1AA7A

Influenza virus matrix protein crystal structure at ph 4.0
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
158
Chain Sequence
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional membrane-RNA binding protein, influenza virus matrix protein M1.
pubmed doi rcsb
molecule tags Matrix protein
molecule keywords INFLUENZA VIRUS MATRIX PROTEIN
total genus 57
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1aa7A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 1aa7A01
4D9JA 4ITVA 4IQ4A 5CQEA 3MD2A 4PUSA 1AA7A 1EA3A 2Z16A 3VDXA
chains in the Genus database with same CATH superfamily
3K1MA 2KDZA 3VB2A 4DYRA 1JKRC 1TBXA 3KZIC 3H1CA 1PDNC 1EH8A 4FT8A 3V8LA 3JR9A 4QWQA 4BEHA 5EJCA 3HRTA 5HS7A 5LBQA 2ZMEA 4HG2A 2CW0F 3ESWB 3KE2A 4FQGA 1JE8A 3HOXJ 2FF4A 4QLCU 2G7UA 1Y0NA 2ISYA 2WAQN 5LHGA 1RUOA 2Y0SN 3BPXA 3T8RA 3DP7A 4AYBN 1VTNC 1AWCA 2KJCA 1K6OA 2HQAA 2R7RA 2A5WA 2BXZA 1YJ9I 2FBKA 3I55I 2LP0A 2K9QA 1OMIA 4C3HJ 1RIOH 2JRTA 5H6RA 1QVUA 4PUSA 5J4YA 2RVCA 4OU0A 2LKPA 5E3OA 3OYFA 4MQ9F 5J4VA 1IXCA 2KMUA 1D1AA 3SFIA 5E3LA 5CJ9A 2KKOA 1R1UA 1SD6A 2XF7A 2YUSA 3ZQCA 1U9NA 1QZZA 1XDSA 2QBYB 4E7ZA 5JFRA 2IA2A 2ISZA 4NC6A 1MNEA 1Y1VJ 1WJDA 3IAS2 2R7XA 2BZTA 2V9KA 1E3HA 4B1RA 4XSZF 4I76A 2ESNA 1BM9A 1Z05A 3KP6A 1BJZA 2CQ7A 2Q2EB 5FROA 4BDZA 3P5JA 2R93J 2HXIA 3TGNA 1BOBA 2UWMA 1I50J 3HOWJ 3GMEA 1HF0A 4A6DA 1E3PA 3TOBA 3RPQA 3WU0A 4H4KC 4XLEA 2MH2A 4RBOA 3SZGA 4D1QA 1HCRA 2VN2A 2IA1A 3TP3A 3ERMA 2ZFUA 2O0YA 3U9GA 2A6EF 2VPRA 1ETKA 3F8CA 2CQXA 5CKTA 4HF0A 3CF5F 3DLLF 3WGGA 1KYWA 3DU5A 3JSOA 3F23A 3ZMDA 2DFIA 5BNGA 2ETHA 1YW8A 4A3JJ 3FXLA 2L01A 2F5CA 5CVIA 4IHTA 3ELKA 5EGOB 3FXUA 4J00A 2Z3YA 1SANA 5D5UB 2VC1A 1V5FA 1ZH5A 2K9MA 2HZDA 3RZOJ 1UFMA 3IC7A 3BR5A 3DBRB 2NNYA 3HSFA 4A3CJ 1X1DA 1ZTRA 2BV6A 1O4XA 5E3MA 4BJ6C 1ERDA 3W2WA 1P4XA 2XGEA 3TKYA 2BHYA 5H20A 1TTYA 2E2HJ 3ZQFA 4J01A 4EMSA 1MNDA 2UZKA 1W1WE 5D6FA 1K79A 3AL0B 4JX4A 3ZQGA 1OCZH 4QIWN 5DS9A 4AD9A 4NBQA 2BY3A 3S1QJ 3IUOA 3FISA 2K3FA 3KP4A 4RM3A 5HODA 1HDDC 3BR2A 4C9YA 1QPMA 3BDDA 5D8LB 1F43A 2HR3A 3G1LA 4ESBA 1LDKB 5CYVA 3LSHA 1BI2A 2RC4A 2F48A 4GFBA 2PG4A 5DCFA 1X4PA 1GV5A 3I9V2 2QKMB 4IEJA 3PO2J 1IXRC 1FLIA 3ML6A 4MFEA 3PUBA 2Q8KA 1J59A 1A5JA 4IX7A 3OR2C 1SMYF 3QU3A 2LRDA 1DGWY 2A73B 4C3JJ 3F72A 4KIGA 5JI6A 4U88A 3SFZA 3ZMTA 3BG7A 3V8JA 5DCMA 3I56I 5DUKA 1H8AC 1K4TA 3CP2A 3G3ZA 2D2WA 4LG0B 1G4DA 3RCOA 1U6GA 1HLVA 1FP2A 3KYDB 5M3MJ 2JVHA 2FQ3A 1ZHFA 3DQVC 2ESHA 5BMZA 5HDGA 4I0AA 1TZLA 2KRHA 3JSPA 3P9CA 3ZXSA 1QQIA 2LY9A 3SHFA 2EK5A 3MEXA 3JRAA 4UB6C 5JPNB 3S93A 3LSPA 4DNCA 2ECCA 2OF7A 4BDYA 2FBIA 2CUJA 4BL0B 2NOGA 1WVRA 2HDCA 2V6CA 4M9ZA 4EM0B 1FEXA 3BPVA 2EZKA 1K7AA 3DBHB 2GQQA 4YFNF 4FXGB 2P8TA 3L7WA 1GVJA 2HTSA 2JJ7A 3HOUJ 2JA2A 3KX2A 4NUBA 1ACIA 1ZRFA 3W2VA 4UV9A 3H92A 1T0FA 3EUHA 2CRGA 3CU7A 4NQWB 2XF5A 2ZMEC 1MBKA 5HDKA 4IZZA 1T8IA 2CQKA 3Q0UA 1DP3A 2G0EA 4KN4X 1BR4A 4UHTA 4A3MJ 1QA6A 2VQHA 2R7UA 4HNTA 1FOXA 4OOIA 4CCOA 2LR8A 1ZQ3P 5J47A 4MTDA 3LAPA 1APLC 3EUAA 3WTSC 1CF7A 1VNDA 4YFXF 2PEXA 4AVPA 3RI4A 2R7WA 1G3WA 3RPUD 3VPRA 2EZHA 2LMDA 4ZYEA 1TQPA 3KP3A 2GA2A 3PM1A 4ZH4F 3OYBA 3M3YJ 3ZGKA 3HUGB 3QQAA 2R5ZA 1S5LC 1YS7A 2FUG2 4A5MA 4CYCB 5FLXZ 2X6XA 4B43A 1XG1A 2DMNA 3FK7A 2IS2A 3LNQA 3PUFA 4DW6A 3SDGA 2QQAA 3LSTA 5HOOA 1T08B 2FX0A 3K69A 4UXNA 2EINH 2AXTC 2FBHA 2R0QC 1ETQA 1CQTA 3E5UA 3KYCB 1GT0C 1XSXA 1R36A 1ZREA 1LFUP 1T56A 1WFXA 2FOKA 4EATA 2YSRA 3L2UA 2P6TA 3R4KA 2CQNA 2ZXWH 4JOMA 3H9QA 4CHUA 1BI1A 2OZUA 3LA3A 2GXBA 4DIQA 3F8NA 5TISC 2BY0A 1W7PD 4FHTA 3HJEA 1A04A 1ETYA 2LF7A 2DMPA 1SD4A 3Q3SA 4IRHA 3QPTA 4M6VA 1HKSA 2XAQA 1FZPB 2FJ1A 4JX6A 2X1CA 4A12A 5IT9K 3CO6C 1MNMC 2XUBA 1UMQA 4ESFA 1DPUA 4MLOA 2M7BA 1POGA 1MBGA 1LJ9A 2BE5F 2NS0A 2UXXA 3I53A 1OYIA 3ZCOA 4A69C 2M5WA 2OUMA 3C18A 3CMAI 3OYLA 2IGMA 3BWGA 1QHHD 1ULYA 4XLPF 5FO5A 4GYGA 2P5LC 4U0YA 2PJPA 1WZ2A 1K4SA 3N4MA 5D6EA 2I10A 2CW8A 5CLSA 1DQUA 1R1VA 3WU1B 4BE2A 2HNHA 3VSLA 2HOTA 2AHQA 5HS9A 4P39A 1K61A 2XSJC 1HOMA 2Y75A 1SAXA 2YU3A 3OSGA 2J5OA 4XLNF 3L2WA 1LQ1A 5KCMA 2MW8A 2YS9A 2IPQX 1ENHA 2MG4A 2KZGA 1IN7A 1MGTA 4RAFA 2OQRA 2QQ9A 4C3IJ 3FZVA 1D8KA 3IKVA 5A2QZ 5B3SH 2IS1A 5CVVA 2R7OA 3I0TA 3QYEA 4AIJA 1Z1DA 2L2OA 2QSFX 1OCRH 1XCVA 4AUXA 1ZLKA 4XLFA 1T2KA 2XC7A 3QPSA 2FQ4A 2V4JC 2AQFA 1YIOA 4NQWA 1SMTA 2GXGA 2IGKA 1UB9A 2JN6A 5KHDA 5LGTA 1I1GA 3GTGJ 1TP4A 4RMNA 4XKBA 1IC8A 1PUFA 3F8BA 2JA7J 3J7YJ 2VC0A 3PFYA 5CVUA 1N78A 3D5LA 4Y33A 3ZQHA 3MQ0A 4YIRX 5KVRA 3BT9A 3ZPLA 2D5VA 1FTZA 3BZKA 2XASA 2X6WA 2TCTA 1U8RA 2CGPA 4EJVA 3HUGA 1FPQA 5M5WJ 3JRBA 1MD0A 3REOA 1C5AA 3TW7A 4LFUA 4PK4A 5GPCA 4IOCF 2DQLA 3A01A 2W48A 3WE3A 1B9NA 1XD7A 1YLFA 3HEFA 4A6EA 3X2QH 3H3ZA 4AIDA 3COAC 5M3FJ 2BY1A 2CU7A 2W82A 5E79C 3OYJA 4EGZA 2BHZA 3MWMA 1B72A 3S17J 1YTYA 2MFZA 1WQ2A 1KQ8A 2JSPA 3EYYA 4WWCA 1Z3YA 2FEZA 1I3QJ 3SDBA 1LPQA 4BJ5C 2V26A 4PJMA 1TC3C 2DK5A 5AIPA 2L4AA 1HKTA 1T6SA 3GTOJ 3QYBA 2V1UA 2W1OA 2HZTA 1YQAA 4X1EA 5KAIC 1WJEA 5E8GA 5DTDA 4BACA 3DCFA 4R1HA 2QF7A 3OMYA 1W7PA 2Z5UA 1ORKA 3BY6A 3HSRA 4XICA 3HZJA 1P4WA 2XAHA 2IA0A 3GFLA 2W25A 5K7ZA 3HXLA 5FKKA 2K40A 2Y0MA 2RQQA 5BPIA 3M1EA 4BE0A 3GLXA 4N4OB 2YX4A 4CGZA 3S1RJ 3E0JB 5LHHA 1T38A 4AM3A 5C44J 1MMAA 4R79A 5GAGJ 5M5YJ 2Z33A 2JT1A 4DJAA 2DOAA 3GTMJ 1MJBA 4RM2A 3JRIA 3ABMH 3U2RA 3TQNA 4XQFA 1KQ9A 4BHBA 1ZAOA 3G1OA 4ITVA 1XMAA 4B09A 2O03A 3E3VA 4FE7A 3WG7H 1QBJA 3S1MJ 3TW6A 3FBIB 1GXQA 1ZGAA 4MGRA 2STWA 4PJLA 1I27A 4IVNA 2WY8Q 3K4BA 4XLAA 5HDNA 3FDYA 2EH3A 3RQIA 4M3DA 4XRFA 5FGMA 5GTIC 5IP7J 5IT3A 2L02A 1D0XA 4RGUA 2QLZA 4WXDA 5AIQA 3IRRA 2VODA 1REPC 3DBLB 3HHGA 5HLIA 1R00A 3ONQA 2COMA 5DD8A 1DPRA 3I59B 4G7ZF 1BL0A 1SD5A 1LFBA 2X4HA 3DKYA 4L9VA 4MNUA 3M4OJ 2JA6J 5EF6A 4AVZA 2LLKA 4BYYA 4BNCA 3RQ4A 2EV5A 2HPMA 4CO8A 3CCQI 3S16J 2L7ZA 1JJ6C 4D5CA 4EJWA 3HQAA 1PUFB 5B66C 3TDZC 3I3LA 3C2GA 4CDGA 2MH9A 1SVOA 3DPUA 3NWSA 3T1BA 2W24A 5JHUA 1JKPC 2STTA 1HSTA 1IDYA 4RAGA 1NHAA 2DJIA 4IRGA 4IO9F 1R7JA 4B8XA 2E1NA 2H6CA 2OCEA 2QKLB 1VQNI 3CC2I 1IZ1A 4XRSA 1LB2A 3CJRB 5ILSA 4I6OA 1FJLA 4E7SA 4NNJA 4BH9A 1WJ5A 3BJ6A 4U7DA 1I39A 2M34A 3ECOA 1BR1A 5ED4A 3FXJA 3SZPA 1XC5A 2M0MA 1ZK8A 2ZNYA 4RAZA 2MD0A 3BCBA 4XK4A 4M6YA 4D5FA 1ZR4A 1IUFA 1TWCJ 2HS5A 2IVMA 4G8XA 1I3AA 1B4AA 3B73A 3IWZA 2F5EA 3BG9A 3LSJA 3VOEA 4YIFA 4ZZLA 3U1DA 4RB3C 1IF1A 1SVLA 4HRIA 2QYOA 2H1LA 4ZZDA 3LSKA 1DUXC 4KT5C 4A0ZA 3LSRA 2KPMA 3HGGA 2ELHA 2CUFA 4UU9C 2DDAA 1ON2A 5GP9A 4FE4A 2LY1A 4C2UA 1X2MA 2V79A 4A0YA 4K2EA 3M8EA 3BOQA 3BTIA 3D5RC 1T98A 2KIQA 2P7VB 2DOEA 1R4MB 2WB1A 1ZYRF 2DPUA 2LKSA 4EJUA 2DFEA 4YG2F 1UZCA 1TQIA 3HDDA 5J6XA 1AU7A 5B4PB 4C2MJ 1O7LA 3A0HC 4S04A 1IJWC 4OIOF 3K9TA 3B02A 4OAYA 3LAJA 2X6OA 2E7XA 3DKXA 3LQRA 5HVQC 4UUSA 1I1SA 5KNLA 4PFOA 1S7AA 3GLLA 3HGYA 5HS8A 1O3SA 3WGIA 1EH7A 2WADA 3G6EI 4ASNA 1KU7A 2DLLA 4Y4RA 2HXOA 1MBFA 4KIBA 2L54A 4MEYF 3S14J 4M3EA 3PIOF 2CH0A 3J7AY 2FNPA 5L3FA 3JRFA 2ZO4A 2GM4A 4HLXA 1B8IB 3I5UA 2PJRB 3NEUA 2HYGD 3S3MA 2RN7A 3ZQQA 4RGXA 3OR1C 5ICGA 1FOKA 4UVBA 4E70A 1JXSA 2E1OA 4XLHA 3G73A 3IWFA 4LITA 1FYKA 4XKVA 5FLVA 4EM1A 3OIOA 1H88C 3HOYJ 3BLYA 3BR3A 3K4MA 4HA8A 2DN0A 3BJAA 1X3UA 2HEOA 2IJLA 4HSRA 2ZBKA 1U5TB 1IGNA 1WCMJ 3ZR8X 2HKXA 3LSMA 2K3PA 2MLGA 2YU9J 1JGSA 3K1PA 1P92A 4UUTA 1D8JA 2M0CA 2QM3A 3MAJA 1VQ8I 3SQNA 4Y7NJ 2X6YA 3I71A 2LREA 2XPVA 2ZJRF 1Z0XA 3OWTA 2A07F 2V1NA 1L3LA 5IOZA 3H0GJ 1B6AA 4IHYA 3D1NI 3K4NA 3LWFA 1F9NA 1XGSA 2R5YA 1DU0A 4EGYA 4BE1A 3CUQA 2EJRA 3M8JA 1O3RA 5GAHJ 3JRDA 