVTD 3V79C 4LRNL 1S7XA 2A73A 3JBG7 3MOBL 2VUYA 1S9YA 3QUML 4JDZA 3D5SA 1U8NB 3S97C 1RIUL 3Q6FB 2DJSA 5AUMB 5C0CE 1CDCA 1M4KA 2FJFB 4N1HB 1T66D 3QEUA 2LTQC 4JKPH 1BVKB 1MOEA 5BOPA 1MCPH 4PYGA 2HT3D 5FYKH 3JWOC 4OZGB 3DSTB 3LB6C 4OM0H 2J1KA 3K4ZA 3SE3A 4D94A 1ERNA 1VHPA 2CRYA 1DANT 1I9IL 3SBWC 5HYQB 2J8OA 3KPPA 2F53E 3MNWB 5KTEL 3GSXA 1H8OA 2WBWB 4DCQA 4I13B 3ZYZA 4ZFOL 4LVOC 4FQJH 1M7DA 5C2UB 3KNBA 2A6IB 5GISH 3WEXB 4EVNB 3BP7A 3N06B 2JLLA 3QJFB 1ZHLB 3KPNA 4G43B 1OB1B 3I2CH 1HQRB 4I2XB 2DICA 2N7AA 1QVOA 5I1EL 1KXVC 3G5XB 4MB5A 4HKJB 8CGTA 5LGJA 1I8MA 1AGDB 5DUPH 1DFBL 3O6FD 4OLVH 4ETQB 1N5YH 1YYML 1JGLL 3QZWB 4FG6D 4AMKL 2A74B 3PGCB 1FNGB 3DGGB 2VISB 4U1NA 1QFWI 2GK2A 3QNYA 3RDTA 4OB5H 3FONB 5IHZB 1BGXL 5CGYC 1HI6A 3ZE2F 3FQNB 1RUKL 3SGJA 5JR1L 2BNQD 5DMJB 1QRNB 4ELKA 3AAZB 5HGHA 1U91A 4TVPD 1NGWB 1DLHB 2JTDA 2J5LC 2Y5TA 3LV3A 2MHAB 5ID1B 3MREA 2X1QA 4HJGB 2A77H 1NCWH 1ULVA 3IB4A 5EIVA 2MFNA 4YHPB 4RMVA 4M9PA 2A0LD 1JZ4A 1RZJC 2Z4QB 3PWNA 2VO5A 5ADPH 2X4RB 3VGAC 1SBBA 1S7WA 4MD4A 4M7ZB 4CW1A 1MH5B 2VLJD 4M1CD 5B38A 5AG8A 1HEZB 5I74B 2VOTA 3CFKA 2IPUG 5DC9B 5E4EC 5E03A 1DR9A 3OKEA 2VQUA 3QNXB 5HHOB 5ACZA 2YPLB 1T1WA 3X14B 4RA3A 3SEPA 4DTGH 2APWA 4OKDA 2X4PB 2G5BA 2EIEA 1LMKA 3SKMA 3GHEH 4IIQA 3VMNA 4G42B 5LXGH 3VD7A 4XMKL 3OAYK 3VRLF 4NQTA 3UMTA 1O6HA 2P42B 1OOAA 1H3TA 1X5XA 2NW2B 4YNYB 1BREA 3RX7A 4XHJD 4JRXB 1I1FA 2P5WE 2X4NA 2EH8L 3PABA 3RZCB 1FL6A 3ARVA 4LLDA 3QPXL 1P2CB 3QFJB 1ZHKA 1P4BL 1TETH 4X7TA 3HC3H 3L3GB 4UQ2B 4U6YA 5GGUA 3T0EB 4CJ0A 2HRLA 4Y5XC 3BEWB 5A16B 3EYUL 1ZHBB 3VI3F 2XXCB 3EOBB 2L4OA 3FT2B 5D2NA 3O2WL 3C5SB 4HK3N 3L7EA 2VITA 4PJ9D 5F88A 4ZFFB 1V7MH 3NBNA 32C2B 4NHCL 1DP0A 3MFFB 5B38G 4Z7UA 5JNYA 5AGDA 2GIYA 3PWPD 4Q58C 2NX5B 1U95B 3KG5A 1OSPH 2NXZD 1MWAB 4PLJC 1LO0H 1UH2A 3QUMA 2V5TA 5SWZB 3INUH 4JFFA 1LD9B 4HX1A 3CLEH 4EBQH 3D3VD 4NQEA 4XPBH 1DSFL 4WHDA 4NZTL 4FRWA 1MUJB 3VFVB 3WJJA 2XA8H 2CKNA 2AEPH 2UZIH 4F9LC 4NO3A 5IV2A 2ADGA 5DRWA 1AJ7H 1E4KA 4U1IA 4HWUA 5ENWB 4XBEH 2V8KA 4RQQA 1OAQL 1CTOA 4U1HB 5MENB 4U1JA 3VWJB 4NQXA 3OXRA 1JV5A 4M02A 3ABZA 3MACL 3HI6L 1K8IB 3R06A 3KSLB 