1AA7A

Influenza virus matrix protein crystal structure at ph 4.0
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
158
Chain Sequence
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Matrix protein
molecule keywords INFLUENZA VIRUS MATRIX PROTEIN
publication title Structure of a bifunctional membrane-RNA binding protein, influenza virus matrix protein M1.
pubmed doi rcsb
total genus 57
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1aa7A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 1aa7A01
4IQ4A 1AA7A 5CQEA 4PUSA 2Z16A 1EA3A 3MD2A 3VDXA 4D9JA 4ITVA
chains in the Genus database with same CATH superfamily
2D1VA 4HYEA 3P9IA 3RJPA 4D5CA 1XS9A 4M3DA 4KA4A 1YE9A 3J7AY 3HTUA 4PCQA 4K2EA 4XK4A 1NG6A 4BJ6C 1OMIA 4L5JA 3GF2A 1BI1A 4M3FA 3CCQI 3MVPA 2QSGX 4ZDOA 4IVNA 4B47A 2OU2A 1AKHB 2KKOA 3G71I 3VYRB 2KIFA 2BXYA 3BZCA 2EV6A 3EYYA 5F04A 1R4MB 4OINF 1KU3A 4X1EA 3F3XA 5J8CA 3ZCOA 4RLQA 1IF1A 3MCZA 1W1WE 2MH9A 4G8XA 1HQCA 3F23A 1EH7A 3QRFF 1HKQA 3LQRA 2H6BA 2V6EA 3WE2A 4P9UA 4ESFA 1LNWA 3K69A 2ELJA 1IN6A 1FBQA 5DV5A 2F5FA 2OCEA 1AKHA 4CXFA 1VQ4I 5ILSA 1KZHA 2I5UA 4BJTA 3RKYA 1ZRDA 1O4XA 2A61A 4FASD 3T8RA 2DYSH 3Q9VA 3PO3J 2OF7A 2V4JC 1QZEA 2LMDA 4B44A 3LFUA 3G6EI 4MEXF 4YFXF 5GAEJ 1OKRA 5IT9Z 4M6YA 4Z2YA 4HF1A 4AIJA 4F91B 2XGCA 3HOVJ 4ZZDA 1HBXG 3ESWB 4ON0A 5FLXZ 3S32A 1O7LA 4IX7A 4DQ2A 1X2MA 3OS1A 2M3AA 1Y1WJ 3QQAA 2HPMA 5E1XA 1YX3A 2CW0F 1Y6IA 3QYFA 4GXOA 3IRRA 3E6CC 5D8KB 2WA0A 3BZ6A 2XVCA 5F0FA 4XSXF 3I9V2 2D2WA 2DDBA 3G3ZA 2P81A 3G4SI 3UNGC 2EA2A 4C2TA 3CD6I 3VYUB 3HJEA 2ECCA 3MEXA 4XLCA 2M45A 3I56I 4P1WA 4R79A 2PJRB 2FUG2 1YQAA 1QQIA 1U9OA 4KIGA 1RZ4A 3G1LA 4PZJA 2R5ZA 3E1SA 2FOWA 3OYGA 2HTJA 2J5OA 1X1AA 2V9PA 5J1YA 2NVUB 1D0YA 1D0XA 2BVMA 2PEXA 1HA8A 5FLVA 1GV2A 4HF0A 3BLYA 2K9QA 2HOEA 3O8HA 1EF4A 1JJ6C 2XAHA 4BY7J 1MZBA 3KZZA 1SVMA 5CVJA 2QEXI 3GVAA 3GFIA 2ZJ2A 3PUBA 4XOPA 5CVIA 3FDYA 5B1BH 1ZAOA 1S7OA 3ZXSA 3ZQLA 5J3LA 4AWXB 2WBMA 2ADUA 1WH5A 2W24A 3WGHA 3VOEA 3I71A 3RPUA 2GQQA 2HVQA 2R7XA 1LE8B 1TWGJ 1V5GA 3U2RA 3I3LA 2BOLA 3SDBA 5D4RA 1ENHA 1WSUA 4U0VA 3KEYA 5CVVA 5IYBJ 3FKIJ 2W7NA 5CKTA 2B0LA 5KAFC 4LMYA 4P96A 4YRVA 1D8KA 3FM5A 2ISYA 2PX9A 2Q0OA 2KT0A 2UXXA 2XF5A 3FXJA 3TOBA 1W7PB 3IHUA 5AONA 2WAQA 1MGTA 4CCNA 3TBIA 5HLGA 2R7SA 4F7ZA 1DPRA 3J7ZI 3WODF 2D1HA 3U1KA 4IOCF 2Q8KA 3CUQB 1VQPI 5FKNA 1AHDP 4UV9A 5DUKA 4KT5C 4X6AJ 2ZMEA 4F52A 3F6VA 2D45A 3ABUA 4A6DA 5LGTA 1XD7A 4AM3A 3HGGA 4PK4A 4UB6C 4LLLA 1V4RA 3K7AJ 4IQJA 5E3MA 4P5OA 1YTYA 1IW7F 5LBQA 2DN0A 4DNCA 3O6BB 3CCUI 3F72A 2FX0A 2HYFA 4HQEA 4OWRB 1PYVA 5DCMB 1ETWA 2V9KA 2FBIA 3KCCA 2BGCA 2QQ8A 4U0YA 3HHGA 2EJRA 5FKMA 2ELHA 1ODDA 1SEUA 2X1EA 4J19A 1XGOA 4FETA 2HQ5A 2M2EA 3REOA 4OAZA 1U5TC 3JTGA 2V1UA 4HX4A 4QWQA 3BR5A 1UG2A 1TT5B 2ZNZA 1N25A 4KICA 4PGGA 3FKJA 3IC7A 1JHHA 5H20A 1OCPA 1XGNA 3KYCB 4L18B 2L7FP 1IRZA 3K4CA 2OZUA 4KYWA 4XICA 3FXOA 1RKWA 2CW7A 3WTVC 4GCVA 2FMLA 2O6GE 3VDXA 2NS7A 3DCFA 2RN7A 3GCMA 5EZGA 4IHVA 2BY2A 1B72A 2IT0A 2HXOA 1BR2A 1MKMA 1RC9A 2K86A 2K9NA 4XSZF 1WJCA 3WTUC 3IKVA 3L1PA 4I0BA 2M0MA 2UV1A 3DTIA 4HLXA 2HKXA 5JPMB 5HOOA 3DFGA 4M9XA 1S7AA 3GFMA 3K2AA 5FRNA 1ETOA 3PM1A 3WE3A 1Y0UA 1W0UA 1YHQI 5KCMA 4G9YA 3W3CA 1KGSA 1ON1A 2KIMA 4GO1A 3L2UA 2HU9A 2V6CA 1YX5A 3OIOA 4M3GA 1U78A 2QWWA 4M3EA 1D0ZA 1IRFA 5HLTA 3HM5A 2GXGA 2LOOA 5K7ZA 4FX4A 2E71A 4EM0B 2FXAA 2VODA 