1JHHA 1JUPA 2KDOA 2XAUA 3BG6A 3OOPA 3SZTA 4BEHB 4F91B 3F21A 3ZMUA 3H36A 3FX3A 4ENKA 3GX4X 3ABTA 4A3EJ 2M3AA 4U0VA 3HG9A 1BN5A 3VYTB 3H5NA 1GUUA 2LOOA 3KYLA 1IO2A 4MEXF 4BQQA 2JA5J 3FXMA 4OIPF 3A01B 2EILH 5E18F 2KZVA 4RB0A 4XRMA 4LK1F 4EJTA 4BQNA 2XSDC 4HBLA 4GGGA 2LFBA 1D5YA 4JK1X 3OS2A 5D4RA 3K70C 5EG0B 3R0AA 2Y48A 4BAYA 2EB7A 1U9OA 2OCCH 4A3IJ 4D7NA 3HIFA 3C3WA 3HM5A 3G1MA 5FKLA 3MKYB 3LFUA 9ANTA 3ZMSA 3GFJA 2HQNA 1JHFA 1ZRDA 2MBFA 1V55H 3O8HA 3CDIA 1FIPA 3DPLC 1MMNA 1K6YA 1TT0A 5FLXK 1KGSA 2E1CA 1MMDA 4I7HA 2EFNA 5DM6F 4ZTJA 1K78A 3HL2A 2VKVA 1ZGJA 5BS6A 1RPWA 4W97A 5LRSA 4RB1A 3H9JA 3TP0A 2L9SA 4IHWA 1W7PB 1IN4A 4UUVA 2A5YB 1ETOA 2P7CB 3UKGA 4UUSB 4KUMA 3QP5A 3OY9A 4HV6A 5EEGA 2A6HF 3Q9SA 5JLWA 1JKQC 2OA4A 2HVSA 1KONA 4LIUA 3L00A 4BKXA 3CMYA 1BA5A 2DU9A 1QRYA 2DA6A 1VQ5I 4OIQF 4WB2A 5LGUA 3CDHA 2KT0A 3D0SA 1FOWA 2KHMA 3FHNA 4PJJA 3S3NA 2PJRA 3NRVA 2H09A 5IYBJ 2DMTA 4EQQA 4GDFA 2XPWA 2Q0OA 3KPHA 1Y1WJ 3OL4A 2MSYA 4I02A 2OZ6A 3WU2C 2V9PA 1X1CA 2LH9A 2W84A 5J3LA 3BTLA 1BI0A 5CQEA 2ID6A 3GWZA 4LLGF 3RSNA 3PO3J 3OS1A 3GZ6A 3G71I 4DQ2A 3F6VA 2E2JJ 3K4KA 3F22A 1C0WA 4EV0A 3P7NA 1A31A 2EZLA 4I0BA 1B1BA 2GWRA 3QWLA 3IV5A 5K7FA 4WB3A 4IKFA 2NVYJ 3HKZA 3H3UA 2V1XA 4GCVA 3QOPA 2DAOA 1FNNA 2HDDA 2R7ZJ 1ETXA 1RC9A 4HNVA 1ON1A 4PGHA 1HKQA 1P4AA 4KMUX 4I09A 2JPBA 4I98B 4P55A 1YW9A 1AA7A 2JVGA 1OFCX 2UUZA 1OCCH 2CV2A 2K86A 4HX4A 2GZWA 2XHKA 2VQCA 3I54A 4DZJA 1FBQA 4A3DJ 4NHJA 3F8FA 3EETA 4Z2YA 1MJ9A 1PP7U 1RI7A 4KT6A 3E97A 3OIPA 1X1AA 3BROA 3DKWA 4L18B 4HSTA 1YJNI 1FYLA 1NK3P 4XORA 5DCMB 2HQRA 1KU2A 2OBPA 2FA5A 4EEFG 2WAFA 4QPQA 2VJ5A 1WWXA 3CF2A 4BJTA 2DPDA 2LF8A 1UJ8A 4F3QA 2PBIA 3JTHA 4BY7J 1ZGWA 1WJFA 1SAUA 4FISA 1PJRA 2MA3A 2P81A 5C4JJ 1KA8A 3DFGA 2VBWA 2KQRA 4U7BA 4E7LA 3S32A 4ANJA 5LEJA 4M3GA 1XSVA 2CYYA 3O3KA 5J40A 3Q0WA 2JTVA 1VI0A 4P3BA 3FXQA 3QOEA 4M3BA 3SXYA 3ZN0A 4Z6YA 3HTSB 3GYHX 1W5SA 4CZCA 1K78B 1A36A 3MFKA 3K10A 1TLHB 1TW2A 3ABKH 3H9GA 3EUKL 3MVPA 2CG4A 3HSEA 3BC8A 2W4SA 3VYRB 4HQEA 3K2AA 3HTUA 1T33A 3AKZA 3DLAA 3FM3A 2FOWA 3MZ8A 1OJLA 2NVTJ 4P9UA 5K5QA 2EQRA 1JT6A 2DA3A 3ISPA 1MJAA 3FKIJ 4KJZA 5HLGA 1QU3A 3IKTA 4LK0F 2JMWA 2OTJI 3GUDA 2LDUA 5F6FA 1XSDA 1QPIA 3AFHA 1R49A 1GV2A 4KFCA 3E6BA 2Z2SB 2M4KA 5ICFA 1E2XA 1VQLI 2K4BA 3V4GA 3RTRA 2DI3A 2WC2A 3KLNA 1IW7F 4AYBA 3ROUA 4HYEA 1U5TC 1IV8A 2E35A 4II3A 4CYDA 1Z91A 3UNGC 1X2NA 2O9LA 4LG3A 3MKLA 4IHVA 3F8MA 1RUNA 5E1WA 3GZNB 3BG3A 3M7GA 1H89C 1G3YA 4JP0A 1I5ZA 1ZARA 3GCMA 4KN7X 3L1PA 2MABA 2X51A 3VFZA 2XGCA 2V1DA 2F2EA 3MZHA 5BOXA 3LSIA 1YHQI 4BXFA 2KIFA 4E6KG 3LQQA 5K5OA 1EH6A 3E1SA 4B44A 3RJPA 3A03A 3O8GA 2HVQA 1WJAA 1SC7A 2B7EA 4ZTFA 1RETA 1UHWA 1HBXG 4HF2A 3O2PE 3PIPF 2PMUA 5B5EC 3GTQJ 4CICA 1G59A 4U87A 3UR3C 4FTHA 2QCOA 1J2XA 2A61A 4Y52J 4PJ0C 3GO5A 4A3BJ 2EWNA 3JAMZ 1EF4A 1KU9A 3LOCA 1YE9A 4O6JA 4JYKA 4RGRA 5IT9Z 4HNUA 5CQGA 2GLOA 2VKHA 2XIGA 2O7OA 1NTCA 1BBYA 3W6KB 2R7TA 3SYTA 5F1RA 5EDNA 3ASOH 1RKTA 1H9GA 5F08A 2XGDA 3A2KA 2DA1A 4M71A 4FX4A 1HA8A 1TNTA 3ABUA 2CQQA 2JUGA 5FD6A 4UB8C 4X6AJ 1FP1D 2NVUB 1UCRA 3CCEI 1YRNB 3EYIA 1GXPA 3BTCA 2L3DA 4CUGA 2RKHA 2PLYA 4LG0A 3T8TA 4ZC3A 1ODDA 2VE8A 2X85A 5EG0A 1U0JA 2DODA 1V5EA 4HDUA 2L0KA 3EQLF 3SJMA 3CJQB 2KFDA 3CLOA 3DTKA 3BR6A 1BIBA 1R5GA 2EIJH 4HOBA 4CA0A 1MZBA 4O5VA 1FIAA 1W4MA 5LHIA 1Z6TA 2L9NA 1YIJI 1MW7A 5D5WB 1MSEC 5ERIA 3I64A 1FSEA 4DBQA 4L9TA 3CUOA 4ZDOA 1ZN2A 1ETVA 2LVSA 4G94A 4QPOA 2K85A 3ECHA 1UHSA 3OYAA 3OYNA 5C4XJ 3U1KA 3G2BA 1XB4A 1F4KA 1J9IA 4PSXA 3CESA 3DPTA 5BQTA 2M45A 2B39A 3LA2A 1VQ4I 4BY1J 5J1RA 4ABZA 2LSOA 3VYUB 3S2HJ 3CLQA 2DW4A 5FLMJ 2E2IJ 3M1CA 1Y0UA 4N9HA 3PNYA 1VQMI 3VYSB 2KLOA 2VLAA 1X1BA 3JCUC 2H6BA 4IXAA 4PGGA 2QEXI 1SEUA 2XKOA 1X3ZB 1IG7A 1S3JA 2F5FA 3RKWA 1QHGA 2BOLA 2KRCA 3PNVA 1XPXA 3IAM2 1Z7UA 4BS9A 2VJJA 2IEKA 4LLNA 4MHGA 3GFMA 4UVAA 1XMKA 4MTEA 1Z3XA 1YYVA 2ME0A 4M9XA 1IRZA 2HDWA 2O61A 1RKWA 2VBXA 1VQOI 1Z9CA 5E17F 2P4WA 4A3GJ 5LGNA 2VT2A 4Q5SF 3P9IA 1ZELA 4CCMA 2R3SA 4DYCA 2NVQJ 4D9JA 4GO1A 3K4JA 2GOMA 1O57A 3ZN1A 5E8IA 1YX3A 4XIDA 4QTRA 4F92B 2NYXA 2R92J 1RESA 2QA4I 5HLTA 2EPFA 1MBHA 2JSCA 3SEQA 2L9RA 4EM2A 1MDMA 1LVAA 4AIKA 2EV6A 3OV8A 3QPHA 4GRIA 2DMQA 4IHSA 3E7LA 1ZLJA 1ZR2A 3QYFA 2RNGA 2G7HA 2RV8A 1BC8C 1LDDA 3BZ6A 2COBA 1W5TA 1B59A 1IN8A 1USSA 4AU7A 1SFEA 3OYHA 3MN2A 3V42A 3MCZA 2GIZA 4OAZA 5L3GA 3QP6A 3C2HA 3CDLA 2ZMEB 4XKCA 3VSKA 3RDIA 3L2VA 1A6IA 3AL0C 2I8DA 3A1YA 2F5VA 1RRJA 3CC4I 2EZIA 4L5EA 1LEAA 1UHMA 2IGOA 3RPUA 2UV1A 1YRNA 4H0EA 1ZG1A 1CFAA 1JJ8C 1S9HA 5F27A 4G7OF 1J5YA 2BY2A 4BHCA 1TL8A 1YOVB 3FMSA 5EZHA 2VQLA 2PMZN 1FTTA 3ZQLA 4HW5A 5FRMA 3J7AO 3A0BC 4Q4ZF 4D0PA 1YS6A 2DDBA 3OL3A 2ACJA 4F93B 3IHUA 3EDPA 4YRVA 4J19A 2DQRA 3K7AJ 2FU4A 3GTPJ 2E7WA 3F6OA 2WA0A 2NOJB 2CW7A 1GLNA 3CCVI 4M3FA 2RQPA 1FX7A 2IT0A 4XONA 5K7HA 1YJWI 2E34A 2DFHA 2X1DA 2B9SA 4BQAA 3JRHA 2YR2A 2MYSA 2P5VA 2VKDA 4IQ4A 2J5PA 5DV5A 3TDUC 1BI3A 5L3CA 3FWEA 3I4MJ 5K5RA 3M07A 3HPHA 2IAIA 1XGNA 2CS3A 4ZYAA 1ZG5A 1P9QC 4IRIA 1USTA 1H0MA 2R4GA 2VXZA 3JRCA 3S2DJ 2YX7A 4L0YB 4DZPA 3B6CA 4P96A 2DJNA 3DV8A 5LFAA 1FMWA 2JPCA 4KICA 4Q48A 3WHBA 2VBZA 3BTJA 4M9SA 3JTGA 2TRTA 4O3MA 2GA1A 1O3QA 3OYCA 3J81K 3PQJA 4TV7A 4GYIA 2AQEA 1SFUA 4RLFA 2L7FP 3DXJF 4B48A 5GAEJ 4JQFA 2OPTA 2M4GA 3LA7A 4AC0A 3CCUI 3CJNA 4MQVA 1TWHJ 2XROA 2IW5A 1KQ0A 1TW3A 1Y56A 4II2A 5LD2C 3OYDA 3S8PA 3KLOA 2DBBA 3CMMA 3E5QA 4XR6A 1KZHA 3TOAA 4BBRJ 3FBNB 3OYEA 3JW4A 1MMSA 4LOCA 3Q0VA 2Y69H 4WXCA 4XRSG 1F1ZA 5L3DA 2EFOA 2AXLA 1WSUA 1FWZA 1X58A 2E19A 2HOEA 3GTLJ 5E1ZB 3GTJJ 4C30A 1Q1VA 2O8XA 1DU6A 2CMPA 1E3OC 3WE2A 2GAUA 3I4PA 3FXKA 2HQ5A 4UV8A 3WTUC 3NQOA 2DOFA 4BHPA 4B3XA 2WTEA 3Q9VA 3EPZA 5FKNA 2W7NA 2FNAA 1KJSA 2W57A 1WH5A 2A6TA 2MGQA 3CQZJ 1Z7LA 1YG2A 1XDUA 1Z21A 2JA8J 1A6QA 1TT5B 4V2GA 2ME6A 1W0TA 2RAEA 2ZB9A 2BEOA 3PQKA 3TBIA 4G6QA 5D5XB 3H5AA 3A4CA 3CCRI 3H5RA 2ZKZA 4MIMA 2K7LA 2DMUA 3OYMA 4NC7A 1AKHB 2Y2ZA 4G7HF 5EEHA 1E17A 4YFKF 4LB6B 1BW6A 2VBYA 2TDXA 2VQGA 2DA5A 2OAZA 2WB1N 2E1MC 4Y17A 3FM5A 1EJ9A 2OV7A 3DEUA 3HC7A 5LRRA 2W85A 5D5VB 5L3BA 3OYKA 3RZDJ 4CZZA 1YO5C 1QNTA 4JX5A 1PVEA 4BUPA 1OYYA 2QGUA 3L9FA 1TWFJ 1FMVA 1XMXA 3C2BA 5CVJA 3WODF 3S2WA 2ZSIB 2E71A 4IL6C 3PL8A 1S8NA 5JHFA 3KCCA 2BYVE 1SVMA 4BQOA 5FD5A 4Y3OA 2LKXA 5FFZA 1DDNA 5DM7F 3J81Z 1FY7A 3R6SA 2M9HA 5HLHA 3VODA 4WCGA 2VUMJ 2DA4A 2IGNA 1XN7A 3QPLA 1VQ6I 1Z77A 4IPAA 2VT3A 1P7IA 3BG5A 2R7VA 3K1NA 4LMYA 2O3FA 2XPUA 4HWJA 1IXSB 4S0HB 2Q2EA 3WTTC 2GBYA 3DF8A 3PFIA 1T0FC 2R7QA 1O7FA 1JUMA 1RZ4A 2Z99A 3FF5A 2XB5A 2E5NA 3BR1A 2DTRA 3N97A 1LKXA 2HGCA 5D8KB 3T5XA 1MH4A 3KIOA 1Y8RB 1R4NB 4U0WA 3H35A 4XSXF 2E36A 2LC2A 5A2QK 2AO9A 1VFCA 4FX0A 5F04A 3ZMZA 1CF7B 4ZYHA 4KMFA 2N8GA 4BU2A 1N77A 2XF6A 3CUQB 2LK2A 3FXRA 4RA2A 3J7ZI 1DP7P 2VIXA 1LFPA 3HPGA 3VWBA 2PFBA 2F6CA 3T0YA 5GADJ 1IUYA 2VJIA 3MMYB 4HEA2 1JKOC 4XKWA 1LNWA 2ZXIA 3A02A 3E6CC 5DYMA 5M5XJ 3ZOBA 2F4IA 2PMHA 4L9JA 5ILVA 3F3XA 3AG2H 1QZEA 2KL4A 1U3EM 6PAXA 2R7FA 2VXDA 2NS7A 2WY7Q 4P3AA 1MH3A 4EJOA 2XAGA 5IOYA 3TO7A 3ABLH 4FCYA 2GOXB 3K70D 1RR7A 1U78A 2ZXJA 2IS4A 3HBLA 1IRXA 1VQPI 2ECBA 2DTZA 2KRFA 3CMEI 1VQ9I 3HQBA 4Y15A 5IYCJ 2QZ8A 2KJBA 2H27A 3GBGA 2L5QA 2QWWA 2HYJA 2BXYA 4UNOA 1ONVA 2FXAA 4IOAF 1U8BA 1W5CC 2HOAA 1WJCA 4A93J 5JVTA 3RKXA 4RAYA 2M30A 1AHDP 5FB2A 4R8HA 2GXAA 2OTLI 4HW0A 1DGRM 1EKEA 4F7ZA 4WK8F 3ZMVA 1XX5A 4E4HA 3BQZA 3HRSA 4XN0A 3HRUA 4XL9A 4OMYA 1OLTA 4PCQA 4C2TA 2LD5A 2WV1A 1UAAA 1MSFC 3I4NJ 4OINF 1F36A 3ZRGA 4G12A 5LEKA 1AKHA 2CSOA 4I6ZA 2KIUA 