1U3ZA 2WP3O 2YOCA 4S1DD 3T65B 2LAAA 4BFBD 2GQHA 5KG9B 1IM9D 2XN9D 3C5ZC 2EIDA 4X80L 1I8KA 1U0QA 1JNNH 3OBAA 3ZKXB 3T3PF 1SHMA 3TBTA 4B50A 4OZGE 3FB6B 3KJ6H 5F89B 1W8NA 5C9KA 1U8MA 2BJML 5MEOB 4PJHA 1H5BB 5HJ3B 1GGYA 2HN7B 1K8DB 1PQZA 5DSCA 4QYOA 4MXQD 5D1ZD 2HKFH 1RURL 3VWKC 3EYQD 4N0CD 3ZO0A 5D93B 1EHLH 3R1GL 4UU9A 4FQCH 2D3VA 1Y0LB 2AJXL 4JR9L 4XP5H 2F5BL 5CJQL 5HDQL 4P57A 2NY1C 4I2XE 5DWUH 3O2DL 5HHNA 4HUUB 2WINB 5HDBF 1JCRB 4X8XA 4DZBB 2R69L 5K9OB 2CJUL 2D7TL 3C9NB 2H8PB 1WUNT 4PRHD 4POYA 4G8FA 4KUCF 3U46A 4I0PD 4UTAL 1JRHL 1U3JA 3GIZH 3V0WL 4UI2A 2ZUSA 1SJEA 3EU5B 1A1OB 5CJBA 5CP3A 5DJZB 4B53A 1AC6A 1N3NB 1QRNE 4D4CA 3UC0H 1RK0A 1T2QH 1JYNA 1T04A 4UQ3B 4WFHE 4WY7L 3EJZC 5DD3H 4F7MA 2EYSA 2FEEL 3DYPA 1F2XK 5J12B 4LHJB 4XNUL 3I84A 4AENA 2EDDA 4KRMB 3LVEA 3QFDB 2IPTL 1DLFH 1JGUH 4MJ5A 2IANA 3IU3B 4L4TB 2ZUWA 3TH3T 2Z35B 3NIGE 1BX2B 1JTTA 1U41A 1R3JA 3DECA 3FZUC 3LHPL 4JQIH 3VD3A 1FO0H 4HLZH 1QBMH 4BZ1H 4BQCA 5GJTL 2Y7QA 3V6BR 5C0EA 4X5XA 2DTML 1LK2A 5HHOE 2DYPB 4XPAL 4RGOH 1WZLA 3KPSD 5HVHC 3QIBB 2X4UB 4Y1AD 4G3YL 5DI8A 4PJIA 1ZXQA 2Z92B 3NCFB 3THML 4OIAA 4TPRH 4NPYB 2KBGA 1TLKA 4I18B 3TCLA 5BS0D 4M6OH 1R76A 1ZANL 3H9SB 4Z7QE 5MHSD 1YYLL 4OT1L 5CLTA 1U3HD 4LSPL 4JRXE 4B7LA 5KSBB 1ZKAA 4U2YA 4XGZA 1N6UA 1VSCA 5J3HD 2MPAH 3DSUB 2DL9A 1IAOB 1JPTL 4F7PB 3HR6A 2XKNA 3QFJE 2V7HA 2DMCA 1UACH 2IH3B 1JF5A 4EXKA 3LS5L 5EU6E 4UIKH 1CU4L 3T0EE 3X12B 4WWKC 5TJWK 2NY2C 4OCRL 4OZIB 4QHUA 1T7YA 4Z7OE 3WD5L 1DVFD 5FYJH 3GO1L 2VLRA 1KJ2B 1FL5A 3MV7D 3QCTL 2BFVH 4XH2A 5DRXA 5DJCA 3IFPB 3GGWB 5DGQA 2NX5E 3SE4C 5C70A 1R0AL 3TGXA 2VXUL 3KLAB 2DWEB 1CZ8H 3EYFB 5F1OB 2VLKD 1F3JA 5SWZE 3IS0X 4P46A 3S37X 3NACL 4FQ1H 3RWFB 1B0RB 4JAMA 5E2TH 1BVZA 1CE6B 4KJWD 5CGTA 3KS0J 4XXDB 3RKDD 3ROOA 5I6XB 4HFUL 1VFUA 3RGVD 5MERA 1FYTA 2ARJQ 2GKIA 2IAMA 3F5WA 4N1EA 4ZQKB 5CEYB 2ENSA 5MENE 5HHVL 3V4PH 4L4VB 2EDWA 5F6IC 4XVJL 3FRUA 1XGPA 4A6YH 4ZUTA 1I9JL 1S7VB 5IMKB 2FIKA 4Y2DB 5IKCA 2I24N 4GKZA 2EO1A 1I4FA 4MWFA 4IDJH 2AS5M 5FHAH 4NC1E 4DWHA 3RZWA 3IDUA 1FSKB 2I9LB 1IZKA 3MV8A 4MZ3A 3V95A 3EYVB 1JGVH 5DK2B 4MCYA 4ZO7A 2FGWL 1IFHH 1LNUB 1C12A 