4CYCB 2LF7A 3WU2C 1UB9A 3K1NA 3ML6A 2EINH 1HW1A 5E17F 2XKOA 2ZNYA 4E4HA 4LOCA 2DOAA 3I4PA 3CMAI 1ZTRA 2F48A 2L9VA 3MZHA 1U8RA 1R5HA 4UY8I 1Z91A 4CGZA 1F1ZA 4HNTA 2EFWA 1KJSA 2DTRA 2H8RA 2AQFA 4FX0A 3FXRA 2E7XA 3M1EA 2RVCA 3K70D 5CYVA 3KP7A 2CFXA 5EZHA 3F8FA 4M72A 2OJED 5DTDA 4W1UA 1YS6A 2A5YB 5TJJA 4JX6A 4I6OA 3T1BA 2W1OA 2F5VA 1ZYRF 1IXRC 4J00A 4Y52J 1S7EA 3MN2A 2QM3A 2Y9YA 1RI7A 2L9SA 2GA1A 1IRXA 1VQ9I 2HTSA 3IWFA 2OA4A 4EJVA 5ICCA 3GTMJ 2FA5A 3M9AA 3JSOA 1GT0C 1T08B 3OY9A 2Y9ZA 4EM2A 5JVTA 2ESHA 2W25A 1MNDA 4UXNA 1VQ7I 4OIOF 3FM3A 2A6HF 2CQQA 3M3YJ 3B6CA 3EETA 4FE7A 1Q1VA 4BEHA 2BHYA 5LHIA 3QU3A 1NTCA 3J81K 3KIOA 2ZJPF 3M07A 5DM6F 3CO7C 4XOTA 4HNUA 4MGRA 1RRJA 5HS8A 4W97A 3NAUA 3MQ0A 1Y8RB 2XRNA 2NRAC 1JGGA 2KIQA 5IYDJ 1TWFJ 2E1MB 3JRDA 4BY1J 2CH0A 3HL2A 3MFKA 1P7JA 1YYVA 2XB0X 2VBYA 3ZMDA 2QQBA 1WWXA 1EJ9A 2IA2A 2VBWA 3S2DJ 2OV7A 1JHFA 1D5VA 2G7UA 3P9KA 3H35A 5GTIC 1NH3A 3OYKA 1DPUA 4I01A 2EWNA 3JRBA 3TDUC 4BUPA 1RUOA 1WZ2A 2GIZA 1RPWA 1UCRA 5M3FJ 3VYSB 3TKYA 1KU7A 2BVLA 4HBLA 2DT5A 1X3UA 3SFIA 1HC8A 4CSWA 3ROUA 5E79C 1Y8QB 1CQTA 1K4SA 2WB1A 3BQZA 1D8JA 5H6RA 1G2HA 2R7TA 1M1EB 3HIFA 1EH8A 3W6JB 2DT6A 5E8GA 4HX8A 4N9HA 2DFFA 3S14J 2CJJA 3ABLH 5GP9A 1X3WB 1YJNI 4RMNA 2BYVE 2TCTA 1B1BA 3HUGB 2M8GX 2KISA 4XRSG 4AVZA 1FLIA 1KU9A 1UMQA 3JRFA 2DFEA 1FOYA 1HXDA 2IGOA 2WTEA 4JX5A 4KUMA 3QPHA 1ZARA 5LGNA 1DGRM 5K7FA 1IV6A 2QKMB 3OYFA 2L9RA 1ZH5A 1FEXA 2IGKA 4M6XA 1T38A 1YW8A 1R71A 1Y56A 3HSRA 1YRNA 1TT0A 2RV8A 1J09A 4JYKA 4S0HB 2H1LA 2W00A 2Y0SA 3P9CA 3L2WA 2MGQA 2EFQA 3LFKA 3A4CA 3HUGA 4BQNA 2KJBA 1C5AA 3J81Z 3LA7A 1ITYA 4IO9F 3RYPA 3TO9A 1TWAJ 4CCOA 1TL8A 2M7BA 2FU4A 4CZCA 1JI8A 1YO5C 1MMAA 2VBXA 3WGGA 1ZGAA 2O0YA 4B8XA 5JVGF 3HRUA 4BYYA 1O3TA 2BEOA 3DEWA 2LDUA 2H09A 1Z67A 1S72I 2DPUA 3NARA 1K6OA 2IRFG 3TW6A 4E70A 3ZGKA 3I53A 4U0WA 1IDZA 2X4HA 3DKYA 1VFCA 2EZKA 2LF8A 3U1DA 3VB2A 1O57A 3RSNA 1QU3A 2XRLA 1IJWC 4DBRA 2EZHA 5IP9J 4HG2A 1G59A 1X1BA 3PO2J 2IA0A 3QWLA 3OR1C 4G12A 3ISPA 5J6XA 4P9FA 2JMWA 2E1NA 2RC4A 2I10A 3L2CA 3FK6A 1MBHA 2K27A 5LLQA 1MDMB 2VOPA 3IH4A 3SFZA 4L9TA 5BQTA 3IRQA 4DZPA 4IKFA 2JSPA 1B4AA 3C3WA 2IW5A 3NEUA 2HDWA 2PMHA 4ENMA 4UNOA 3JRAA 2FE3A 4RAFA 2RQQA 1WJ5A 4GDFA 2M34A 2EH3A 4UVAA 2YU3A 1IN4A 4YELA 2HFHA 1SFEA 3ZN1A 1MMNA 3HB9A 2BXZA 4JK1X 3DBHB 4RBOA 1ETXA 1R22A 4L9NA 5L3EA 1I6XA 2ZC2A 2ZXJA 4PJMA 5DDGA 3F21A 2E7WA 4ZTJA 3GXOA 3OV8A 1XSXA 2BY3A 3HOUJ 3PSIA 5EEGA 2DOEA 2DBBA 1WCMJ 2DA6A 4JP0A 4CCKA 4E7KA 4MEYF 3HPGA 4BHCA 2BBYA 3L7WA 4KJZA 3A02A 4U87A 1FJLA 3GZNB 3OYHA 3HXLA 3VYTB 3CCJI 3OSGA 3JRIA 1FPQA 2IVMA 5IP6A 1ZR4A 3K10A 4BQAA 3H0GJ 4Y17A 3M7GA 3W2VA 4QPOA 2BV6A 4A3EJ 2R3SA 2P8TA 4WXCA 2I8DA 2BZTA 3FHNA 3LSMA 3SHFA 2XDVA 2LKSA 4CUGA 1J9IA 1E3PA 1P7IA 5EJCA 2R7WA 3CCVI 2VC0A 4IEJA 3TDZC 3TP0A 4I6ZA 1BW5A 3I59B 2ETHA 4H0EA 1BJAA 1DQUA 2JTVA 4NQWB 5B3SH 4PFOA 4FT8A 5HLIA 3LSJA 2GXBA 1SAXA 2F4MB 4M6VA 3GTOJ 2P6SA 2QF7A 2M1BA 2XB5A 2YR2A 3WU0A 2VC1A 3AFHA 3L00A 5GTHC 1O3QA 1FMVA 2JZYA 2VBZA 1J0RA 4A2UA 5FFZA 1BIAA 4LG0B 4P3AA 3FZVA 1LDKB 1SFOJ 2Z99A 1P4WA 1T0FC 1OPCA 1HSTA 2VT3A 2FF4A 2R7QA 3I59A 4G6TB 3I5UA 2XUBA 2ZSHB 3CLQA 1WVRA 3DV8A 4CCLA 2X0LA 2LBFA 2ZJQF 1ACIA 3G1MA 2QCOA 3BJOA 1JGSA 4QPQA 1FSEA 1TW2A 2KIUA 5M3MJ 4WWCA 5TGTA 1JUSA 3MZ8A 4BQQA 1VQ5I 2W48A 3KP2A 5J4YA 3RZOJ 3KLSA 3JTHA 2WADA 2FJ1A 4P55A 3HSFA 3DPUA 2X48A 3CJRB 