3QU6A 2RNJA 1MMGA 3F9KA 2WBMA 2JUCA 2M1BA 3V7CA 3BJOA 2ZJQF 1R71A 1NK2P 3M8FA 1XS9A 2CFOA 1PYVA 2A3SA 3CD6I 5FFXA 3ZP5A 3TL4X 2H8RA 1X1PA 4F55A 2F4OB 3CJTB 4GXOA 3WTZA 2ZJ2A 4FXKB 3QODA 3KEOA 2D1VA 5JPMB 1OCPA 5IPAA 3PSFA 5KK1A 4RGSA 1E0EA 3CUQC 3DEWA 5DUIA 2MC4A 5DEQA 3FMRA 5E3NA 1S29A 2MC3A 3DWLE 3AG3H 4PFPA 1FBSA 3V7RA 1VQ7I 4A3KJ 2VKEA 2VPLA 4KITB 3OS0A 1WPKA 5JLXA 5FKMA 1U5TA 4KIFA 1VF9A 1GDTA 3K4LA 3OIQA 1D1CA 2IBDA 4FASD 3CO7C 1MBEA 1WGXA 3K0LA 4XBFA 2HVRA 2BVLA 1U2WA 2JWTA 2WV0A 2XAFA 3CTAA 3KP5A 1XGOA 2DYSH 4RDUA 2BVMA 2KP6A 1OCTC 2ZC2A 5F0CA 5J1UA 1X19A 5IP6A 3TEDA 2CJJA 4MO7A 1LDJA 2M87A 5IP9J 4PSWA 2M2EA 1JI8A 2DA7A 2PX9A 3WHCA 1P7JA 5JVGF 1G8XA 1D5VA 2QUFA 2L4MA 1D1BA 2Z16A 3WTVC 1BW5A 1XGMA 2P5KA 3MD2A 1OR7C 3GEZA 2R5ZB 3BP8A 2HWVA 1N25A 1O3TA 2YPRA 4CYCA 1R1TA 2ELJA 5L3EA 5J8CA 2EFQA 2XKPA 5B1AH 3R61A 5IYDJ 2LBFA 1X4OA 1PUEE 2ICWG 1D0YA 3JAMK 1IAWA 2VOPA 3AAFA 3LFKA 4KA4A 1VQKI 1B72B 1S6LA 2VI6A 1WRJA 2FMYA 1V54H 4HF1A 3GZ5A 1FSHA 1EV7A 2KIMA 2R7SA 2JQ7A 2CUEA 1QZYA 1OPCA 1V5GA 4AIHA 3CP8A 2M8EA 1IRGA 1YFHA 2MD5A 2HI3A 1R23A 3LL7A 1BOAA 1UG0A 4N9IA 2Y9ZA 4A5NA 3OOUA 5B1BH 4EVIA 1S7EA 2EA4A 4HX7A 2GIVA 2EIMH 4LIVA 2AS5F 4E7HA 4N4NB 3GTKJ 5ICEA 5HNFA 1M1EB 2BBYA 4A3FJ 1HW5A 2FE3A 4LJZF 2VASA 1J75A 3NARA 3NWTA 4RB2C 1XCBA 2P6SA 2DCEA 4CXFA 4DOZA 2Y31A 3IRQA 2XV4S 3W6VA 1R22A 4Q47A 1KU3A 4W1UA 5HNHA 2PMZA 1LVKA 1HQCA 5ILUA 1BC7C 2K9LA 2NNNA 1W36C 2XAJA 2CWEA 2JK3A 2E5ZA 1L0OC 2BGCA 3BQYA 1UG2A 4ENNA 2KISA 2Z9OA 4BGDA 2O8KA 4KNYA 2E60A 4PJNA 2D1HA 3IP4B 4PZJA 3RYPA 1HXDA 4KDPA 4M72A 3ZQ7A 2V7FA 3DEEA 3KETA 2FSWA 1EA3A 4HDVA 1Y6IA 4DYQA 1F5TA 2A68F 3IH2A 2EFPA 4V2FA 2DT7B 3TO6A 3WTYC 2X0LA 3KP7A 3EUHC 1MBJA 4V19K 1FOYA 4QSHA 2EV0A 2QSGX 3HOZJ 2VB6A 5FKOA 2A69F 3I59A 2Y9YA 4ZYDA 2XRNA 4IJAA 4NDLA 1JUSA 3L09A 3KLSA 4DBRA 4YIIA 1IV6A 3CCYA 1HW1A 3L2RA 2W00A 3PSIA 3R0JA 1Q1HA 2PN6A 3QAHA 1FC3A 4HPQA 2V6EA 5EEAA 1NH3A 1MKMA 3WTWC 1V3FA 4B3AA 2QQ8A 5BPDA 1LE8A 4NC8A 2IRFG 2CUZA 2OD5A 4HAMA 5K1YA 1SFOJ 2WAEA 3RKQA 4UVCA 4BXUA 1R9TJ 3HYIA 4A2UA 1V4RA 2HYFA 4E7JA 2NXNB 2OJED 4XLCA 3J80Z 5CVRA 3ULQB 4LGWA 4WF2A 1JTXA 1R58A 4HV5A 1X3WB 5CPRB 2OQGA 2LBFB 3CC7I 2ZSHB 4OIRF 1FYMA 2L7MP 1NG6A 4IQJA 1LUJB 3GF2A 4OWRB 3DU6A 4G9YA 2D45A 2K9SA 4ZYGA 1S7OA 2OC6A 1SFXA 4G6DA 4RS8A 2V9VA 2VOOA 2RREA 2VJ4A 2PI0A 1S72I 1TWAJ 3N05A 3HOTA 3OYGA 3V8KA 3E6DA 2ZNZA 3KFWX 1K83J 2JZYA 4P9FA 4ENMA 2M8GX 1RNLA 4X0GA 4LD5A 3HOVJ 1N75A 1YW7A 2ELKA 2LG4A 1G2HA 5FJ8J 3F0CA 3FIWA 2NS8A 2IP2A 3HB9A 4CCKA 1ZRCA 2NAZA 4Y13A 1QVTA 3NAUA 3K2ZA 2DT5A 3K6GA 5J1YA 1R6RA 3HHHA 2O6GE 5E1XA 1D3YA 2G9WA 4ZDPA 2H94A 4CCLA 5ICCA 1QO0D 1NG7A 1XTAA 4I01A 3GFIA 5FRNA 2CFXA 1OQYA 1FT9A 3CCMI 3P9KA 5F0FA 2XB0X 1T39A 5LLQA 3CCLI 2FD5A 2ZJPF 5F0HA 3JRGA 3MKWB 4RLQA 2MLKA 4S05A 3BR0A 2DA2A 3DTEA 3Q5FA 4L9NA 3HKZN 3FKJA 3AG1H 4FETA 4P1WA 2IXSA 3B6AA 4ENJA 3KEQA 2OU2A 3D5SC 1YX5A 1P6RA 1WHUA 2DO7A 4L5IA 2E1MB 2X9DA 1J0RA 4HZFA 1B8IA 2QQBA 3M9AA 2EFWA 1J7KA 3SEZA 5EGOA 1T95A 3C1DA 4M6XA 2LNBA 2FMLA 3E5XA 3FMQA 4KYWA 3OYIA 1OISA 1J09A 1ZG3A 2F5DA 1HDPA 3WTXC 4NB5A 3K4CA 4CCJA 5IY5H 2I5UA 2B0LA 1JGGA 5H6QA 4XNFA 1Y8QB 4PDKA 1SD7A 1GHCA 3S1NJ 2QENA 3IH3A 2C6YA 1G3TA 4BXXJ 1Y39A 3IH4A 2P0WA 4HLYA 3H0DA 5GTHC 1B9MA 2EA2A 2LYCA 3VEPA 4IHXA 5J8FA 2L7KA 1STZA 4ESJA 5DDGA 1MDMB 2DT6A 2NRAC 3CCJI 2RDPA 2ADUA 3MZYA 2ZCWA 2HKOA 2NVXJ 1I6HJ 3AG4H 4E7KA 4G6TB 2VL8A 1JTYA 2Q1ZB 1BR2A 5TJJA 5TGTA 3MKZA 3G4SI 4OMZA 3HRMA 1D0ZA 3U21A 1LE8B 2BW3A 2K9NA 1I6XA 2M7AA 2K27A 3KP2A 2H1KA 5DD4A 1CGPA 1KYZA 1HC8A 4XOTA 2LY2A 5AONA 1R5ID 3DTIA 2UXNA 1IN6A 2ZXHA 1TWGJ 1Z6RA 3J80K 2QVOA 2HOSA 3S3OA 3GXOA 3KZZA 3KZYA 2HFHA 4XM3A 2Y0SA 1R5HA 2XDVA 4HQMA 4CCNA 1IDZA 4HX8A 2HPIA 4LB5A 3C7JA 4XMYA 2DFFA 5EZGA 3V7SA 1OCOH 3L2QA 1OYWA 3VDXA 2LTPA 2EBIA 2Z1DA 4A0XA 1YITI 3JREA 2DK8A 1A35A 1Z67A 3CZ6A 3LSGA 4YELA 1WKMA 1FBUA 3RKYA 3ZQIA 5TRDA 3ERED 1AOYA 4D7MA 3GW2A 3LMMA 5EYRA 4XOPA 5H2FC 1SFKA 1TNSA 2CO5A 4N0BA 2QBYA 1UELB 3HOSA 1WH7A 3R60A 2DXIA 3L2CA 1GVDA 4IF4A 3WG9A 2H8WA 2RGVA 2IS6A 2F4MB 1ETWA 2K4JA 4JBAA 4B47A 4KISA 2XRLA 3FHZA 3GVAA 4I2OA 2FRHA 3CCSI 1PP8F 2CV1A 4YEJA 4I99C 2Y30A 4WX9A 4A3LJ 1VZ0A 4CH7A 5JR3A 3W6JB 3WGHA 1IRFA 4ETSA 4LLLA 2K5CA 1HW2A 1YI2I 3W3CA 2EIKH 3O6BB 3S15J 3FXOA 3PJRA 4WXHA 2CV0A 4BBSJ 1BJAA 2K02A 4F52A 2WWYA 4UY8I 4ON0A 5GPAA 1ITYA 2WAQA 1G3SA 1W36D 4ZJZA 4P5OA 1WI3A 1OKRA 1H9TA 4ZDLA 3FK6A 3RIRA 1RR8C 4XN3A 2L9VA 1TQMA 3BZCA 4AWXB 4E7IA 4M73A 2HU9A 3QRFF 2A05A 3E6MA 4DGWB 1OR7A 1WJBA 3TMOA 4M74A 5F64A 3W2AA 1HSJA 5KAFC 3H3VK 1W0UA 2VONA 1LEBA 3BCAA 5E20A 2ID3A 4MFDA 1JT0A 2VE9A 1ZKGA 2X48A 3I58A 2HTJA 4CSWA 2XVCA 2O5RA 1G6NA 3PNTA 3RYRA 4L0ZB 2PQ8A 1BIAA 2R7DA 1MIJA 1WI9A 2B63J 2ZFWA 2X1EA 3TO9A 1P2FA 1IN5A 5D4SA 3OSFA 2JRMA 2XGXA 4L5JA 3IL2A 4B4CA 2QSHX 1QGPA 2DYRH 3ASNH 5F1JA 5C3EJ 3KEYA 2BW3B 2R5YB
chains in the Genus database with same CATH topology
2MC4A 2WY8Q 3K4BA 4XLAA 1YE9A 3FDYA 3DWLE 4PFPA 4HNUA 4BEHA 5CQGA 4HG2A 1D0XA 2VPLA 2VKHA 4KITB 3OS0A 2R7TA 3SYTA 3K4LA 3OIQA 1D1CA 3A2KA 4FASD 1HA8A 3ONQA 2HVRA 2JUGA 2BVLA 2HQAA 2R7RA 2A5WA 3DKYA 2BVMA 2KP6A 4CUGA 4AVZA 1X19A 3RQ4A 4PUSA 4ZC3A 2X85A 2HPMA 1U0JA 3OYFA 1V5EA 2KMUA 1D1AA 3CJQB 3DTKA 4PSWA 3I3LA 1JI8A 3C2GA 4CA0A 3DPUA 3NWSA 2XF7A 2DJIA 1G8XA 2L9NA 1MW7A 1D1BA 2Z16A 4E7ZA 2QKLB 4DBQA 4ZDOA 3CJRB 3MD2A 1OR7C 1MNEA 4QPOA 1WJDA 4E7SA 4NNJA 3IAS2 2R7XA 1WJ5A 2V9KA 3OYAA 3OYNA 1BR1A 2ELJA 3G2BA 2M0MA 4PSXA 3CESA 3DPTA 2MD0A 2Q2EB 3BCBA 5FROA 4BDZA 2LBFA 1X4OA 1BOBA 1D0YA 2UWMA 3VYUB 4H4KC 4XLEA 3M1CA 4HRIA 3SZGA 4D1QA 3PNYA 3LSKA 2KLOA 3VYSB 1X1BA 2VLAA 2ZFUA 2KPMA 2R7SA 5CKTA 1QHGA 2BOLA 2KRCA 1V5GA 3PNVA 3DU5A 2LY1A 3IAM2 3CP8A 4C2UA 4BS9A 2VJJA 3D5RC 3LL7A 1UG0A 2WB1A 1Z3XA 3OOUA 4J00A 2HDWA 4LIVA 4E7HA 1V5FA 4N4NB 2K9MA 2HZDA 5HNFA 1ZELA 4CCMA 4OAYA 4D9JA 3DKXA 5HVQC 3K4JA 2GOMA 1X1DA 2VASA 1YX3A 4PFOA 3NWTA 5KNLA 4BJ6C 1ERDA 4F92B 2DCEA 3W2WA 4DOZA 4J01A 5HLTA 1MNDA 2WADA 3SEQA 3AL0B 4Y4RA 5HNHA 2PMZA 1LVKA 4GRIA 2K9LA 2CH0A 3J7AY 1W36C 3IUOA 2E5ZA 2PJRB 3QYFA 2RNGA 4RM3A 4C9YA 4BGDA 3S3MA 3UR3C 3ZQQA 2E60A 3OR1C 4PJNA 3IP4B 1LDKB 2V7FA 3DEEA 4AU7A 3LSHA 3OYHA 4XLHA 1EA3A 1Y6IA 4LITA 4XKVA 3V42A 3BLYA 3K4MA 1X4PA 2DT7B 4OAZA 3C2HA 3I9V2 2QKMB 4XKCA 3VSKA 3EUHC 4HSRA 3PUBA 3L2VA 4IX7A 3OR2C 3AL0C 2VB6A 2I8DA 3ZR8X 2LRDA 2F5VA 1DGWY 3A1YA 3LSMA 2K3PA 2IGOA 3BG7A 2UV1A 2X6YA 2LREA 4DBRA 1S9HA 3CP2A 3OWTA 3RCOA 2V1NA 2VQLA 3L2RA 2W00A 3PSIA 5FRMA 4HPQA 2V6EA 2JVHA 3K4NA 3DQVC 3OL3A 1TZLA 2KRHA 4F93B 4YRVA 4BE1A 3ZXSA 3M8JA 4NC8A 2CUZA 2NOJB 2WA0A 2CW7A 3S93A 1GLNA 2WAEA 2KDOA 2XAUA 3BG6A 4XONA 4BEHB 4BDYA 4F91B 2CUJA 2X1DA 4BL0B 4E7JA 4XLCA 2MYSA 2M3AA 3HG9A 2VKDA 4IQ4A 3H5NA 3VYTB 2LOOA 3KYLA 4BQQA 3HPHA 4FXGB 5CPRB 2CS3A 4ZYAA 2LBFB 2KZVA 1P9QC 2ZSHB 2JA2A 3KX2A 4NUBA 4BQNA 1NG6A 3W2VA 4IQJA 2R4GA 2VXZA 4OWRB 3DU6A 3OS2A 2OC6A 4NQWB 2XF5A 3K70C 5LFAA 1FMWA 4IZZA 2RREA 2VJ4A 1DP3A 2R7UA 1BR4A 2VQHA 3N05A 4HNTA 3OYGA 3HOTA 3OYCA 4CCOA 3MKYB 2AQEA 3LFUA 4RLFA 3EUAA 4X0GA 4B48A 4JQFA 2M4GA 2R7WA 3RPUD 1N75A 3DPLC 2LG4A 3OYBA 1MMNA 1K6YA 1TT0A 3ZGKA 4CCKA 3HUGB 1Y56A 4II2A 1MMDA 5LD2C 3OYDA 3S8PA 4ZTJA 2FUG2 3CMMA 4XR6A 3HL2A 3K6GA 1R6RA 3FBNB 2X6XA 4CCLA 4ZDPA 4B43A 3OYEA 3H9JA 2IS2A 2L9SA 1NG7A 5FRNA 5HOOA 4C30A 2CMPA 3OY9A 3MKWB 4RLQA 1WFXA 2HVSA 3DTEA 4EATA 1KONA 4LIUA 3L2UA 3FKJA 4JOMA 4FETA 4P1WA 2IXSA 3H9QA 4B3XA 3EPZA 3D5SC 1YX5A 4DIQA 2E1MB 