3HCVB 3B5GA 4PB9L 5GS0C 3SOBL 2VDPL 1CK0L 4IRZL 1INQA 2EH7L 4KROC 2VDQH 4KFZC 1UYWL 4P23D 3ZYIA 4NFCA 4L8DA 4KI5E 5I8OL 3WSQH 4IOIA 3T8XA 3LKSB 5D1QC 3CSYA 1B0WA 1JHTA 2HJKB 4BA8A 3ARFB 3UP1A 1UJ3B 4OF7A 4J8RA 4LSTL 4E42B 4ZNEA 1JK8A 1V3LA 3OGOE 4ALAL 4B0MM 3A6CH 3QUKA 3BSZL 4KMTH 4RFEA 1DBML 1DQTA 4TN9A 1YC7A 4C57C 3D69B 1BZ9A 3HE7B 4PRID 5EFIB 3P4MB 1C5DB 3QQ9C 4HWNA 3IGAB 2ICES 4JPWH 4TNWF 4XCNB 1V7NH 2QV2A 3EKCA 3GSWB 2DQJH 1JZ3A 3FRPA 1A6VL 4LSSH 1QLRB 1WJ3A 3LN9A 3EDKA 3PWJA 2HMID 5C3TA 4BM7A 1FE8L 2NY4B 5DRNB 4XNZC 3S37H 4M7LH 5L2KA 3VFRB 3WLWC 2LU7A 5IVXA 5AD0B 2KPNA 3BO8A 2B5IB 4UILH 3GMQA 5ERWB 4TVSa 3QXTA 4L4TE 4LIQH 2X1XR 3E30B 4Z5RA 3VXSD 1NBQA 3PWLB 1BWMA 3ZKMD 5L8KB 1DANU 1KLUB 5KANG 3IFLH 2X7LA 1EZVY 3G9VA 4J3WA 3F7PC 4WV1A 4HDIA 3FQWB 5DMKB 1XIWB 2HJLA 4G6FB 2VLLA 4L3AA 4O51B 1BAFL 3ILPA 5MEPB 4MAUL 4J2XA 2HT2C 2FX7H 2LV4A 4PG9B 3H9SE 1G7LA 4E9LA 3PWUA 1YN7A 5DVMA 1TVDA 3HE6C 2AV7A 3E8UH 3O4OC 3CX5K 2HWZL 5HYFA 4XB7A 5T1DL 5I1AA 5KSBE 3P3YA 1TPXC 2R2EB 2WUBL 2DLGA 1HH9A 4Z7UF 4EIZC 5DHVB 3RWHA 3TN0A 3ULUL 1A6UH 43C9A 3M1BB 1BJ1J 2UY7A 2XZQL 2NYYD 3FRPG 4H8WH 2XFXA 1CT8B 2Y6SC 5DQJA 2X40A 5IFHH 1JWMB 5DDHB 3CVHL 5D2LE 2FB4L 1UB5B 1K5NA 3VXUB 3STLA 4QHNA 4UUJB 1P1ZA 1QR4A 3JV6A 1ZEAL 2X4SB 3VH8B 2VDLL 3DMMA 1KLFA 4JM4L 1W0YT 5E2VH 2X89D 3CMOH 1QBLL 5J57B 1RFDL 5BV7L 1A6TB 2P8PB 1P9MC 3WFZA 3MRMB 5HHPB 3PV7A 2NW3B 3WYRA 2V2XA 3N1PC 4Z0BH 4RGMC 4WO4B 3LEYL 5HGDB 1KIPA 5DUPL 4LFHD 2OL3B 3BIBX 2UWEB 1RPQA 5JA8B 1LO3H 3SFXB 3D6GA 1VERA 3P9LB 4ISVA 3TA3C 3LB6D 3RWGB 3U1SL 1AO7A 2BCKA 2WM0A 4ZUUA 2OS7A 5F44A 1H3PL 2A83A 3C8HA 4PJHF 4JDTL 3E37B 4QRRD 2F15A 4PB0L 2QADD 3EBAA 2CXGA 3DSNA 4L4VE 5HYIA 1P5UA 2OLDA 1J1XH 5F1SA 1QSFB 2IALB 3UBXI 12E8H 3MLSH 1T5XB 4QRSB 5CBEA 2YKLL 3O3DB 4Z95L 5LVEA 4QF1B 4MNQD 3ARGC 4FXLA 3PHQB 4D0BA 2VDOL 1T7ZA 3FN0H 1GZQB 4PLKC 4UB0H 4QXUL 3E2HB 3W39B 4QHLB 4KTDH 5ILTH 3B8SA 5KS9B 3QA3A 4JPIA 4Y16A 5D9SA 4G9FB 5CGYD 3RTQB 4YFEA 4PRIB 1O6QA 3U9UA 3T2NH 1CD8A 2D31A 4CN6A 2W59A 4RZCA 4OCWH 1FZKB 2CGRH 1OQOA 1H9VA 1HDMA 5LXGL 2AJZB 1XGYH 1ZLWK 3SKJH 1X7QB 3W9DA 2P5EB