3K1PA 1WRJA 1E3HA 3BROA 1Y39A 4PGHA 5K5QA 2NNYA 1W36C 5FLXK 3OYEA 1FIAA 3PIPF 3O3KA 3R0AA 4HX7A 4ZTFA 2L01A 3J7YJ 4WB3A 4XLAA 3JAMK 3RQIA 3TO7A 1QBJA 2PLYA 4XN0A 3PUFA 2YX7A 2EIKH 2RREA 5IT3A 2PMZN 1VQMI 5FD6A 2F2EA 3E3VA 4RGSA 3K9TA 3TL4X 1R4NB 2DMPA 5DD8A 3A2KA 3D5SC 1GV5A 5HDGA 4FCYA 1H8AC 4A3CJ 1FTZA 3ABKH 2MW8A 1XG1A 2A05A 1T2KA 3QOEA 4BXUA 2WAEA 3RCOA 3CCLI 2M30A 3GW2A 3ERED 3NQOA 4PJJA 3ECOA 2MD0A 3NWTA 2P4WA 2V1NA 4KIFA 4LK0F 2LFBA 3BTLA 1NHAA 2Q1ZB 2VKVA 3T8TA 4HQMA 2QQ9A 3E5UA 1ZKGA 2WY8Q 4PJ0C 3S3OA 4M71A 2XSDC 2HQRA 3OS0A 3LOCA 3AAFA 4E7ZA 4A3BJ 1IO2A 1OR7C 3K6GA 1YI2I 3ECHA 1X1PA 2W84A 3BC8A 5H6QA 2DMQA 2BY1A 1TTYA 3SYTA 3MKLA 3H1CA 1OCOH 2F5EA 4EEFG 3CCMI 5F0CA 2EA4A 3BTCA 2GZWA 1BN5A 2VL8A 1SAUA 1RNLA 4FXGB 1TC3C 4B09A 3IL2A 3L09A 3KZIC 3OYNA 2KPMA 2HEOA 1T95A 3ZPLA 4A69C 1C0WA 4UUTA 2E5ZA 4V19K 2R7VA 3S8PA 4BNCA 1UHSA 4ASNA 1T6SA 1HOMA 1LJ9A 4I2OA 3SDGA 2CQXA 2ACJA 2G7HA 3DLAA 3KYDB 4H4KC 2EV5A 4XONA 5DEQA 4B43A 1GLNA 3VSKA 2IS4A 5L3GA 2L9NA 4TV7A 1NK2P 2R7RA 1Z3XA 2OUMA 1D3YA 1XTAA 1VI0A 2QYOA 2RNJA 4BGDA 2L5QA 3COAC 3HEFA 3AL0C 3HQBA 1P4XA 1WQ2A 5B5EC 3VPRA 4Z6YA 1B6AA 2R5ZB 1R5ID 2F5DA 5FO5A 1PJRA 5LHHA 4DJAA 3JAMZ 1U5TA 4A6EA 2DXIA 2ELKA 2VXDA 4PSWA 3F6OA 4A5MA 2A73B 2KZGA 2DA4A 1JT6A 1PVEA 4L9VA 5HS9A 3I58A 4MQ9F 1ZGWA 3CUOA 3ZOBA 1BR4A 3M1CA 2CW8A 2QZ8A 4BH9A 9ANTA 3EUHC 3PIOF 3N05A 1MBFA 3FXMA 4HDVA 2COBA 2YU9J 2KDOA 2W82A 4RB3C 3HKZA 1QNTA 1TWCJ 4ANJA 4FQGA 5LFAA 5TRDA 5DS9A 1PP7U 2IS6A 1X4OA 5DUIA 1MBJA 2L7KA 4PJLA 4WF2A 1YFHA 4C2MJ 6PAXA 1LDJA 2VKEA 1TQIA 1MNMC 2JA5J 2E60A 1IXSB 3DTKA 3R4KA 4B3XA 3CCEI 2DLLA 1BC7C 1G3SA 1WKMA 2JJ7A 4XN3A 1F43A 3ZMUA 2V79A 3C2BA 2HDCA 1J5YA 1T39A 3HYIA 2HYGD 4Y13A 2O61A 3EUAA 2R7FA 1VQ6I 4RGXA 3G1OA 3E6DA 5CVRA 5EGOA 3ZR8X 2V1XA 3H36A 1SD4A 3FMQA 4DBQA 1I1SA 5GAHJ 1K83J 1D1CA 2JVHA 2Y31A 1EH6A 3J80K 1IAWA 3QODA 4YIRX 3WTTC 4M74A 2ZMEB 1O7FA 4C2UA 1DU0A 3CLOA 3D1NI 2YS9A 1A35A 1XN7A 4BHPA 1B8IB 4ZZLA 2ESNA 2LG4A 2LRDA 3OYDA 1Z6RA 1G3WA 1Z05A 2Y48A 4HOBA 4ZYHA 3WTSC 3TO6A 2V7FA 2ZJRF 2VLAA 3RQ4A 1SD6A 5D8LB 4AD9A 2OD5A 3DKWA 1SMYF 1H0MA 1HF0A 2AQEA 4RAZA 3RDIA 4PSXA 3K0LA 1H9GA 2KRHA 4XL9A 5HNHA 3SJMA 4PFPA 1ZG3A 5J47A 2KMUA 2JK3A 5ICGA 4O3MA 2P5KA 1USSA 3RZDJ 3BG7A 2KP6A 1A6QA 4BKXA 1B8IA 4IHXA 2VB6A 1IGNA 3DKXA 1A04A 5E3LA 5HODA 2ZFUA 1QA6A 1XMKA 1RR7A 1QRYA 3IUOA 1FTTA 2PFBA 1K4TA 2DODA 5CQEA 2K9LA 3KEQA 3SZPA 3P7NA 1OCTC 3CJTB 2HDDA 2DJIA 1P2FA 1ETVA 5J4VA 1B72B 5GPCA 1J2XA 3UKGA 3SZGA 4E7SA 3OYJA 1TP4A 2ZXHA 2MSYA 3SXYA 1VZ0A 2BW3B 4HV5A 2DDAA 3I4MJ 1L3LA 2M4KA 2F6CA 4MLOA 2XGXA 2KRFA 2O7OA 4FISA 1MSEC 4C3HJ 5LEJA 2K4BA 5K5RA 2JVGA 5D5UB 2FQ3A 2WWYA 2YX4A 3H3UA 1W5SA 5JLWA 2NVQJ 1I3QJ 2MC4A 2CRGA 4KMUX 1HKTA 4UVCA 1SC7A 1JKQC 3J80Z 3KLOA 4E7HA 2VJ5A 3FXKA 2QBYA 4A0YA 2IJLA 3E6MA 2QUFA 3G2BA 1PP8F 2BW3A 5M5YJ 3TQNA 3KLNA 3WG7H 2K9MA 5K7HA 2GLOA 2ZKZA 4A3IJ 4BXXJ 2JA2A 3V7CA 1XGMA 3H3ZA 1R1UA 4XLPF 3CF5F 4GYGA 4D7NA 2VE8A 3FWEA 4RDUA 3S1QJ 4Q4ZF 3LAJA 3ABTA 5ICEA 1JE8A 1YJ9I 1IN5A 5BS6A 2JRTA 2DTZA 4CCJA 4KIBA 2JA6J 2H8WA 4KISA 3DEEA 3OMYA 2IS1A 1GVJA 3WTYC 2AO9A 1XDUA 1K78A 1MMSA 1KQ8A 4OIRF 1V5FA 2GM4A 3KYLA 2P5LC 1XSVA 3WTZA 3H92A 3E5QA 1R1VA 3PNVA 4HSRA 3U21A 4LLGF 2NYXA 2X6OA 3EDPA 3VSLA 4CICA 3HBLA 5C3EJ 1BL0A 2QQAA 2CWEA 5J1UA 1Z3YA 4EATA 4RAGA 1S8NA 4A3FJ 2LY2A 3K4LA 4M3BA 3BR6A 3HOWJ 