2W7NA 2KHMA 3FHNA 4PJJA 2PJRA 3S3NA 2A6TA 1Z7LA 3SEZA 1Z21A 3OL4A 1T95A 1X1CA 2LH9A 3OYIA 1J09A 3TBIA 5CQEA 3H5AA 4CCJA 3K4CA 3A4CA 3RSNA 4XNFA 3H5RA 3OS1A 2X1CA 3OYMA 4NC7A 3K4KA 4MLOA 2M7BA 2P0WA 3H0DA 2LYCA 3ZCOA 2OUMA 2VQGA 2L7KA 3OYLA 2IGMA 2E1MC 1QHHD 2OV7A 2DT6A 3HC7A 3OYKA 4IKFA 4BUPA 3HKZA 1FMVA 2CW8A 1DQUA 4E7KA 4G6TB 2ZSIB 4BE2A 2HNHA 2VL8A 3VSLA 2Q1ZB 1BR2A 5TGTA 3MKZA 3PL8A 1D0ZA 2XSJC 5JHFA 3U21A 2JVGA 1AA7A 2BW3A 2UUZA 2CV2A 2M7AA 4BQOA 4Y3OA 2VQCA 3L2WA 4XOTA 2LY2A 5KCMA 3DTIA 2IGNA 2ZXHA 2R7VA 3S3OA 4KT6A 3OIPA 1X1AA 4XM3A 2Y0SA 2IS1A 2XDVA 2R7OA 3QYEA 4HSTA 2L2OA 4CCNA 4XORA 2HPIA 1T0FC 4XMYA 4XLFA 2R7QA 2XC7A 2WAFA 2V4JC 2VJ5A 4QPQA 2E5NA 3CF2A 4BJTA 2AQFA 3L2QA 4F3QA 3VDXA 1LKXA 2Z1DA 2IGKA 5KHDA 1WJFA 1SAUA 3CZ6A 1PJRA 3LSGA 3H35A 4RMNA 4XKBA 4YELA 2LC2A 2KQRA 3PFYA 1N78A 4U7BA 3D5LA 4Y33A 4BU2A 1N77A 2XF6A 3S32A 4ANJA 4E7LA 3LMMA 2VIXA 1LFPA 3HPGA 4XOPA 3VWBA 2F6CA 1SFKA 2VJIA 2X6WA 3MMYB 4HEA2 4XKWA 2ZXIA 3QOEA 1UELB 2F4IA 4CZCA 3HOSA 3K10A 2DXIA 4PK4A 2KL4A 3H9GA 3EUKL 2VXDA 3BC8A 2W4SA 3VYRB 3AKZA 2WY7Q 3DLAA 2IS6A 4B47A 4KISA 2W82A 2GOXB 3K70D 4KJZA 1QU3A 3OYJA 2IS4A 2CV1A 1IRXA 4YEJA 2MFZA 1VZ0A 4CH7A 2JSPA 2K5CA 3AFHA 1Z3YA 3W3CA 3GBGA 2L5QA 2Z2SB 3SDBA 2M4KA 4BJ5C 2V26A 2CV0A 3PJRA 4F52A 4PJMA 3RTRA 1WJCA 2WAQA 1W36D 4ZJZA 3QYBA 4P5OA 2W1OA 4ZDLA 4AYBA 4XN3A 4II3A 4E7IA 1DGRM 1WJEA 2HU9A 4DGWB 4BACA 4E4HA 1WJBA 4XN0A 3TMOA 3UNGC 4LG3A 4XL9A 1OLTA 3W2AA 3OMYA 4C2TA 1UAAA 3ZRGA 3BCAA 3HXLA 2RQQA 1MMGA 4BE0A 4N4OB 2MABA 2X51A 3F9KA 3E0JB 4CSWA 2O5RA 1MMAA 2WBMA 3LSIA 4R79A 4BXFA 3PNTA 4E6KG 4DJAA 2DOAA 2X1EA 3E1SA 4RM2A 4B44A 2CFOA 1PYVA 2HVQA 1WJAA 4XQFA 4ZTFA 3TL4X 4F55A 4ITVA 3QODA 5JPMB 3FBIB 4PJLA 1G59A 3PSFA 3KEYA 4U87A 1E0EA 2BW3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D9J A;  4ITV A;  4IQ4 A;  5CQE A;  3MD2 A;  4PUS A;  1AA7 A;  1EA3 A;  2Z16 A;  3VDX A; 
#chains in the Genus database with same CATH topology
 3K1M A;  2KDZ A;  3VB2 A;  4DYR A;  1JKR C;  1TBX A;  3KZI C;  3H1C A;  1PDN C;  1EH8 A;  4FT8 A;  3V8L A;  3JR9 A;  4QWQ A;  4BEH A;  5EJC A;  3HRT A;  5HS7 A;  5LBQ A;  2ZME A;  4HG2 A;  2CW0 F;  3ESW B;  3KE2 A;  4FQG A;  1JE8 A;  3HOX J;  2FF4 A;  4QLC U;  2G7U A;  1Y0N A;  2ISY A;  2WAQ N;  5LHG A;  1RUO A;  2Y0S N;  3BPX A;  3T8R A;  3DP7 A;  4AYB N;  1VTN C;  1AWC A;  2KJC A;  1K6O A;  2HQA A;  2R7R A;  2A5W A;  2BXZ A;  1YJ9 I;  2FBK A;  3I55 I;  2LP0 A;  2K9Q A;  1OMI A;  4C3H J;  1RIO H;  2JRT A;  5H6R A;  1QVU A;  4PUS A;  5J4Y A;  2RVC A;  4OU0 A;  2LKP A;  5E3O A;  3OYF A;  4MQ9 F;  5J4V A;  1IXC A;  2KMU A;  1D1A A;  3SFI A;  5E3L A;  5CJ9 A;  2KKO A;  1R1U A;  1SD6 A;  2XF7 A;  2YUS A;  3ZQC A;  1U9N A;  1QZZ A;  1XDS A;  2QBY B;  4E7Z A;  5JFR A;  2IA2 A;  2ISZ A;  4NC6 A;  1MNE A;  1Y1V J;  1WJD A;  3IAS 2;  2R7X A;  2BZT A;  2V9K A;  1E3H A;  4B1R A;  4XSZ F;  4I76 A;  2ESN A;  1BM9 A;  1Z05 A;  3KP6 A;  1BJZ A;  2CQ7 A;  2Q2E B;  5FRO A;  4BDZ A;  3P5J A;  2R93 J;  2HXI A;  3TGN A;  1BOB A;  2UWM A;  1I50 J;  3HOW J;  3GME A;  1HF0 A;  4A6D A;  1E3P A;  3TOB A;  3RPQ A;  3WU0 A;  4H4K C;  4XLE A;  2MH2 A;  4RBO A;  3SZG A;  4D1Q A;  1HCR A;  2VN2 A;  2IA1 A;  3TP3 A;  3ERM A;  2ZFU A;  2O0Y A;  3U9G A;  2A6E F;  2VPR A;  1ETK A;  3F8C A;  2CQX A;  5CKT A;  4HF0 A;  3CF5 F;  3DLL F;  3WGG A;  1KYW A;  3DU5 A;  3JSO A;  3F23 A;  3ZMD A;  2DFI A;  5BNG A;  2ETH A;  1YW8 A;  4A3J J;  3FXL A;  2L01 A;  2F5C A;  5CVI A;  4IHT A;  3ELK A;  5EGO B;  3FXU A;  4J00 A;  2Z3Y A;  1SAN A;  5D5U B;  2VC1 A;  1V5F A;  1ZH5 A;  2K9M A;  2HZD A;  3RZO J;  1UFM A;  3IC7 A;  3BR5 A;  3DBR B;  2NNY A;  3HSF A;  4A3C J;  1X1D A;  1ZTR A;  2BV6 A;  1O4X A;  5E3M A;  4BJ6 C;  1ERD A;  3W2W A;  1P4X A;  2XGE A;  3TKY A;  2BHY A;  5H20 A;  1TTY A;  2E2H J;  3ZQF A;  4J01 A;  4EMS A;  1MND A;  2UZK A;  1W1W E;  5D6F A;  1K79 A;  3AL0 B;  4JX4 A;  3ZQG A;  1OCZ H;  4QIW N;  5DS9 A;  4AD9 A;  4NBQ A;  2BY3 A;  3S1Q J;  3IUO A;  3FIS A;  2K3F A;  3KP4 A;  4RM3 A;  5HOD A;  1HDD C;  3BR2 A;  4C9Y A;  1QPM A;  3BDD A;  5D8L B;  1F43 A;  2HR3 A;  3G1L A;  4ESB A;  1LDK B;  5CYV A;  3LSH A;  1BI2 A;  2RC4 A;  2F48 A;  4GFB A;  2PG4 A;  5DCF A;  1X4P A;  1GV5 A;  3I9V 2;  2QKM B;  4IEJ A;  3PO2 J;  1IXR C;  1FLI A;  3ML6 A;  4MFE A;  3PUB A;  2Q8K A;  1J59 A;  1A5J A;  4IX7 A;  3OR2 C;  1SMY F;  3QU3 A;  2LRD A;  1DGW Y;  2A73 B;  4C3J J;  3F72 A;  4KIG A;  5JI6 A;  4U88 A;  3SFZ A;  3ZMT A;  3BG7 A;  3V8J A;  5DCM A;  3I56 I;  5DUK A;  1H8A C;  1K4T A;  3CP2 A;  3G3Z A;  2D2W A;  4LG0 B;  1G4D A;  3RCO A;  1U6G A;  1HLV A;  1FP2 A;  3KYD B;  5M3M J;  2JVH A;  2FQ3 A;  1ZHF A;  3DQV C;  2ESH A;  5BMZ A;  5HDG A;  4I0A A;  1TZL A;  2KRH A;  3JSP A;  3P9C A;  3ZXS A;  1QQI A;  2LY9 A;  3SHF A;  2EK5 A;  3MEX A;  3JRA A;  4UB6 C;  5JPN B;  3S93 A;  3LSP A;  4DNC A;  2ECC A;  2OF7 A;  4BDY A;  2FBI A;  2CUJ A;  4BL0 B;  2NOG A;  1WVR A;  2HDC A;  2V6C A;  4M9Z A;  4EM0 B;  1FEX A;  3BPV A;  2EZK A;  1K7A A;  3DBH B;  2GQQ A;  4YFN F;  4FXG B;  2P8T A;  3L7W A;  1GVJ A;  2HTS A;  2JJ7 A;  3HOU J;  2JA2 A;  3KX2 A;  4NUB A;  1ACI A;  1ZRF A;  3W2V A;  4UV9 A;  3H92 A;  1T0F A;  3EUH A;  2CRG A;  3CU7 A;  4NQW B;  2XF5 A;  2ZME C;  1MBK A;  5HDK A;  4IZZ A;  1T8I A;  2CQK A;  3Q0U A;  1DP3 A;  2G0E A;  4KN4 X;  1BR4 A;  4UHT A;  4A3M J;  1QA6 A;  2VQH A;  2R7U A;  4HNT A;  1FOX A;  4OOI A;  4CCO A;  2LR8 A;  1ZQ3 P;  5J47 A;  4MTD A;  3LAP A;  1APL C;  3EUA A;  3WTS C;  1CF7 A;  1VND A;  4YFX F;  2PEX A;  4AVP A;  3RI4 A;  2R7W A;  1G3W A;  3RPU D;  3VPR A;  2EZH A;  2LMD A;  4ZYE A;  1TQP A;  3KP3 A;  2GA2 A;  3PM1 A;  4ZH4 F;  3OYB A;  3M3Y J;  3ZGK A;  3HUG B;  3QQA A;  2R5Z A;  1S5L C;  1YS7 A;  2FUG 2;  4A5M A;  4CYC B;  5FLX Z;  2X6X A;  4B43 A;  1XG1 A;  2DMN A;  3FK7 A;  2IS2 A;  3LNQ A;  3PUF A;  4DW6 A;  3SDG A;  2QQA A;  3LST A;  5HOO A;  1T08 B;  2FX0 A;  3K69 A;  4UXN A;  2EIN H;  2AXT C;  2FBH A;  2R0Q C;  1ETQ A;  1CQT A;  3E5U A;  3KYC B;  1GT0 C;  1XSX A;  1R36 A;  1ZRE A;  1LFU P;  1T56 A;  1WFX A;  2FOK A;  4EAT A;  2YSR A;  3L2U A;  2P6T A;  3R4K A;  2CQN A;  2ZXW H;  4JOM A;  3H9Q A;  4CHU A;  1BI1 A;  2OZU A;  3LA3 A;  2GXB A;  4DIQ A;  3F8N A;  5TIS C;  2BY0 A;  1W7P D;  4FHT A;  3HJE A;  1A04 A;  1ETY A;  2LF7 A;  2DMP A;  1SD4 A;  3Q3S A;  4IRH A;  3QPT A;  4M6V A;  1HKS A;  2XAQ A;  1FZP B;  2FJ1 A;  4JX6 A;  2X1C A;  4A12 A;  5IT9 K;  3CO6 C;  1MNM C;  2XUB A;  1UMQ A;  4ESF A;  1DPU A;  4MLO A;  2M7B A;  1POG A;  1MBG A;  1LJ9 A;  2BE5 F;  2NS0 A;  2UXX A;  3I53 A;  1OYI A;  3ZCO A;  4A69 C;  2M5W A;  2OUM A;  3C18 A;  3CMA I;  3OYL A;  2IGM A;  3BWG A;  1QHH D;  1ULY A;  4XLP F;  5FO5 A;  4GYG A;  2P5L C;  4U0Y A;  2PJP A;  1WZ2 A;  1K4S A;  3N4M A;  5D6E A;  2I10 A;  2CW8 A;  5CLS A;  1DQU A;  1R1V A;  3WU1 B;  4BE2 A;  2HNH A;  3VSL A;  2HOT A;  2AHQ A;  5HS9 A;  4P39 A;  1K61 A;  2XSJ C;  1HOM A;  2Y75 A;  1SAX A;  2YU3 A;  3OSG A;  2J5O A;  4XLN F;  3L2W A;  1LQ1 A;  5KCM A;  2MW8 A;  2YS9 A;  2IPQ X;  1ENH A;  2MG4 A;  2KZG A;  1IN7 A;  1MGT A;  4RAF A;  2OQR A;  2QQ9 A;  4C3I J;  3FZV A;  1D8K A;  3IKV A;  5A2Q Z;  5B3S H;  2IS1 A;  5CVV A;  2R7O A;  3I0T A;  3QYE A;  4AIJ A;  1Z1D A;  2L2O A;  2QSF X;  1OCR H;  1XCV A;  4AUX A;  1ZLK A;  4XLF A;  1T2K A;  2XC7 A;  3QPS A;  2FQ4 A;  2V4J C;  2AQF A;  1YIO A;  4NQW A;  1SMT A;  2GXG A;  2IGK A;  1UB9 A;  2JN6 A;  5KHD A;  5LGT A;  1I1G A;  3GTG J;  1TP4 A;  4RMN A;  4XKB A;  1IC8 A;  1PUF A;  3F8B A;  2JA7 J;  3J7Y J;  2VC0 A;  3PFY A;  5CVU A;  1N78 A;  3D5L A;  4Y33 A;  3ZQH A;  3MQ0 A;  4YIR X;  5KVR A;  3BT9 A;  3ZPL A;  2D5V A;  1FTZ A;  3BZK A;  2XAS A;  2X6W A;  2TCT A;  1U8R A;  2CGP A;  4EJV A;  3HUG A;  1FPQ A;  5M5W J;  3JRB A;  1MD0 A;  3REO A;  1C5A A;  3TW7 A;  4LFU A;  4PK4 A;  5GPC A;  4IOC F;  2DQL A;  3A01 A;  2W48 A;  3WE3 A;  1B9N A;  1XD7 A;  1YLF A;  3HEF A;  4A6E A;  3X2Q H;  3H3Z A;  4AID A;  3COA C;  5M3F J;  2BY1 A;  2CU7 A;  2W82 A;  5E79 C;  3OYJ A;  4EGZ A;  2BHZ A;  3MWM A;  1B72 A;  3S17 J;  1YTY A;  2MFZ A;  1WQ2 A;  1KQ8 A;  2JSP A;  3EYY A;  4WWC A;  1Z3Y A;  2FEZ A;  1I3Q J;  3SDB A;  1LPQ A;  4BJ5 C;  2V26 A;  4PJM A;  1TC3 C;  2DK5 A;  5AIP A;  2L4A A;  1HKT A;  1T6S A;  3GTO J;  3QYB A;  2V1U A;  2W1O A;  2HZT A;  1YQA A;  4X1E A;  5KAI C;  1WJE A;  5E8G A;  5DTD A;  4BAC A;  3DCF A;  4R1H A;  2QF7 A;  3OMY A;  1W7P A;  2Z5U A;  1ORK A;  3BY6 A;  3HSR A;  4XIC A;  3HZJ A;  1P4W A;  2XAH A;  2IA0 A;  3GFL A;  2W25 A;  5K7Z A;  3HXL A;  5FKK A;  2K40 A;  2Y0M A;  2RQQ A;  5BPI A;  3M1E A;  4BE0 A;  3GLX A;  4N4O B;  2YX4 A;  4CGZ A;  3S1R J;  3E0J B;  5LHH A;  1T38 A;  4AM3 A;  5C44 J;  1MMA A;  4R79 A;  5GAG J;  5M5Y J;  2Z33 A;  2JT1 A;  4DJA A;  2DOA A;  3GTM J;  1MJB A;  4RM2 A;  3JRI A;  3ABM H;  3U2R A;  3TQN A;  4XQF A;  1KQ9 A;  4BHB A;  1ZAO A;  3G1O A;  4ITV A;  1XMA A;  4B09 A;  2O03 A;  3E3V A;  4FE7 A;  3WG7 H;  1QBJ A;  3S1M J;  3TW6 A;  3FBI B;  1GXQ A;  1ZGA A;  4MGR A;  2STW A;  4PJL A;  1I27 A;  4IVN A;  2WY8 Q;  3K4B A;  4XLA A;  5HDN A;  3FDY A;  2EH3 A;  3RQI A;  4M3D A;  4XRF A;  5FGM A;  5GTI C;  5IP7 J;  5IT3 A;  2L02 A;  1D0X A;  4RGU A;  2QLZ A;  4WXD A;  5AIQ A;  3IRR A;  2VOD A;  1REP C;  3DBL B;  3HHG A;  5HLI A;  1R00 A;  3ONQ A;  2COM A;  5DD8 A;  1DPR A;  3I59 B;  4G7Z F;  1BL0 A;  1SD5 A;  1LFB A;  2X4H A;  3DKY A;  4L9V A;  4MNU A;  3M4O J;  2JA6 J;  5EF6 A;  4AVZ A;  2LLK A;  4BYY A;  4BNC A;  3RQ4 A;  2EV5 A;  2HPM A;  4CO8 A;  3CCQ I;  3S16 J;  2L7Z A;  1JJ6 C;  4D5C A;  4EJW A;  3HQA A;  1PUF B;  5B66 C;  3TDZ C;  3I3L A;  3C2G A;  4CDG A;  2MH9 A;  1SVO A;  3DPU A;  3NWS A;  3T1B A;  2W24 A;  5JHU A;  1JKP C;  2STT A;  1HST A;  1IDY A;  4RAG A;  1NHA A;  2DJI A;  4IRG A;  4IO9 F;  1R7J A;  4B8X A;  2E1N A;  2H6C A;  2OCE A;  2QKL B;  1VQN I;  3CC2 I;  1IZ1 A;  4XRS A;  1LB2 A;  3CJR B;  5ILS A;  4I6O A;  1FJL A;  4E7S A;  4NNJ A;  4BH9 A;  1WJ5 A;  3BJ6 A;  4U7D A;  1I39 A;  2M34 A;  3ECO A;  1BR1 A;  5ED4 A;  3FXJ A;  3SZP A;  1XC5 A;  2M0M A;  1ZK8 A;  2ZNY A;  4RAZ A;  2MD0 A;  3BCB A;  4XK4 A;  4M6Y A;  4D5F A;  1ZR4 A;  1IUF A;  1TWC J;  2HS5 A;  2IVM A;  4G8X A;  1I3A A;  1B4A A;  3B73 A;  3IWZ A;  2F5E A;  3BG9 A;  3LSJ A;  3VOE A;  4YIF A;  4ZZL A;  3U1D A;  4RB3 C;  1IF1 A;  1SVL A;  4HRI A;  2QYO A;  2H1L A;  4ZZD A;  3LSK A;  1DUX C;  4KT5 C;  4A0Z A;  3LSR A;  2KPM A;  3HGG A;  2ELH A;  2CUF A;  4UU9 C;  2DDA A;  1ON2 A;  5GP9 A;  4FE4 A;  2LY1 A;  4C2U A;  1X2M A;  2V79 A;  4A0Y A;  4K2E A;  3M8E A;  3BOQ A;  3BTI A;  3D5R C;  1T98 A;  2KIQ A;  2P7V B;  2DOE A;  1R4M B;  2WB1 A;  1ZYR F;  2DPU A;  2LKS A;  4EJU A;  2DFE A;  4YG2 F;  1UZC A;  1TQI A;  3HDD A;  5J6X A;  1AU7 A;  5B4P B;  4C2M J;  1O7L A;  3A0H C;  4S04 A;  1IJW C;  4OIO F;  3K9T A;  3B02 A;  4OAY A;  3LAJ A;  2X6O A;  2E7X A;  3DKX A;  3LQR A;  5HVQ C;  4UUS A;  1I1S A;  5KNL A;  4PFO A;  1S7A A;  3GLL A;  3HGY A;  5HS8 A;  1O3S A;  3WGI A;  1EH7 A;  2WAD A;  3G6E I;  4ASN A;  1KU7 A;  2DLL A;  4Y4R A;  2HXO A;  1MBF A;  4KIB A;  2L54 A;  4MEY F;  3S14 J;  4M3E A;  3PIO F;  2CH0 A;  3J7A Y;  2FNP A;  5L3F A;  3JRF A;  2ZO4 A;  2GM4 A;  4HLX A;  1B8I B;  3I5U A;  2PJR B;  3NEU A;  2HYG D;  3S3M A;  2RN7 A;  3ZQQ A;  4RGX A;  3OR1 C;  5ICG A;  1FOK A;  4UVB A;  4E70 A;  1JXS A;  2E1O A;  4XLH A;  3G73 A;  3IWF A;  4LIT A;  1FYK A;  4XKV A;  5FLV A;  4EM1 A;  3OIO A;  1H88 C;  3HOY J;  3BLY A;  3BR3 A;  3K4M A;  4HA8 A;  2DN0 A;  3BJA A;  1X3U A;  2HEO A;  2IJL A;  4HSR A;  2ZBK A;  1U5T B;  1IGN A;  1WCM J;  3ZR8 X;  2HKX A;  3LSM A;  2K3P A;  2MLG A;  2YU9 J;  1JGS A;  3K1P A;  1P92 A;  4UUT A;  1D8J A;  2M0C A;  2QM3 A;  3MAJ A;  1VQ8 I;  3SQN A;  4Y7N J;  2X6Y A;  3I71 A;  2LRE A;  2XPV A;  2ZJR F;  1Z0X A;  3OWT A;  2A07 F;  2V1N A;  1L3L A;  5IOZ A;  3H0G J;  1B6A A;  4IHY A;  3D1N I;  3K4N A;  3LWF A;  1F9N A;  1XGS A;  2R5Y A;  1DU0 A;  4EGY A;  4BE1 A;  3CUQ A;  2EJR A;  3M8J A;  1O3R A;  5GAH J;  3JRD A;  1JHH A;  1JUP A;  2KDO A;  2XAU A;  3BG6 A;  3OOP A;  3SZT A;  4BEH B;  4F91 B;  3F21 A;  3ZMU A;  3H36 A;  3FX3 A;  4ENK A;  3GX4 X;  3ABT A;  4A3E J;  2M3A A;  4U0V A;  3HG9 A;  1BN5 A;  3VYT B;  3H5N A;  1GUU A;  2LOO A;  3KYL A;  1IO2 A;  4MEX F;  4BQQ A;  2JA5 J;  3FXM A;  4OIP F;  3A01 B;  2EIL H;  5E18 F;  2KZV A;  4RB0 A;  4XRM A;  4LK1 F;  4EJT A;  4BQN A;  2XSD C;  4HBL A;  4GGG A;  2LFB A;  1D5Y A;  4JK1 X;  3OS2 A;  5D4R A;  3K70 C;  5EG0 B;  3R0A A;  2Y48 A;  4BAY A;  2EB7 A;  1U9O A;  2OCC H;  4A3I J;  4D7N A;  3HIF A;  3C3W A;  3HM5 A;  3G1M A;  5FKL A;  3MKY B;  3LFU A;  9ANT A;  3ZMS A;  3GFJ A;  2HQN A;  1JHF A;  1ZRD A;  2MBF A;  1V55 H;  3O8H A;  3CDI A;  1FIP A;  3DPL C;  1MMN A;  1K6Y A;  1TT0 A;  5FLX K;  1KGS A;  2E1C A;  1MMD A;  4I7H A;  2EFN A;  5DM6 F;  4ZTJ A;  1K78 A;  3HL2 A;  2VKV A;  1ZGJ A;  5BS6 A;  1RPW A;  4W97 A;  5LRS A;  4RB1 A;  3H9J A;  3TP0 A;  2L9S A;  4IHW A;  1W7P B;  1IN4 A;  4UUV A;  2A5Y B;  1ETO A;  2P7C B;  3UKG A;  4UUS B;  4KUM A;  3QP5 A;  3OY9 A;  4HV6 A;  5EEG A;  2A6H F;  3Q9S A;  5JLW A;  1JKQ C;  2OA4 A;  2HVS A;  1KON A;  4LIU A;  3L00 A;  4BKX A;  3CMY A;  1BA5 A;  2DU9 A;  1QRY A;  2DA6 A;  1VQ5 I;  4OIQ F;  4WB2 A;  5LGU A;  3CDH A;  2KT0 A;  3D0S A;  1FOW A;  2KHM A;  3FHN A;  4PJJ A;  3S3N A;  2PJR A;  3NRV A;  2H09 A;  5IYB J;  2DMT A;  4EQQ A;  4GDF A;  2XPW A;  2Q0O A;  3KPH A;  1Y1W J;  3OL4 A;  2MSY A;  4I02 A;  2OZ6 A;  3WU2 C;  2V9P A;  1X1C A;  2LH9 A;  2W84 A;  5J3L A;  3BTL A;  1BI0 A;  5CQE A;  2ID6 A;  3GWZ A;  4LLG F;  3RSN A;  3PO3 J;  3OS1 A;  3GZ6 A;  3G71 I;  4DQ2 A;  3F6V A;  2E2J J;  3K4K A;  3F22 A;  1C0W A;  4EV0 A;  3P7N A;  1A31 A;  2EZL A;  4I0B A;  1B1B A;  2GWR A;  3QWL A;  3IV5 A;  5K7F A;  4WB3 A;  4IKF A;  2NVY J;  3HKZ A;  3H3U A;  2V1X A;  4GCV A;  3QOP A;  2DAO A;  1FNN A;  2HDD A;  2R7Z J;  1ETX A;  1RC9 A;  4HNV A;  1ON1 A;  4PGH A;  1HKQ A;  1P4A A;  4KMU X;  4I09 A;  2JPB A;  4I98 B;  4P55 A;  1YW9 A;  1AA7 A;  2JVG A;  1OFC X;  2UUZ A;  1OCC H;  2CV2 A;  2K86 A;  4HX4 A;  2GZW A;  2XHK A;  2VQC A;  3I54 A;  4DZJ A;  1FBQ A;  4A3D J;  4NHJ A;  3F8F A;  3EET A;  4Z2Y A;  1MJ9 A;  1PP7 U;  1RI7 A;  4KT6 A;  3E97 A;  3OIP A;  1X1A A;  3BRO A;  3DKW A;  4L18 B;  4HST A;  1YJN I;  1FYL A;  1NK3 P;  4XOR A;  5DCM B;  2HQR A;  1KU2 A;  2OBP A;  2FA5 A;  4EEF G;  2WAF A;  4QPQ A;  2VJ5 A;  1WWX A;  3CF2 A;  4BJT A;  2DPD A;  2LF8 A;  1UJ8 A;  4F3Q A;  2PBI A;  3JTH A;  4BY7 J;  1ZGW A;  1WJF A;  1SAU A;  4FIS A;  1PJR A;  2MA3 A;  2P81 A;  5C4J J;  1KA8 A;  3DFG A;  2VBW A;  2KQR A;  4U7B A;  4E7L A;  3S32 A;  4ANJ A;  5LEJ A;  4M3G