4RAYA 1MJ9A 3LMMA 3PFYA 4LJZF 4EGYA 1Z1DA 2STWA 3S17J 1R7JA 3P5JA 1BIBA 1Y1VJ 4WX9A 4A3KJ 3BCAA 4BACA 1ETYA 4BEHB 5EDNA 3F8CA 1V5EA 2EFOA 1UHWA 2CUZA 4RLFA 1APLC 1G3TA 5TISC 4U88A 1RESA 1FBUA 1LVKA 5ILUA 5J40A 1GHCA 5M5XJ 4LLNA 1FC3A 1A6IA 4HZFA 1GVDA 1Q1HA 5JPNB 1PDNC 3GZ5A 1A31A 4OMZA 1J75A 5HLHA 4N4OB 4JX4A 2GAUA 2GBYA 1JUMA 4XRFA 3KETA 1IUYA 3CQZJ 1BJZA 2MYSA 2EILH 2F4IA 4UB8C 1IZ1A 1OCCH 2PG4A 3HGYA 5F1JA 2NAZA 1JTXA 4PJNA 3MZYA 1R23A 5BNGA 3M8FA 4S05A 2MH2A 4OAYA 3B02A 4AVPA 1FMWA 5J1RA 2HI3A 3CDIA 1MH3A 3DF8A 2H27A 4IHTA 1Y0NA 1H88C 3AKZA 2EBIA 1SVOA 2LVSA 3FHZA 5BPDA 4NDLA 3CP8A 2PBIA 2DU9A 1ETKA 2M0CA 4PDKA 4A0XA 1HDDC 3TW7A 4A12A 2MLKA 3ZQIA 1TQMA 2JRMA 2M87A 4CHUA 2QVOA 4UU9C 5JI6A 4YFKF 2Z33A 1Z21A 4XLEA 1N78A 3KP4A 3FF5A 4IHYA 1LFPA 2EIMH 1LEAA 2HGCA 1CF7B 1ZHFA 1MH4A 1G3YA 1X19A 3B6AA 2A69F 3LSIA 3W2WA 3N97A 3BQYA 3QAHA 4ZYGA 1YRNB 2LTPA 2L02A 1ZG1A 2X9DA 3CESA 2X51A 2L54A 5ED4A 4ZH4F 2EV0A 4WK8F 1KQ9A 2Y0MA 3CCRI 1MMDA 2MG4A 2RDPA 3C2HA 3V4GA 4XKBA 2H6CA 5K1YA 1BM9A 4XORA 3GUDA 4EMSA 3QOPA 1KONA 3KP3A 4RGUA 1CF7A 3MKWB 2JWTA 2CUFA 4F93B 3I55I 5DD4A 1XGSA 2LSOA 2XAQA 3QU6A 5C4JJ 2XC7A 3I4NJ 1WH7A 1QVUA 5E1WA 2L3DA 4XNFA 1MBKA 2XASA 2MFZA 2M5WA 3CC7I 4XRSA 2KQRA 2XPWA 1XMXA 3S1MJ 5FKOA 3AG1H 3E5XA 4ENJA 2FRHA 3GTKJ 5LHGA 2CS3A 1S29A 2NS0A 2G0EA 2FOKA 1T0FA 2QENA 2O9LA 2A6EF 1VQ8I 2EIJH 2HKOA 3PL8A 2VKHA 1P9QC 2TDXA 2XPUA 4A3MJ 3A01B 1Z6TA 3DBRB 4AUXA 1BW6A 2HZTA 2WV1A 2Z1DA 1FNNA 1F9NA 4NNJA 3R6SA 3DPLC 4V2FA 2CGPA 4IRGA 1ZN2A 3S16J 4YFNF 3IAS2 2VUMJ 5EG0A 2CFOA 4AYBA 4I99C 1POGA 1MIJA 2PI0A 3TP3A 1PUFA 1I39A 5F64A 3WHBA 4Q48A 1EV7A 1X4PA 3PFIA 5AIPA 3RIRA 4J01A 1HCRA 3IH3A 3BPVA 3A01A 1ZRFA 5GPAA 2BY0A 3RPQA 3N4MA 1YITI 3BDDA 2RKHA 4RB0A 2UXNA 3FXUA 2EQRA 1N77A 1XX5A 3HKZN 2QLZA 3L9FA 2JPBA 3IAM2 4JQFA 3HDDA 1JUPA 1T56A 1QHGA 2ICWG 1N75A 1V55H 4AIHA 1Z7LA 4A3GJ 1ONVA 2DJNA 2VQCA 5LRSA 2NVTJ 4GGGA 3BTJA 2O03A 5LRRA 1BA5A 2K5CA 1IV8A 3R60A 4WXHA 3ULQB 3ZMZA 2VN2A 3E97A 2MC3A 4G7OF 1DDNA 2XKPA 2NVXJ 4Q47A 2D5VA 1PUEE 3HOSA 2B63J 3QP5A 4F3QA 4MTEA 3ZQCA 2HOSA 1OLTA 1TLHB 2DMNA 3SEZA 2DAOA 4JBAA 4UHTA 4E7JA 2ISZA 4BBSJ 1LKXA 1V3FA 1HSJA 1OR7A 5E18F 3VFZA 3KZYA 5BPIA 5FKKA 2DMUA 5DM7F 4JOMA 1YG2A 4NB5A 4CDGA 2B39A 1FP2A 2E1MC 2E2HJ 4CO8A 2V9VA 4D1QA 2MBFA 4LB5A 3V8LA 2P5VA 5B1AH 1B9NA 3DP7A 2Z9OA 3D5LA 3MWMA 3HOYJ 2CQNA 2WAQN 3FMSA 1TQPA 4YG2F 5BMZA 3GEZA 4DYQA 4M9ZA 5FD5A 1LQ1A 2A6TA 1IN8A 1USTA 1X58A 2LBFB 2K40A 1TWHJ 1UJ8A 2Y75A 3PJRA 1TNTA 3F0CA 1ZG5A 1FOXA 2JSCA 3AG4H 2CG4A 4YIFA 3E7LA 3S3MA 5E3NA 2IPQX 1FP1D 1HKSA 1OISA 1XSDA 5JLXA 4QTRA 5D6EA 4ITVA 4F55A 2DCEA 1R5GA 2G9WA 1E0EA 1SVLA 1WI3A 5CLSA 4B48A 3S93A 2O3FA 4I76A 3VODA 1BBYA 1WHUA 3M4OJ 4HWJA 3DLLF 2LYCA 2HS5A 3CF2A 3PQJA 4XLHA 2XPVA 3X2QH 1E3OC 2LKXA 2XF7A 2VXZA 2JQ7A 4M9SA 2EPFA 3I0TA 1Z0XA 4UUSB 1JTYA 3BOQA 4EJWA 3Q0VA 4BE0A 3KE2A 3EUHA 3Q0WA 5ICFA 4L0YB 4XIDA 3KP6A 2GOXB 2XAGA 1U0JA 4LK1F 5M5WJ 2K85A 3OS2A 3M8JA 1KYZA 2VASA 1ZRCA 5FKLA 1H89C 1DU6A 4N0BA 3OWTA 2QSFX 3H9QA 1DUXC 3L2VA 2DA5A 3BR2A 4MTDA 2XV4S 4IRIA 5KNLA 3LSGA 3BR3A 4XQFA 2IA1A 1RIOH 1O3RA 4U7DA 2MLGA 4KT6A 1W4MA 5KAIC 1ERDA 2K3PA 4UUSA 2UUZA 4LIVA 4NC8A 1XCVA 1IN7A 1U2WA 1XDSA 2GIVA 3I64A 5EEAA 1W36D 2XROA 3K4NA 3BWGA 4HAMA 1OYIA 1QPIA 1MMGA 1UAAA 4ENKA 3JRCA 4IQ4A 2Z5UA 2YPRA 1KQ0A 2DA7A 3CP2A 4BU2A 5EF6A 5FB2A 