A;  1XSV A;  2CYY A;  3O3K A;  5J40 A;  3Q0W A;  2JTV A;  1VI0 A;  4P3B A;  3FXQ A;  3QOE A;  4M3B A;  3SXY A;  3ZN0 A;  4Z6Y A;  3HTS B;  3GYH X;  1W5S A;  4CZC A;  1K78 B;  1A36 A;  3MFK A;  3K10 A;  1TLH B;  1TW2 A;  3ABK H;  3H9G A;  3EUK L;  3MVP A;  2CG4 A;  3HSE A;  3BC8 A;  2W4S A;  3VYR B;  4HQE A;  3K2A A;  3HTU A;  1T33 A;  3AKZ A;  3DLA A;  3FM3 A;  2FOW A;  3MZ8 A;  1OJL A;  2NVT J;  4P9U A;  5K5Q A;  2EQR A;  1JT6 A;  2DA3 A;  3ISP A;  1MJA A;  3FKI J;  4KJZ A;  5HLG A;  1QU3 A;  3IKT A;  4LK0 F;  2JMW A;  2OTJ I;  3GUD A;  2LDU A;  5F6F A;  1XSD A;  1QPI A;  3AFH A;  1R49 A;  1GV2 A;  4KFC A;  3E6B A;  2Z2S B;  2M4K A;  5ICF A;  1E2X A;  1VQL I;  2K4B A;  3V4G A;  3RTR A;  2DI3 A;  2WC2 A;  3KLN A;  1IW7 F;  4AYB A;  3ROU A;  4HYE A;  1U5T C;  1IV8 A;  2E35 A;  4II3 A;  4CYD A;  1Z91 A;  3UNG C;  1X2N A;  2O9L A;  4LG3 A;  3MKL A;  4IHV A;  3F8M A;  1RUN A;  5E1W A;  3GZN B;  3BG3 A;  3M7G A;  1H89 C;  1G3Y A;  4JP0 A;  1I5Z A;  1ZAR A;  3GCM A;  4KN7 X;  3L1P A;  2MAB A;  2X51 A;  3VFZ A;  2XGC A;  2V1D A;  2F2E A;  3MZH A;  5BOX A;  3LSI A;  1YHQ I;  4BXF A;  2KIF A;  4E6K G;  3LQQ A;  5K5O A;  1EH6 A;  3E1S A;  4B44 A;  3RJP A;  3A03 A;  3O8G A;  2HVQ A;  1WJA A;  1SC7 A;  2B7E A;  4ZTF A;  1RET A;  1UHW A;  1HBX G;  4HF2 A;  3O2P E;  3PIP F;  2PMU A;  5B5E C;  3GTQ J;  4CIC A;  1G59 A;  4U87 A;  3UR3 C;  4FTH A;  2QCO A;  1J2X A;  2A61 A;  4Y52 J;  4PJ0 C;  3GO5 A;  4A3B J;  2EWN A;  3JAM Z;  1EF4 A;  1KU9 A;  3LOC A;  1YE9 A;  4O6J A;  4JYK A;  4RGR A;  5IT9 Z;  4HNU A;  5CQG A;  2GLO A;  2VKH A;  2XIG A;  2O7O A;  1NTC A;  1BBY A;  3W6K B;  2R7T A;  3SYT A;  5F1R A;  5EDN A;  3ASO H;  1RKT A;  1H9G A;  5F08 A;  2XGD A;  3A2K A;  2DA1 A;  4M71 A;  4FX4 A;  1HA8 A;  1TNT A;  3ABU A;  2CQQ A;  2JUG A;  5FD6 A;  4UB8 C;  4X6A J;  1FP1 D;  2NVU B;  1UCR A;  3CCE I;  1YRN B;  3EYI A;  1GXP A;  3BTC A;  2L3D A;  4CUG A;  2RKH A;  2PLY A;  4LG0 A;  3T8T A;  4ZC3 A;  1ODD A;  2VE8 A;  2X85 A;  5EG0 A;  1U0J A;  2DOD A;  1V5E A;  4HDU A;  2L0K A;  3EQL F;  3SJM A;  3CJQ B;  2KFD A;  3CLO A;  3DTK A;  3BR6 A;  1BIB A;  1R5G A;  2EIJ H;  4HOB A;  4CA0 A;  1MZB A;  4O5V A;  1FIA A;  1W4M A;  5LHI A;  1Z6T A;  2L9N A;  1YIJ I;  1MW7 A;  5D5W B;  1MSE C;  5ERI A;  3I64 A;  1FSE A;  4DBQ A;  4L9T A;  3CUO A;  4ZDO A;  1ZN2 A;  1ETV A;  2LVS A;  4G94 A;  4QPO A;  2K85 A;  3ECH A;  1UHS A;  3OYA A;  3OYN A;  5C4X J;  3U1K A;  3G2B A;  1XB4 A;  1F4K A;  1J9I A;  4PSX A;  3CES A;  3DPT A;  5BQT A;  2M45 A;  2B39 A;  3LA2 A;  1VQ4 I;  4BY1 J;  5J1R A;  4ABZ A;  2LSO A;  3VYU B;  3S2H J;  3CLQ A;  2DW4 A;  5FLM J;  2E2I J;  3M1C A;  1Y0U A;  4N9H A;  3PNY A;  1VQM I;  3VYS B;  2KLO A;  2VLA A;  1X1B A;  3JCU C;  2H6B A;  4IXA A;  4PGG A;  2QEX I;  1SEU A;  2XKO A;  1X3Z B;  1IG7 A;  1S3J A;  2F5F A;  3RKW A;  1QHG A;  2BOL A;  2KRC A;  3PNV A;  1XPX A;  3IAM 2;  1Z7U A;  4BS9 A;  2VJJ A;  2IEK A;  4LLN A;  4MHG A;  3GFM A;  4UVA A;  1XMK A;  4MTE A;  1Z3X A;  1YYV A;  2ME0 A;  4M9X A;  1IRZ A;  2HDW A;  2O61 A;  1RKW A;  2VBX A;  1VQO I;  1Z9C A;  5E17 F;  2P4W A;  4A3G J;  5LGN A;  2VT2 A;  4Q5S F;  3P9I A;  1ZEL A;  4CCM A;  2R3S A;  4DYC A;  2NVQ J;  4D9J A;  4GO1 A;  3K4J A;  2GOM A;  1O57 A;  3ZN1 A;  5E8I A;  1YX3 A;  4XID A;  4QTR A;  4F92 B;  2NYX A;  2R92 J;  1RES A;  2QA4 I;  5HLT A;  2EPF A;  1MBH A;  2JSC A;  3SEQ A;  2L9R A;  4EM2 A;  1MDM A;  1LVA A;  4AIK A;  2EV6 A;  3OV8 A;  3QPH A;  4GRI A;  2DMQ A;  4IHS A;  3E7L A;  1ZLJ A;  1ZR2 A;  3QYF A;  2RNG A;  2G7H A;  2RV8 A;  1BC8 C;  1LDD A;  3BZ6 A;  2COB A;  1W5T A;  1B59 A;  1IN8 A;  1USS A;  4AU7 A;  1SFE A;  3OYH A;  3MN2 A;  3V42 A;  3MCZ A;  2GIZ A;  4OAZ A;  5L3G A;  3QP6 A;  3C2H A;  3CDL A;  2ZME B;  4XKC A;  3VSK A;  3RDI A;  3L2V A;  1A6I A;  3AL0 C;  2I8D A;  3A1Y A;  2F5V A;  1RRJ A;  3CC4 I;  2EZI A;  4L5E A;  1LEA A;  1UHM A;  2IGO A;  3RPU A;  2UV1 A;  1YRN A;  4H0E A;  1ZG1 A;  1CFA A;  1JJ8 C;  1S9H A;  5F27 A;  4G7O F;  1J5Y A;  2BY2 A;  4BHC A;  1TL8 A;  1YOV B;  3FMS A;  5EZH A;  2VQL A;  2PMZ N;  1FTT A;  3ZQL A;  4HW5 A;  5FRM A;  3J7A O;  3A0B C;  4Q4Z F;  4D0P A;  1YS6 A;  2DDB A;  3OL3 A;  2ACJ A;  4F93 B;  3IHU A;  3EDP A;  4YRV A;  4J19 A;  2DQR A;  3K7A J;  2FU4 A;  3GTP J;  2E7W A;  3F6O A;  2WA0 A;  2NOJ B;  2CW7 A;  1GLN A;  3CCV I;  4M3F A;  2RQP A;  1FX7 A;  2IT0 A;  4XON A;  5K7H A;  1YJW I;  2E34 A;  2DFH A;  2X1D A;  2B9S A;  4BQA A;  3JRH A;  2YR2 A;  2MYS A;  2P5V A;  2VKD A;  4IQ4 A;  2J5P A;  5DV5 A;  3TDU C;  1BI3 A;  5L3C A;  3FWE A;  3I4M J;  5K5R A;  3M07 A;  3HPH A;  2IAI A;  1XGN A;  2CS3 A;  4ZYA A;  1ZG5 A;  1P9Q C;  4IRI A;  1UST A;  1H0M A;  2R4G A;  2VXZ A;  3JRC A;  3S2D J;  2YX7 A;  4L0Y B;  4DZP A;  3B6C A;  4P96 A;  2DJN A;  3DV8 A;  5LFA A;  1FMW A;  2JPC A;  4KIC A;  4Q48 A;  3WHB A;  2VBZ A;  3BTJ A;  4M9S A;  3JTG A;  2TRT A;  4O3M A;  2GA1 A;  1O3Q A;  3OYC A;  3J81 K;  3PQJ A;  4TV7 A;  4GYI A;  2AQE A;  1SFU A;  4RLF A;  2L7F P;  3DXJ F;  4B48 A;  5GAE J;  4JQF A;  2OPT A;  2M4G A;  3LA7 A;  4AC0 A;  3CCU I;  3CJN A;  4MQV A;  1TWH J;  2XRO A;  2IW5 A;  1KQ0 A;  1TW3 A;  1Y56 A;  4II2 A;  5LD2 C;  3OYD A;  3S8P A;  3KLO A;  2DBB A;  3CMM A;  3E5Q A;  4XR6 A;  1KZH A;  3TOA A;  4BBR J;  3FBN B;  3OYE A;  3JW4 A;  1MMS A;  4LOC A;  3Q0V A;  2Y69 H;  4WXC A;  4XRS G;  1F1Z A;  5L3D A;  2EFO A;  2AXL A;  1WSU A;  1FWZ A;  1X58 A;  2E19 A;  2HOE A;  3GTL J;  5E1Z B;  3GTJ J;  4C30 A;  1Q1V A;  2O8X A;  1DU6 A;  2CMP A;  1E3O C;  3WE2 A;  2GAU A;  3I4P A;  3FXK A;  2HQ5 A;  4UV8 A;  3WTU C;  3NQO A;  2DOF A;  4BHP A;  4B3X A;  2WTE A;  3Q9V A;  3EPZ A;  5FKN A;  2W7N A;  2FNA A;  1KJS A;  2W57 A;  1WH5 A;  2A6T A;  2MGQ A;  3CQZ J;  1Z7L A;  1YG2 A;  1XDU A;  1Z21 A;  2JA8 J;  1A6Q A;  1TT5 B;  4V2G A;  2ME6 A;  1W0T A;  2RAE A;  2ZB9 A;  2BEO A;  3PQK A;  3TBI A;  4G6Q A;  5D5X B;  3H5A A;  3A4C A;  3CCR I;  3H5R A;  2ZKZ A;  4MIM A;  2K7L A;  2DMU A;  3OYM A;  4NC7 A;  1AKH B;  2Y2Z A;  4G7H F;  5EEH A;  1E17 A;  4YFK F;  4LB6 B;  1BW6 A;  2VBY A;  2TDX A;  2VQG A;  2DA5 A;  2OAZ A;  2WB1 N;  2E1M C;  4Y17 A;  3FM5 A;  1EJ9 A;  2OV7 A;  3DEU A;  3HC7 A;  5LRR A;  2W85 A;  5D5V B;  5L3B A;  3OYK A;  3RZD J;  4CZZ A;  1YO5 C;  1QNT A;  4JX5 A;  1PVE A;  4BUP A;  1OYY A;  2QGU A;  3L9F A;  1TWF J;  1FMV A;  1XMX A;  3C2B A;  5CVJ A;  3WOD F;  3S2W A;  2ZSI B;  2E71 A;  4IL6 C;  3PL8 A;  1S8N A;  5JHF A;  3KCC A;  2BYV E;  1SVM A;  4BQO A;  5FD5 A;  4Y3O A;  2LKX A;  5FFZ A;  1DDN A;  5DM7 F;  3J81 Z;  1FY7 A;  3R6S A;  2M9H A;  5HLH A;  3VOD A;  4WCG A;  2VUM J;  2DA4 A;  2IGN A;  1XN7 A;  3QPL A;  1VQ6 I;  1Z77 A;  4IPA A;  2VT3 A;  1P7I A;  3BG5 A;  2R7V A;  3K1N A;  4LMY A;  2O3F A;  2XPU A;  4HWJ A;  1IXS B;  4S0H B;  2Q2E A;  3WTT C;  2GBY A;  3DF8 A;  3PFI A;  1T0F C;  2R7Q A;  1O7F A;  1JUM A;  1RZ4 A;  2Z99 A;  3FF5 A;  2XB5 A;  2E5N A;  3BR1 A;  2DTR A;  3N97 A;  1LKX A;  2HGC A;  5D8K B;  3T5X A;  1MH4 A;  3KIO A;  1Y8R B;  1R4N B;  4U0W A;  3H35 A;  4XSX F;  2E36 A;  2LC2 A;  5A2Q K;  2AO9 A;  1VFC A;  4FX0 A;  5F04 A;  3ZMZ A;  1CF7 B;  4ZYH A;  4KMF A;  2N8G A;  4BU2 A;  1N77 A;  2XF6 A;  3CUQ B;  2LK2 A;  3FXR A;  4RA2 A;  3J7Z I;  1DP7 P;  2VIX A;  1LFP A;  3HPG A;  3VWB A;  2PFB A;  2F6C A;  3T0Y A;  5GAD J;  1IUY