4N9IA 3BG6A 4FE4A 3U9GA 4IHWA 1IG7A 2N8GA 3D5RC 3R0JA 2LLKA 4BAYA 3KPHA 5JHFA 1OYYA 3GMEA 2DQRA 3HQAA 1SFKA 2P6TA 5D4SA 4NC7A 3EQLF 1ON2A 2LY9A 4BS9A 1OCZH 3BG5A 3KFWX 5HDNA 4HRIA 3H3VK 4UV8A 5GADJ 3H9JA 2J5PA 2VOOA 1YLFA 1E17A 4E6KG 2B7EA 4LGWA 3DPTA 2IGMA 3DWLE 1TZLA 3Q0UA 1MW7A 1FY7A 2DFHA 3TOAA 3HZJA 3OYBA 1ZELA 2FEZA 1UG0A 4ENNA 5B4PB 2OC6A 4IJAA 3K4KA 4DIQA 2K02A 2VIXA 1U5TB 1ETQA 1P92A 4D0PA 2XAFA 2M4GA 4ZJZA 5L3FA 3F22A 3CU7A 1JJ8C 3F9KA 1STZA 2UWMA 3FISA 2RQPA 2CV0A 1R6RA 3LWFA 1D5YA 3W6VA 3RTRA 2E2IJ 2HWVA 3DTEA 4CYDA 4XR6A 3JW4A 2R92J 1VNDA 2MD5A 2ME6A 3IH2A 4EM1A 2TRTA 2ZXWH 2RNGA 3LSTA 5HS7A 1FOWA 1UZCA 4C30A 4NUBA 2XGDA 2RGVA 5CJ9A 4A0ZA 3ZQGA 1LFUP 1JKRC 4MNUA 2AS5F 3LAPA 3HSEA 1DP3A 3BT9A 2CQ7A 5EYRA 5JFRA 1H9TA 3MKZA 2PJPA 4AIDA 3FIWA 3LQQA 1BI3A 5D6FA 2HXIA 3EYIA 4IPAA 3DBLB 5KVRA 3ZMTA 3FXLA 1FWZA 4HSTA 1ZLJA 4DGWB 4HW0A 4Y15A 1ZGJA 4AC0A 2MABA 1WJBA 3BY6A 3GYHX 5EGOB 2Q2EB 3NWSA 4ZYAA 3E6BA 2E35A 2Z2SB 3EPZA 1IRGA 5F1RA 2E34A 1D1AA 1B59A 4AIKA 3V7SA 4G94A 2UZKA 5GAGJ 3OOPA 1WPKA 3ZMSA 3ZN0A 1WJDA 3LL7A 4MO7A 1SANA 2VQLA 3DQVC 3L2RA 3K4MA 3IP4B 3T0YA 4F92B 4XM3A 4EQQA 2JA8J 3QPTA 2OQRA 4IXAA 2XAJA 4XLNF 1S5LC 2FD5A 3G73A 4MIMA 1Z9CA 1BOBA 3F8BA 2Z3YA 4D7MA 3JREA 2O8KA 2Q2EA 3ZP5A 3LA3A 2ME0A 2HPIA 2KDZA 2E1CA 1XC5A 4LFUA 1FIPA 4IHSA 2IEKA 3KEOA 4L0ZB 3HOZJ 3UR3C 4PUSA 2EB7A 2JPCA 3OSFA 5A2QK 3PSFA 4DW6A 2R93J 5E20A 1X1CA 2WB1N 4XRMA 2R0QC 3LSPA 2DA2A 4RGRA 3K2ZA 4EVIA 2OBPA 2PJRA 1UELB 3B73A 5IOZA 4DYCA 2GOMA 2NVYJ 4GYIA 1JT0A 3A03A 4MFEA 2E5NA 1WFXA 1QGPA 2L4AA 4QIWN 1QPMA 1ZREA 3K4BA 4HV6A 1ORKA 4D9JA 2HQNA 4ESBA 3CDLA 2EK5A 2QKLB 3PNTA 4U7BA 3GX4X 5J8FA 2A68F 2GXAA 4CCMA 1LDDA 4HNVA 5HVQC 2CMPA 3GFJA 3GO5A 5BOXA 4KMFA 3MAJA 2STTA 5FFXA 3J7AO 2LH9A 4BQOA 2HNHA 3HHHA 3GLLA 2R7UA 1R36A 2M7AA 2VPRA 2Y0SN 2B9SA 2DYRH 3ASNH 3HG9A 1NK3P 1CFAA 3NRVA 3QPSA 4ESJA 3TEDA 2XIGA 4ABZA 5IPAA 1LEBA 4M73A 2XF6A 3QYEA 5L3CA 1JXSA 1S9HA 2ID6A 2DA1A 1LE8A 3H9GA 2XAUA 4OOIA 3GTLJ 4CA0A 2LK2A 3HC7A 4Y33A 3JR9A 4KFCA 1ZR2A 1SD7A 4Y4RA 1YW7A 4RA2A 1BI0A 5KHDA 5ILVA 2V1DA 4IOAF 4O6JA 2QBYB 2EZLA 2HZDA 2ZSIB 3A0HC 5F08A 1I27A 1W7PA 4QSHA 4EJOA 2FSWA 3OL4A 3CO6C 3O2PE 4A3LJ 2DK8A 4O5VA 3CUQA 1QO0D 3V8KA 2CUEA 1VQLI 2GA2A 1TBXA 2HVRA 2OPTA 1GUUA 1UFMA 3A1YA 3LSKA 3HOTA 2VJ4A 1UHMA 3Q9SA 2RAEA 2Y69H 4AYBN 4BL0B 3H0DA 1OFCX 2BE5F 2COMA 5A2QZ 2PMUA 4G6QA 1F4KA 4I02A 3LSHA 1K78B 1MBGA 4R1HA 1KA8A 1REPC 1WJFA 5H2FC 4OIPF 3F8NA 4II3A 4GRIA 1AOYA 2W4SA 3JCUC 2W57A 3MKYB 2CSOA 3LNQA 4A93J 5DCMA 4DOZA 1FOKA 2PMZA 4I0AA 1T8IA 3BJAA 4KDPA 3E0JB 3VWBA 1WI9A 2IP2A 2KLOA 1ZLKA 4II2A 4P3BA 2CU7A 1I50J 2JUCA 4HPQA 4XBFA 5L3BA 2E19A 1G8XA 4MQVA 3CC4I 1MJBA 2AXLA 2FQ4A 2LY1A 4I09A 4LITA 2P7CB 5F27A 1U3EM 2XSJC 3CTAA 5C44J 3BZKA 3OYCA 2K9SA 2FMYA 3QPLA 2FNAA 1JKOC 1OQYA 1S6LA 2IAIA 2VI6A 4B1RA 1BR1A 2ZBKA 1QVTA 3DEUA 1YIOA 1K7AA 1VF9A 3C2GA 1I1GA 1T33A 1HW5A 2Z16A 4RS8A 4LB6B 5IYCJ 2AHQA 2Y2ZA 2KL4A 1BC8C 5FGMA 4ZDPA 3ONQA 4FXKB 2ZXIA 2O8XA 1S3JA 2DT7B 1MJAA 2OZ6A 3ZRGA 2HOAA 3K70C 1I6HJ 2PN6A 2O5RA 1VQNI 2R5YB 4CH7A 3OIPA 4C3JJ 3GTJJ 2HR3A 2YSRA 1XPXA 1VQOI 3BP8A 4UUVA 1E2XA 2E2JJ 3HRSA 3FMRA 3RPUD 3WGIA 1FYMA 1AA7A 2A07F 2KRCA 4OU0A 5CPRB 4HW5A 2JT1A 1R9TJ 3V42A 3GTQJ 1R1TA 3V8JA 2F4OB 2ZMEC 2F5CA 2R7DA 4YIIA 2ZB9A 3DU6A 5AIQA 2A5WA 4CYCA 3CCYA 4NBQA 3S15J 1K61A 1K6YA 2R5YA 1IC8A 1SFXA 2YUSA 3V7RA 5JR3A 3AG3H 2OTJI 4XKWA 1QZYA 4ZYDA 2LNBA 2DFIA 4MHGA 2P7VB 4IF4A 1FBSA 3HRTA 3OYLA 5IOYA 3ZQHA 3CUQC 4BXFA 2IBDA 4L9JA 1Z7UA 3BR1A 4BJ5C 4EGZA 3OIQA 3GFLA 3CJQB 1A36A 2X6WA 1NG7A 5E8IA 2MA3A 2OTLI 4BE2A 1W7PD 2WAFA 2OCCH 3I54A 3RI4A 4RM2A 4IL6C 2ECBA 3HRMA 4EV0A 5FRMA 2EFPA 2FNPA 1A5JA 3JRGA 5K5OA 4L5EA 1OYWA 1O3SA 2X1DA 5HDKA 2L4MA 3DXJF 3OR2C 3OYAA 2FBHA 2CV2A 1VQKI 3BG3A 3SZTA 2XGEA 3MMYB 1XB4A 1YW9A 1X1DA 3ZQFA 4G6DA 4CZZA 3H5RA 4ZYEA 5JHUA 1HW2A 3LSRA 5E1ZB 2ZFWA 1CGPA 4QLCU 4HEA2 4BHBA 2FBKA 3IWZA 1K79A 3CMEI 3GWZA 2H1KA 3M8EA 2CV1A 2HQAA 1ZQ3P 1W0TA 2OQGA 1G4DA 1IUFA 2CQKA 3W6KB 3W2AA 4G7ZF 2VE9A 4FHTA 2DI3A 3WHCA 3L2QA 2EZIA 2VQGA 2M9HA 3CCSI 4A3DJ 1RUNA 1U6GA 5CQGA 3CMMA 2QA4I 4HF2A 2R4GA 2P0WA 2VJJA 5F0HA 1KU2A 1BI2A 5DCFA 4R8HA 3O8GA 3CJNA 1KYWA 3OL3A 2XHKA 4HDUA 5LGUA 1B9MA 5FJ8J 1QHHD 2Y30A 3WU1B 1FZPB 2GWRA 2BHZA 1YS7A 2KZVA 2DW4A 3KX2A 4Y3OA 1G6NA 4L5IA 2DPDA 4NC6A 1R58A 3BCBA 3EUKL 2JA7J 5EG0B 2E1OA 2E36A 4BDZA 1Z77A 3LA2A 1LFBA 1F36A 3PNYA 4N4NB 1PUFB 2CYYA 1FSHA 2NXNB 2LC2A 2IGNA 2ID3A 4DZJA 3IV5A 4WB2A 4ZDLA 2KJCA 4XKCA 2K7LA 3PQKA 1FX7A 1OJLA 3S2WA 5C4XJ 4OIQF 3ZMVA 5HNFA 3SQNA 2IS2A 2DMTA 4LD5A 4GFBA 4A3JJ 2PQ8A 1DP7P 3GZ6A 1RR8C 4IRHA 1WGXA 2W85A 3BTIA 1ZK8A 4X0GA 1GXQA 3WTXC 1MSFC 2V26A 5F6FA 2X6YA 2WC2A 3HPHA 3R61A 4B4CA 2KFDA 5L3DA 2H94A 4YEJA 2HOTA 1HDPA 2HVSA 4DYRA 1J59A 4EJTA 3VEPA 3RKQA 1IXCA 3S3NA 1F5TA 4KNYA 3RKWA 2C6YA 2X6XA 4I98B 4C3IJ 4LG3A 1SMTA 4KITB 1GXPA 2QSHX 1JKPC 1MD0A 1X2NA 1YJWI 3GBGA 3OOUA 1GDTA 2VONA 3ELKA 4KN4X 1HLVA 1W5CC 3FBNB 3FXQA 3JSPA 2L0KA 4RB1A 5IY5H 3CC2I 5KK1A 1SD5A 2LD5A 2X1CA 2A3SA 3WG9A 3MD2A 2VPLA 2VJIA 3ABMH 1XCBA 2NNNA 1P4AA 1R00A 2JN6A 1FT9A 4C9YA 1XMAA 3CMYA 3ERMA 2DK5A 3RYRA 1T98A 3K1MA 3ZQQA 2WV0A 2JUGA 3ZQ7A 4OMYA 4IZZA 3Q3SA 5ERIA 3GLXA 1WJAA 4RB2C 1RETA 1MBEA 2LP0A 2KHMA 4V2GA 1LUJB 3C1DA 4XLFA 1MDMA 2K4JA 3HTSB 2DO7A 1AWCA 4E7IA 3TMOA 3AL0B 5CVUA 2VKDA 3RKXA 2AXTC 3BJ6A 3CDHA 3S1RJ 1LPQA 1U8BA 3H5AA 4KN7X 4XKVA 5FLMJ 5DYMA 1R49A 3HOXJ 3K4JA 4NHJA 2R7ZJ 1AU7A 3JRHA 3D0SA 3A0BC 3S1NJ 2CUJA 5E3OA 3SEQA 3C18A 4G7HF 3F8MA 3IKTA 2LREA 4D5FA 1VTNC 4FTHA 1RKTA 1W5TA 4WCGA 1P6RA 4B3AA 4EJUA 2HYJA 3Q5FA 1YIJI 2LR8A 2X85A 1DGWY 3S2HJ 2ZCWA 1FYLA 4AU7A 4Q5SF 4HLYA 1TW3A 3OYIA 2L7MP 3KP5A 5D5WB 4ETSA 4E7LA 2DA3A 4XMYA 4S04A 2NS8A 5LD2C 3BPXA 2ZO4A 4LIUA 4BBRJ 3DU5A 2WY7Q 1V54H 2R7OA 1LVAA 3C7JA 2EFNA 3ASOH 4P39A 2VT2A 3OYMA 1SFUA 4BE1A 3BG9A 4UVBA 5D5XB 3CZ6A 1EKEA 3GTGJ 1WJEA 4ZC3A 3H5NA 4HA8A 3BR0A 1YOVB 4NQWA 4Y7NJ 1TNSA 5EEHA 1MNEA 4WXDA 2NOJB 1J7KA 5IP7J 3GTPJ 5FROA 3AG2H 1X3ZB 2NOGA 1ULYA 1D1BA 4RM3A 2VQHA 5IT9K 3T5XA 3TGNA 2L7ZA 2M8EA 1EA3A 3WTWC 1LB2A 2LKPA 1QZZA 2QGUA 1L0OC 1BOAA 1OCRH 4I7HA 5D5VB 4MFDA 2L2OA 3FX3A 2DOFA 5B66C 4BDYA 1U9NA 4LG0A 3FBIB 2IXSA 2OAZA 3QYBA 3QP6A 4A5NA 1FYKA 5LEKA 1I3AA 2K3FA 1I5ZA 2CO5A 1IDYA 3FK7A 2DQLA
chains in the Genus database with same CATH topology