A;  2VJI A;  3MMY B;  4HEA 2;  1JKO C;  4XKW A;  1LNW A;  2ZXI A;  3A02 A;  3E6C C;  5DYM A;  5M5X J;  3ZOB A;  2F4I A;  2PMH A;  4L9J A;  5ILV A;  3F3X A;  3AG2 H;  1QZE A;  2KL4 A;  1U3E M;  6PAX A;  2R7F A;  2VXD A;  2NS7 A;  2WY7 Q;  4P3A A;  1MH3 A;  4EJO A;  2XAG A;  5IOY A;  3TO7 A;  3ABL H;  4FCY A;  2GOX B;  3K70 D;  1RR7 A;  1U78 A;  2ZXJ A;  2IS4 A;  3HBL A;  1IRX A;  1VQP I;  2ECB A;  2DTZ A;  2KRF A;  3CME I;  1VQ9 I;  3HQB A;  4Y15 A;  5IYC J;  2QZ8 A;  2KJB A;  2H27 A;  3GBG A;  2L5Q A;  2QWW A;  2HYJ A;  2BXY A;  4UNO A;  1ONV A;  2FXA A;  4IOA F;  1U8B A;  1W5C C;  2HOA A;  1WJC A;  4A93 J;  5JVT A;  3RKX A;  4RAY A;  2M30 A;  1AHD P;  5FB2 A;  4R8H A;  2GXA A;  2OTL I;  4HW0 A;  1DGR M;  1EKE A;  4F7Z A;  4WK8 F;  3ZMV A;  1XX5 A;  4E4H A;  3BQZ A;  3HRS A;  4XN0 A;  3HRU A;  4XL9 A;  4OMY A;  1OLT A;  4PCQ A;  4C2T A;  2LD5 A;  2WV1 A;  1UAA A;  1MSF C;  3I4N J;  4OIN F;  1F36 A;  3ZRG A;  4G12 A;  5LEK A;  1AKH A;  2CSO A;  4I6Z A;  2KIU A;  3QU6 A;  2RNJ A;  1MMG A;  3F9K A;  2WBM A;  2JUC A;  2M1B A;  3V7C A;  3BJO A;  2ZJQ F;  1R71 A;  1NK2 P;  3M8F A;  1XS9 A;  2CFO A;  1PYV A;  2A3S A;  3CD6 I;  5FFX A;  3ZP5 A;  3TL4 X;  2H8R A;  1X1P A;  4F55 A;  2F4O B;  3CJT B;  4GXO A;  3WTZ A;  2ZJ2 A;  4FXK B;  3QOD A;  3KEO A;  2D1V A;  5JPM B;  1OCP A;  5IPA A;  3PSF A;  5KK1 A;  4RGS A;  1E0E A;  3CUQ C;  3DEW A;  5DUI A;  2MC4 A;  5DEQ A;  3FMR A;  5E3N A;  1S29 A;  2MC3 A;  3DWL E;  3AG3 H;  4PFP A;  1FBS A;  3V7R A;  1VQ7 I;  4A3K J;  2VKE A;  2VPL A;  4KIT B;  3OS0 A;  1WPK A;  5JLX A;  5FKM A;  1U5T A;  4KIF A;  1VF9 A;  1GDT A;  3K4L A;  3OIQ A;  1D1C A;  2IBD A;  4FAS D;  3CO7 C;  1MBE A;  1WGX A;  3K0L A;  4XBF A;  2HVR A;  2BVL A;  1U2W A;  2JWT A;  2WV0 A;  2XAF A;  3CTA A;  3KP5 A;  1XGO A;  2DYS H;  4RDU A;  2BVM A;  2KP6 A;  1OCT C;  2ZC2 A;  5F0C A;  5J1U A;  1X19 A;  5IP6 A;  3TED A;  2CJJ A;  4MO7 A;  1LDJ A;  2M87 A;  5IP9 J;  4PSW A;  2M2E A;  1JI8 A;  2DA7 A;  2PX9 A;  3WHC A;  1P7J A;  5JVG F;  1G8X A;  1D5V A;  2QUF A;  2L4M A;  1D1B A;  2Z16 A;  3WTV C;  1BW5 A;  1XGM A;  2P5K A;  3MD2 A;  1OR7 C;  3GEZ A;  2R5Z B;  3BP8 A;  2HWV A;  1N25 A;  1O3T A;  2YPR A;  4CYC A;  1R1T A;  2ELJ A;  5L3E A;  5J8C A;  2EFQ A;  2XKP A;  5B1A H;  3R61 A;  5IYD J;  2LBF A;  1X4O A;  1PUE E;  2ICW G;  1D0Y A;  3JAM K;  1IAW A;  2VOP A;  3AAF A;  3LFK A;  4KA4 A;  1VQK I;  1B72 B;  1S6L A;  2VI6 A;  1WRJ A;  2FMY A;  1V54 H;  4HF1 A;  3GZ5 A;  1FSH A;  1EV7 A;  2KIM A;  2R7S A;  2JQ7 A;  2CUE A;  1QZY A;  1OPC A;  1V5G A;  4AIH A;  3CP8 A;  2M8E A;  1IRG A;  1YFH A;  2MD5 A;  2HI3 A;  1R23 A;  3LL7 A;  1BOA A;  1UG0 A;  4N9I A;  2Y9Z A;  4A5N A;  3OOU A;  5B1B H;  4EVI A;  1S7E A;  2EA4 A;  4HX7 A;  2GIV A;  2EIM H;  4LIV A;  2AS5 F;  4E7H A;  4N4N B;  3GTK J;  5ICE A;  5HNF A;  1M1E B;  2BBY A;  4A3F J;  1HW5 A;  2FE3 A;  4LJZ F;  2VAS A;  1J75 A;  3NAR A;  3NWT A;  4RB2 C;  1XCB A;  2P6S A;  2DCE A;  4CXF A;  4DOZ A;  2Y31 A;  3IRQ A;  2XV4 S;  3W6V A;  1R22 A;  4Q47 A;  1KU3 A;  4W1U A;  5HNH A;  2PMZ A;  1LVK A;  1HQC A;  5ILU A;  1BC7 C;  2K9L A;  2NNN A;  1W36 C;  2XAJ A;  2CWE A;  2JK3 A;  2E5Z A;  1L0O C;  2BGC A;  3BQY A;  1UG2 A;  4ENN A;  2KIS A;  2Z9O A;  4BGD A;  2O8K A;  4KNY A;  2E60 A;  4PJN A;  2D1H A;  3IP4 B;  4PZJ A;  3RYP A;  1HXD A;  4KDP A;  4M72 A;  3ZQ7 A;  2V7F A;  3DEE A;  3KET A;  2FSW A;  1EA3 A;  4HDV A;  1Y6I A;  4DYQ A;  1F5T A;  2A68 F;  3IH2 A;  2EFP A;  4V2F A;  2DT7 B;  3TO6 A;  3WTY C;  2X0L A;  3KP7 A;  3EUH C;  1MBJ A;  4V19 K;  1FOY A;  4QSH A;  2EV0 A;  2QSG X;  3HOZ J;  2VB6 A;  5FKO A;  2A69 F;  3I59 A;  2Y9Y A;  4ZYD A;  2XRN A;  4IJA A;  4NDL A;  1JUS A;  3L09 A;  3KLS A;  4DBR A;  4YII A;  1IV6 A;  3CCY A;  1HW1 A;  3L2R A;  2W00 A;  3PSI A;  3R0J A;  1Q1H A;  2PN6 A;  3QAH A;  1FC3 A;  4HPQ A;  2V6E A;  5EEA A;  1NH3 A;  1MKM A;  3WTW C;  1V3F A;  4B3A A;  2QQ8 A;  5BPD A;  1LE8 A;  4NC8 A;  2IRF G;  2CUZ A;  2OD5 A;  4HAM A;  5K1Y A;  1SFO J;  2WAE A;  3RKQ A;  4UVC A;  4BXU A;  1R9T J;  3HYI A;  4A2U A;  1V4R A;  2HYF A;  4E7J A;  2NXN B;  2OJE D;  4XLC A;  3J80 Z;  5CVR A;  3ULQ B;  4LGW A;  4WF2 A;  1JTX A;  1R58 A;  4HV5 A;  1X3W B;  5CPR B;  2OQG A;  2LBF B;  3CC7 I;  2ZSH B;  4OIR F;  1FYM A;  2L7M P;  1NG6 A;  4IQJ A;  1LUJ B;  3GF2 A;  4OWR B;  3DU6 A;  4G9Y A;  2D45 A;  2K9S A;  4ZYG A;  1S7O A;  2OC6 A;  1SFX A;  4G6D A;  4RS8 A;  2V9V A;  2VOO A;  2RRE A;  2VJ4 A;  2PI0 A;  1S72 I;  1TWA J;  3N05 A;  3HOT A;  3OYG A;  3V8K A;  3E6D A;  2ZNZ A;  3KFW X;  1K83 J;  2JZY A;  4P9F A;  4ENM A;  2M8G X;  1RNL A;  4X0G A;  4LD5 A;  3HOV J;  1N75 A;  1YW7 A;  2ELK A;  2LG4 A;  1G2H A;  5FJ8 J;  3F0C A;  3FIW A;  2NS8 A;  2IP2 A;  3HB9 A;  4CCK A;  1ZRC A;  2NAZ A;  4Y13 A;  1QVT A;  3NAU A;  3K2Z A;  2DT5 A;  3K6G A;  5J1Y A;  1R6R A;  3HHH A;  2O6G E;  5E1X A;  1D3Y A;  2G9W A;  4ZDP A;  2H94 A;  4CCL A;  5ICC A;  1QO0 D;  1NG7 A;  1XTA A;  4I01 A;  3GFI A;  5FRN A;  2CFX A;  1OQY A;  1FT9 A;  3CCM I;  3P9K A;  5F0F A;  2XB0 X;  1T39 A;  5LLQ A;  3CCL I;  2FD5 A;  2ZJP F;  5F0H A;  3JRG A;  3MKW B;  4RLQ A;  2MLK A;  4S05 A;  3BR0 A;  2DA2 A;  3DTE A;  3Q5F A;  4L9N A;  3HKZ N;  3FKJ A;  3AG1 H;  4FET A;  4P1W A;  2IXS A;  3B6A A;  4ENJ A;  3KEQ A;  2OU2 A;  3D5S C;  1YX5 A;  1P6R A;  1WHU A;  2DO7 A;  4L5I A;  2E1M B;  2X9D A;  1J0R A;  4HZF A;  1B8I A;  2QQB A;  3M9A A;  2EFW A;  1J7K A;  3SEZ A;  5EGO A;  1T95 A;  3C1D A;  4M6X A;  2LNB A;  2FML A;  3E5X A;  3FMQ A;  4KYW A;  3OYI A;  1OIS A;  1J09 A;  1ZG3 A;  2F5D A;  1HDP A;  3WTX C;  4NB5 A;  3K4C A;  4CCJ A;  5IY5 H;  2I5U A;  2B0L A;  1JGG A;  5H6Q A;  4XNF A;  1Y8Q B;  4PDK A;  1SD7 A;  1GHC A;  3S1N J;  2QEN A;  3IH3 A;  2C6Y A;  1G3T A;  4BXX J;  1Y39 A;  3IH4 A;  2P0W A;  4HLY A;  3H0D A;  5GTH C;  1B9M A;  2EA2 A;  2LYC A;  3VEP A;  4IHX A;  5J8F A;  2L7K A;  1STZ A;  4ESJ A;  5DDG A;  1MDM B;  2DT6 A;  2NRA C;  3CCJ I;  2RDP A;  2ADU A;  3MZY A;  2ZCW A;  2HKO A;  2NVX J;  1I6H J;  3AG4 H;  4E7K A;  4G6T B;  2VL8 A;  1JTY A;  2Q1Z B;  1BR2 A;  5TJJ A;  5TGT A;  3MKZ A;  3G4S I;  4OMZ A;  3HRM A;  1D0Z A;  3U21 A;  1LE8 B;  2BW3 A;  2K9N A;  1I6X A;  2M7A A;  2K27 A;  3KP2 A;  2H1K A;  5DD4 A;  1CGP A;  1KYZ A;  1HC8 A;  4XOT A;  2LY2 A;  5AON A;  1R5I D;  3DTI A;  2UXN A;  1IN6 A;  2ZXH A;  1TWG J;  1Z6R A;  3J80 K;  2QVO A;  2HOS A;  3S3O A;  3GXO A;  3KZZ A;  3KZY A;  2HFH A;  4XM3 A;  2Y0S A;  1R5H A;  2XDV A;  4HQM A;  4CCN A;  1IDZ A;  4HX8 A;  2HPI A;  4LB5 A;  3C7J A;  4XMY A;  2DFF A;  5EZG A;  3V7S A;  1OCO H;  3L2Q A;  1OYW A;  3VDX A;  2LTP A;  2EBI A;  2Z1D A;  4A0X A;  1YIT I;  3JRE A;  2DK8 A;  1A35 A;  1Z67 A;  3CZ6 A;  3LSG A;  4YEL A;  1WKM A;  1FBU A;  3RKY A;  3ZQI A;  5TRD A;  3ERE D;  1AOY A;  4D7M A;  3GW2 A;  3LMM A;  5EYR A;  4XOP A;  5H2F C;  1SFK A;  1TNS A;  2CO5 A;  4N0B A;  2QBY A;  1UEL B;  3HOS A;  1WH7 A;  3R60 A;  2DXI A;  3L2C A;  1GVD A;  4IF4 A;  3WG9 A;  2H8W A;  2RGV A;  2IS6 A;  2F4M B;  1ETW A;  2K4J A;  4JBA A;  4B47 A;  4KIS A;  2XRL A;  3FHZ A;  3GVA A;  4I2O A;  2FRH A;  3CCS I;  1PP8 F;  2CV1 A;  4YEJ A;  4I99 C;  2Y30 A;  4WX9 A;  4A3L J;  1VZ0 A;  4CH7 A;  5JR3 A;  3W6J B;  3WGH A;  1IRF A;  4ETS A;  4LLL A;  2K5C A;  1HW2 A;  1YI2 I;  3W3C A;  2EIK H;  3O6B B;  3S15 J;  3FXO A;  3PJR A;  4WXH A;  2CV0 A;  4BBS J;  1BJA A;  2K02 A;  4F52 A;  2WWY A;  4UY8 I;  4ON0 A;  5GPA A;  1ITY A;  2WAQ A;  1G3S A;  1W36 D;  4ZJZ A;  4P5O A;  1WI3 A;  1OKR A;  1H9T A;  4ZDL A;  3FK6 A;  3RIR A;  1RR8 C;  4XN3 A;  2L9V A;  1TQM A;  3BZC A;  4AWX B;  4E7I A;  4M73 A;  2HU9 A;  3QRF F;  2A05 A;  3E6M A;  4DGW B;  1OR7 A;  1WJB A;  3TMO A;  4M74 A;  5F64 A;  3W2A A;  1HSJ A;  5KAF C;  3H3V K;  1W0U A;  2VON A;  1LEB A;  3BCA A;  5E20 A;  2ID3 A;  4MFD A;  1JT0 A;  2VE9 A;  1ZKG A;  2X48 A;  3I58 A;  2HTJ A;  4CSW A;  2XVC A;  2O5R A;  1G6N A;  3PNT A;  3RYR A;  4L0Z B;  2PQ8 A;  1BIA A;  2R7D A;  1MIJ A;  1WI9 A;  2B63 J;  2ZFW A;  2X1E A;  3TO9 A;  1P2F A;  1IN5 A;  5D4S A;  3OSF A;  2JRM A;  2XGX A;  4L5J A;  3IL2 A;  4B4C A;  2QSH X;  1QGP A;  2DYR H;  3ASN H;  5F1J A;  5C3E J;  3KEY A;  2BW3 B;  2R5Y B; 