2QKLB 3PNTA 4HG2A 1G59A 4U7BA 1X1BA 3OR1C 4N4OB 4CCMA 5HVQC 2CMPA 1YE9A 3J7AY 2MYSA 1NG6A 2LH9A 4BJ6C 4BQOA 2F4IA 2HNHA 2R7UA 2M7AA 4IKFA 4PJNA 3HG9A 2JSPA 4ZDOA 4B47A 2HDWA 4OAYA 1FMWA 2XF6A 3QYEA 1S9HA 2RQQA 3VYRB 1WJ5A 3H9GA 4YELA 2XAUA 1MMNA 4CA0A 3HC7A 3AKZA 4Y33A 4PJMA 3CP8A 3ZCOA 4RLQA 4Y4RA 5KHDA 4ZTJA 2HZDA 2ZSIB 3PSIA 2V6EA 3OL4A 2ELJA 4CCKA 4E7KA 3HPGA 4KJZA 1Z21A 4BJTA 4XLEA 4U87A 1N78A 3OYHA 3HXLA 3VYTB 4FASD 2HVRA 1LFPA 3LSKA 3A1YA 3HOTA 2V4JC 2VJ4A 4B44A 3LFUA 3K10A 3W2VA 1X19A 4BL0B 4QPOA 3LSIA 3W2WA 3H0DA 2I8DA 3FHNA 3LSMA 3LSHA 3CESA 2X51A 2XDVA 4CUGA 4F91B 1WJFA 2R7WA 4II3A 4GRIA 3S32A 2W4SA 3MKYB 1DQUA 4NQWB 4IX7A 1MMDA 4PFOA 4DOZA 2PMZA 3OS1A 2M3AA 3C2HA 3E0JB 3VWBA 2HPMA 4XKBA 2KLOA 4XORA 1YX3A 4II2A 3QYFA 1Y6IA 1KONA 2WA0A 4HPQA 1G8XA 3MKWB 3I9V2 3UNGC 3AFHA 4F93B 1FMVA 4C2TA 3VYUB 4XLCA 2LY1A 4LITA 4P1WA 4R79A 1LDKB 2PJRB 1T0FC 2XC7A 2FUG2 2XSJC 2R7QA 4G6TB 3OYCA 4XNFA 2MFZA 2ZSHB 3E1SA 2KQRA 4CCLA 3OYGA 2LBFA 1BR1A 1X1AA 4QPQA 3C2GA 1D0YA 1D0XA 2CS3A 2BVMA 2Z16A 5TGTA 2KL4A 4BQQA 1HA8A 3BLYA 4ZDPA 2WADA 3ONQA 2ZXIA 3DPUA 3CJRB 2DT7B 3ZRGA 3PL8A 2VKHA 3K70C 1P9QC 1W36C 3OYEA 2O5RA 4ZTFA 3PUBA 4CH7A 3OIPA 4XOPA 3FDYA 4XLAA 3ZXSA 4XN0A 2Z1DA 4NNJA 2WBMA 2RREA 3DPLC 3RPUD 2HVQA 2R7XA 3TL4X 1AA7A 1V5GA 2KRCA 3I3LA 2BOLA 3A2KA 3D5SC 3IAS2 5CPRB 3SDBA 3KEYA 3V42A 2CFOA 4AYBA 2W7NA 5CKTA 4YRVA 3DU6A 2A5WA 3QOEA 1X4PA 2WAEA 3RCOA 2XF5A 4J01A 1K6YA 2WAQA 4CCNA 4PJJA 3TBIA 2MD0A 3NWTA 2V1NA 1N77A 2R7SA 2Q1ZB 4XKWA 3IAM2 4JQFA 1QHGA 2WY8Q 1N75A 3S3OA 3OYLA 4F52A 3OS0A 1Z7LA 2VQCA 4E7ZA 4BXFA 1OR7C 3K6GA 3BC8A 3SYTA 2K5CA 4BJ5C 4PK4A 3OIQA 4IQJA 3CJQB 2X6WA 1NG7A 4P5OA 2VL8A 3HOSA 4BE2A 4F3QA 1SAUA 2WAFA 4FXGB 1OLTA 4RM2A 3SEZA 4OWRB 5FRMA 4E7JA 1PYVA 2V9KA 3OYNA 2KPMA 1LKXA 1T95A 2X1DA 2E5ZA 2R7VA 3OR2C 3S8PA 3OYAA 2CV2A 2X1EA 4FETA 4JOMA 3MMYB 4OAZA 3DLAA 4H4KC 4XONA 4B43A 1GLNA 1X1DA 3VSKA 2IS4A 3H5RA 2E1MC 2L9NA 4D1QA 2R7RA 1Z3XA 2OUMA 3FKJA 4HEA2 4BGDA 2L5QA 3D5LA 3AL0C 3K4CA 2CV1A 2HQAA 2CW7A 2A6TA 1PJRA 4DJAA 2LBFB 3VDXA 2DXIA 2VXDA 3W2AA 4PSWA 3PJRA 3L2QA 2VQGA 3S3MA 1BR2A 5CQGA 3CMMA 1WJCA 2R4GA 2P0WA 2M0MA 2UV1A 3DTIA 1BR4A 2VJJA 2CW8A 3M1CA 2DCEA 4ITVA 4F55A 5JPMB 3EUHC 5HOOA 3N05A 1E0EA 4B48A 3S93A 5FRNA 2KDOA 3OL3A 2W82A 3HKZA 2LYCA 5KCMA 4ANJA 3CF2A 5LFAA 4XLHA 2IS6A 1X4OA 1QHHD 3W3CA 2L7KA 4PJLA 2XF7A 2VXZA 3L2UA 2HU9A 2KZVA 1YX5A 3KX2A 4Y3OA 2E60A 1D0ZA 3BCBA 3DTKA 3EUKL 5HLTA 2LOOA 4B3XA 4BE0A 4BDZA 3PNYA 4XN3A 4N4NB 2GOXB 2LC2A 1U0JA 2IGNA 3EUAA 3OS2A 3M8JA 2VASA 4ZDLA 4XKCA 3OWTA 3H9QA 3ZR8X 3L2VA 4E4HA 4DBQA 2DOAA 5KNLA 3LSGA 1D1CA 2JVHA 4XQFA 5HNFA 2IS2A 3QODA 4KT6A 4C2UA 4HNTA 1ERDA 2AQFA 2K3PA 2UUZA 4LIVA 4NC8A 4X0GA 3K70D 2V26A 1W36D 3K4NA 2X6YA 2LRDA 2LG4A 3OYDA 1MMGA 1UAAA 3HPHA 4YEJA 4IQ4A 2HVSA 2V7FA 2VLAA 3RQ4A 2W1OA 2F5VA 3CP2A 3S3NA 4BU2A 4J00A 2AQEA 2X6XA 3BG6A 2L9SA 1IRXA 4LG3A 4PSXA 4KITB 2KRHA 4XL9A 3D5RC 5HNHA 3GBGA 3OOUA 4PFPA 5JHFA 3OY9A 2KMUA 1MNDA 1SFKA 3FBNB 4NC7A 3BG7A 2KP6A 4BS9A 4HRIA 2X1CA 2VB6A 3MD2A 3DKXA 2VPLA 2VJIA 3H9JA 4BEHA 4E6KG 2ZFUA 3DPTA 2IGMA 3DWLE 1TZLA 4C9YA 3IUOA 1MW7A 4XOTA 4HNUA 3OYBA 5CQEA 2K9LA 1ZELA 1UG0A 2OC6A 3K4KA 3ZQQA 4DIQA 2VIXA 2JUGA 4IZZA 2E1MB 2CH0A 2DJIA 3HL2A 2M4GA 1WJAA 4ZJZA 3F9KA 2KHMA 4XLFA 2UWMA 3SZGA 4E7SA 3OYJA 4E7IA 3TMOA 2CV0A 1R6RA 3AL0B 2OV7A 2ZXHA 1VZ0A 2VKDA 2BW3B 3RTRA 3H35A 3DTEA 3H5AA 4XKVA 2M4KA 2F6CA 4MLOA 4XR6A 3OYKA 3K4JA 2RNGA 4BUPA 4C30A 2JVGA 4NUBA 3VYSB 2CUJA 2BVLA 3SEQA 2MC4A 2LREA 4CSWA 1DP3A 4E7HA 2VJ5A 3MKZA 2WB1A 2R7TA 2X85A 1DGWY 2DT6A 3G2BA 4AU7A 2BW3A 4HSTA 2K9MA 4DGWB 2MABA 4RMNA 3OYIA 2JA2A 1WJBA 3HUGB 2Q2EB 3NWSA 4ZYAA 4AVZA 3EPZA 2Z2SB 4E7LA 2IGOA 4XMYA 1D1AA 1DGRM 2QKMB 4CCJA 5LD2C 3OYFA 4LIUA 3DU5A 2WY7Q 4KISA 