#chains in the Genus database with same CATH homology
 2MC4 A;  2WY8 Q;  3K4B A;  4XLA A;  1YE9 A;  3FDY A;  3DWL E;  4PFP A;  4HNU A;  4BEH A;  5CQG A;  4HG2 A;  1D0X A;  2VPL A;  2VKH A;  4KIT B;  3OS0 A;  2R7T A;  3SYT A;  3K4L A;  3OIQ A;  1D1C A;  3A2K A;  4FAS D;  1HA8 A;  3ONQ A;  2HVR A;  2JUG A;  2BVL A;  2HQA A;  2R7R A;  2A5W A;  3DKY A;  2BVM A;  2KP6 A;  4CUG A;  4AVZ A;  1X19 A;  3RQ4 A;  4PUS A;  4ZC3 A;  2X85 A;  2HPM A;  1U0J A;  3OYF A;  1V5E A;  2KMU A;  1D1A A;  3CJQ B;  3DTK A;  4PSW A;  3I3L A;  1JI8 A;  3C2G A;  4CA0 A;  3DPU A;  3NWS A;  2XF7 A;  2DJI A;  1G8X A;  2L9N A;  1MW7 A;  1D1B A;  2Z16 A;  4E7Z A;  2QKL B;  4DBQ A;  4ZDO A;  3CJR B;  3MD2 A;  1OR7 C;  1MNE A;  4QPO A;  1WJD A;  4E7S A;  4NNJ A;  3IAS 2;  2R7X A;  1WJ5 A;  2V9K A;  3OYA A;  3OYN A;  1BR1 A;  2ELJ A;  3G2B A;  2M0M A;  4PSX A;  3CES A;  3DPT A;  2MD0 A;  2Q2E B;  3BCB A;  5FRO A;  4BDZ A;  2LBF A;  1X4O A;  1BOB A;  1D0Y A;  2UWM A;  3VYU B;  4H4K C;  4XLE A;  3M1C A;  4HRI A;  3SZG A;  4D1Q A;  3PNY A;  3LSK A;  2KLO A;  3VYS B;  1X1B A;  2VLA A;  2ZFU A;  2KPM A;  2R7S A;  5CKT A;  1QHG A;  2BOL A;  2KRC A;  1V5G A;  3PNV A;  3DU5 A;  2LY1 A;  3IAM 2;  3CP8 A;  4C2U A;  4BS9 A;  2VJJ A;  3D5R C;  3LL7 A;  1UG0 A;  2WB1 A;  1Z3X A;  3OOU A;  4J00 A;  2HDW A;  4LIV A;  4E7H A;  1V5F A;  4N4N B;  2K9M A;  2HZD A;  5HNF A;  1ZEL A;  4CCM A;  4OAY A;  4D9J A;  3DKX A;  5HVQ C;  3K4J A;  2GOM A;  1X1D A;  2VAS A;  1YX3 A;  4PFO A;  3NWT A;  5KNL A;  4BJ6 C;  1ERD A;  4F92 B;  2DCE A;  3W2W A;  4DOZ A;  4J01 A;  5HLT A;  1MND A;  2WAD A;  3SEQ A;  3AL0 B;  4Y4R A;  5HNH A;  2PMZ A;  1LVK A;  4GRI A;  2K9L A;  2CH0 A;  3J7A Y;  1W36 C;  3IUO A;  2E5Z A;  2PJR B;  3QYF A;  2RNG A;  4RM3 A;  4C9Y A;  4BGD A;  3S3M A;  3UR3 C;  3ZQQ A;  2E60 A;  3OR1 C;  4PJN A;  3IP4 B;  1LDK B;  2V7F A;  3DEE A;  4AU7 A;  3LSH A;  3OYH A;  4XLH A;  1EA3 A;  1Y6I A;  4LIT A;  4XKV A;  3V42 A;  3BLY A;  3K4M A;  1X4P A;  2DT7 B;  4OAZ A;  3C2H A;  3I9V 2;  2QKM B;  4XKC A;  3VSK A;  3EUH C;  4HSR A;  3PUB A;  3L2V A;  4IX7 A;  3OR2 C;  3AL0 C;  2VB6 A;  2I8D A;  3ZR8 X;  2LRD A;  2F5V A;  1DGW Y;  3A1Y A;  3LSM A;  2K3P A;  2IGO A;  3BG7 A;  2UV1 A;  2X6Y A;  2LRE A;  4DBR A;  1S9H A;  3CP2 A;  3OWT A;  3RCO A;  2V1N A;  2VQL A;  3L2R A;  2W00 A;  3PSI A;  5FRM A;  4HPQ A;  2V6E A;  2JVH A;  3K4N A;  3DQV C;  3OL3 A;  1TZL A;  2KRH A;  4F93 B;  4YRV A;  4BE1 A;  3ZXS A;  3M8J A;  4NC8 A;  2CUZ A;  2NOJ B;  2WA0 A;  2CW7 A;  3S93 A;  1GLN A;  2WAE A;  2KDO A;  2XAU A;  3BG6 A;  4XON A;  4BEH B;  4BDY A;  4F91 B;  2CUJ A;  2X1D A;  4BL0 B;  4E7J A;  4XLC A;  2MYS A;  2M3A A;  3HG9 A;  2VKD A;  4IQ4 A;  3H5N A;  3VYT B;  2LOO A;  3KYL A;  4BQQ A;  3HPH A;  4FXG B;  5CPR B;  2CS3 A;  4ZYA A;  2LBF B;  2KZV A;  1P9Q C;  2ZSH B;  2JA2 A;  3KX2 A;  4NUB A;  4BQN A;  1NG6 A;  3W2V A;  4IQJ A;  2R4G A;  2VXZ A;  4OWR B;  3DU6 A;  3OS2 A;  2OC6 A;  4NQW B;  2XF5 A;  3K70 C;  5LFA A;  1FMW A;  4IZZ A;  2RRE A;  2VJ4 A;  1DP3 A;  2R7U A;  1BR4 A;  2VQH A;  3N05 A;  4HNT A;  3OYG A;  3HOT A;  3OYC A;  4CCO A;  3MKY B;  2AQE A;  3LFU A;  4RLF A;  3EUA A;  4X0G A;  4B48 A;  4JQF A;  2M4G A;  2R7W A;  3RPU D;  1N75 A;  3DPL C;  2LG4 A;  3OYB A;  1MMN A;  1K6Y A;  1TT0 A;  3ZGK A;  4CCK A;  3HUG B;  1Y56 A;  4II2 A;  1MMD A;  5LD2 C;  3OYD A;  3S8P A;  4ZTJ A;  2FUG 2;  3CMM A;  4XR6 A;  3HL2 A;  3K6G A;  1R6R A;  3FBN B;  2X6X A;  4CCL A;  4ZDP A;  4B43 A;  3OYE A;  3H9J A;  2IS2 A;  2L9S A;  1NG7 A;  5FRN A;  5HOO A;  4C30 A;  2CMP A;  3OY9 A;  3MKW B;  4RLQ A;  1WFX A;  2HVS A;  3DTE A;  4EAT A;  1KON A;  4LIU A;  3L2U A;  3FKJ A;  4JOM A;  4FET A;  4P1W A;  2IXS A;  3H9Q A;  4B3X A;  3EPZ A;  3D5S C;  1YX5 A;  4DIQ A;  2E1M B;  2W7N A;  2KHM A;  3FHN A;  4PJJ A;  2PJR A;  3S3N A;  2A6T A;  1Z7L A;  3SEZ A;  1Z21 A;  3OL4 A;  1T95 A;  1X1C A;  2LH9 A;  3OYI A;  1J09 A;  3TBI A;  5CQE A;  3H5A A;  4CCJ A;  3K4C A;  3A4C A;  3RSN A;  4XNF A;  3H5R A;  3OS1 A;  2X1C A;  3OYM A;  4NC7 A;  3K4K A;  4MLO A;  2M7B A;  2P0W A;  3H0D A;  2LYC A;  3ZCO A;  2OUM A;  2VQG A;  2L7K A;  3OYL A;  2IGM A;  2E1M C;  1QHH D;  2OV7 A;  2DT6 A;  3HC7 A;  3OYK A;  4IKF A;  4BUP A;  3HKZ A;  1FMV A;  2CW8 A;  1DQU A;  4E7K A;  4G6T B;  2ZSI B;  4BE2 A;  2HNH A;  2VL8 A;  3VSL A;  2Q1Z B;  1BR2 A;  5TGT A;  3MKZ A;  3PL8 A;  1D0Z A;  2XSJ C;  5JHF A;  3U21 A;  2JVG A;  1AA7 A;  2BW3 A;  2UUZ A;  2CV2 A;  2M7A A;  4BQO A;  4Y3O A;  2VQC A;  3L2W A;  4XOT A;  2LY2 A;  5KCM A;  3DTI A;  2IGN A;  2ZXH A;  2R7V A;  3S3O A;  4KT6 A;  3OIP A;  1X1A A;  4XM3 A;  2Y0S A;  2IS1 A;  2XDV A;  2R7O A;  3QYE A;  4HST A;  2L2O A;  4CCN A;  4XOR A;  2HPI A;  1T0F C;  4XMY A;  4XLF A;  2R7Q A;  2XC7 A;  2WAF A;  2V4J C;  2VJ5 A;  4QPQ A;  2E5N A;  3CF2 A;  4BJT A;  2AQF A;  3L2Q A;  4F3Q A;  3VDX A;  1LKX A;  2Z1D A;  2IGK A;  5KHD A;  1WJF A;  1SAU A;  3CZ6 A;  1PJR A;  3LSG A;  3H35 A;  4RMN A;  4XKB A;  4YEL A;  2LC2 A;  2KQR A;  3PFY A;  1N78 A;  4U7B A;  3D5L A;  4Y33 A;  4BU2 A;  1N77 A;  2XF6 A;  3S32 A;  4ANJ A;  4E7L A;  3LMM A;  2VIX A;  1LFP A;  3HPG A;  4XOP A;  3VWB A;  2F6C A;  1SFK A;  2VJI A;  2X6W A;  3MMY B;  4HEA 2;  4XKW A;  2ZXI A;  3QOE A;  1UEL B;  2F4I A;  4CZC A;  3HOS A;  3K10 A;  2DXI A;  4PK4 A;  2KL4 A;  3H9G A;  3EUK L;  2VXD A;  3BC8 A;  2W4S A;  3VYR B;  3AKZ A;  2WY7 Q;  3DLA A;  2IS6 A;  4B47 A;  4KIS A;  2W82 A;  2GOX B;  3K70 D;  4KJZ A;  1QU3 A;  3OYJ A;  2IS4 A;  2CV1 A;  1IRX A;  4YEJ A;  2MFZ A;  1VZ0 A;  4CH7 A;  2JSP A;  2K5C A;  3AFH A;  1Z3Y A;  3W3C A;  3GBG A;  2L5Q A;  2Z2S B;  3SDB A;  2M4K A;  4BJ5 C;  2V26 A;  2CV0 A;  3PJR A;  4F52 A;  4PJM A;  3RTR A;  1WJC A;  2WAQ A;  1W36 D;  4ZJZ A;  3QYB A;  4P5O A;  2W1O A;  4ZDL A;  4AYB A;  4XN3 A;  4II3 A;  4E7I A;  1DGR M;  1WJE A;  2HU9 A;  4DGW B;  4BAC A;  4E4H A;  1WJB A;  4XN0 A;  3TMO A;  3UNG C;  4LG3 A;  4XL9 A;  1OLT A;  3W2A A;  3OMY A;  4C2T A;  1UAA A;  3ZRG A;  3BCA A;  3HXL A;  2RQQ A;  1MMG A;  4BE0 A;  4N4O B;  2MAB A;  2X51 A;  3F9K A;  3E0J B;  4CSW A;  2O5R A;  1MMA A;  2WBM A;  3LSI A;  4R79 A;  4BXF A;  3PNT A;  4E6K G;  4DJA A;  2DOA A;  2X1E A;  3E1S A;  4RM2 A;  4B44 A;  2CFO A;  1PYV A;  2HVQ A;  1WJA A;  4XQF A;  4ZTF A;  3TL4 X;  4F55 A;  4ITV A;  3QOD A;  5JPM B;  3FBI B;  4PJL A;  1G59 A;  3PSF A;  3KEY A;  4U87 A;  1E0E A;  2BW3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...