3DEEA 2IGKA 3OMYA 1WJDA 2R7OA 3LL7A 2IS1A 2VQLA 3DQVC 3L2RA 1Y56A 3K4MA 3IP4B 4F92B 3OYMA 4XM3A 1TT0A 4BE1A 3CZ6A 1J09A 2W00A 2Y0SA 1WJEA 3L2WA 1V5FA 4ZC3A 1BOBA 3H5NA 3KYLA 3A4CA 4BQNA 1MNEA 2NOJB 3PNVA 4HSRA 5FROA 2HPIA 3U21A 1D1BA 4CCOA 4RM3A 2VQHA 2M7BA 3UR3C 4CZCA 4PUSA 3VSLA 1EA3A 3PSFA 1JI8A 1Z3YA 4EATA 1MMAA 2LY2A 3K4LA 1X1CA 3LMMA 3PFYA 2L2OA 4BDYA 3BCAA 3FBIB 4BACA 2PJRA 1UELB 2IXSA 4BEHB 3QYBA 2GOMA 1V5EA 3ZGKA 2CUZA 4RLFA 2E5NA 1WFXA 3DKYA 1LVKA 1QU3A 3K4BA 4D9JA 3RSNA 4DBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ4 A;  1AA7 A;  5CQE A;  4PUS A;  2Z16 A;  1EA3 A;  3MD2 A;  3VDX A;  4D9J A;  4ITV A; 
#chains in the Genus database with same CATH topology
 2D1V A;  4HYE A;  3P9I A;  3RJP A;  4D5C A;  1XS9 A;  4M3D A;  4KA4 A;  1YE9 A;  3J7A Y;  3HTU A;  4PCQ A;  4K2E A;  4XK4 A;  1NG6 A;  4BJ6 C;  1OMI A;  4L5J A;  3GF2 A;  1BI1 A;  4M3F A;  3CCQ I;  3MVP A;  2QSG X;  4ZDO A;  4IVN A;  4B47 A;  2OU2 A;  1AKH B;  2KKO A;  3G71 I;  3VYR B;  2KIF A;  2BXY A;  3BZC A;  2EV6 A;  3EYY A;  5F04 A;  1R4M B;  4OIN F;  1KU3 A;  4X1E A;  3F3X A;  5J8C A;  3ZCO A;  4RLQ A;  1IF1 A;  3MCZ A;  1W1W E;  2MH9 A;  4G8X A;  1HQC A;  3F23 A;  1EH7 A;  3QRF F;  1HKQ A;  3LQR A;  2H6B A;  2V6E A;  3WE2 A;  4P9U A;  4ESF A;  1LNW A;  3K69 A;  2ELJ A;  1IN6 A;  1FBQ A;  5DV5 A;  2F5F A;  2OCE A;  1AKH A;  4CXF A;  1VQ4 I;  5ILS A;  1KZH A;  2I5U A;  4BJT A;  3RKY A;  1ZRD A;  1O4X A;  2A61 A;  4FAS D;  3T8R A;  2DYS H;  3Q9V A;  3PO3 J;  2OF7 A;  2V4J C;  1QZE A;  2LMD A;  4B44 A;  3LFU A;  3G6E I;  4MEX F;  4YFX F;  5GAE J;  1OKR A;  5IT9 Z;  4M6Y A;  4Z2Y A;  4HF1 A;  4AIJ A;  4F91 B;  2XGC A;  3HOV J;  4ZZD A;  1HBX G;  3ESW B;  4ON0 A;  5FLX Z;  3S32 A;  1O7L A;  4IX7 A;  4DQ2 A;  1X2M A;  3OS1 A;  2M3A A;  1Y1W J;  3QQA A;  2HPM A;  5E1X A;  1YX3 A;  2CW0 F;  1Y6I A;  3QYF A;  4GXO A;  3IRR A;  3E6C C;  5D8K B;  2WA0 A;  3BZ6 A;  2XVC A;  5F0F A;  4XSX F;  3I9V 2;  2D2W A;  2DDB A;  3G3Z A;  2P81 A;  3G4S I;  3UNG C;  2EA2 A;  4C2T A;  3CD6 I;  3VYU B;  3HJE A;  2ECC A;  3MEX A;  4XLC A;  2M45 A;  3I56 I;  4P1W A;  4R79 A;  2PJR B;  2FUG 2;  1YQA A;  1QQI A;  1U9O A;  4KIG A;  1RZ4 A;  3G1L A;  4PZJ A;  2R5Z A;  3E1S A;  2FOW A;  3OYG A;  2HTJ A;  2J5O A;  1X1A A;  2V9P A;  5J1Y A;  2NVU B;  1D0Y A;  1D0X A;  2BVM A;  2PEX A;  1HA8 A;  5FLV A;  1GV2 A;  4HF0 A;  3BLY A;  2K9Q A;  2HOE A;  3O8H A;  1EF4 A;  1JJ6 C;  2XAH A;  4BY7 J;  1MZB A;  3KZZ A;  1SVM A;  5CVJ A;  2QEX I;  3GVA A;  3GFI A;  2ZJ2 A;  3PUB A;  4XOP A;  5CVI A;  3FDY A;  5B1B H;  1ZAO A;  1S7O A;  3ZXS A;  3ZQL A;  5J3L A;  4AWX B;  2WBM A;  2ADU A;  1WH5 A;  2W24 A;  3WGH A;  3VOE A;  3I71 A;  3RPU A;  2GQQ A;  2HVQ A;  2R7X A;  1LE8 B;  1TWG J;  1V5G A;  3U2R A;  3I3L A;  2BOL A;  3SDB A;  5D4R A;  1ENH A;  1WSU A;  4U0V A;  3KEY A;  5CVV A;  5IYB J;  3FKI J;  2W7N A;  5CKT A;  2B0L A;  5KAF C;  4LMY A;  4P96 A;  4YRV A;  1D8K A;  3FM5 A;  2ISY A;  2PX9 A;  2Q0O A;  2KT0 A;  2UXX A;  2XF5 A;  3FXJ A;  3TOB A;  1W7P B;  3IHU A;  5AON A;  2WAQ A;  1MGT A;  4CCN A;  3TBI A;  5HLG A;  2R7S A;  4F7Z A;  1DPR A;  3J7Z I;  3WOD F;  2D1H A;  3U1K A;  4IOC F;  2Q8K A;  3CUQ B;  1VQP I;  5FKN A;  1AHD P;  4UV9 A;  5DUK A;  4KT5 C;  4X6A J;  2ZME A;  4F52 A;  3F6V A;  2D45 A;  3ABU A;  4A6D A;  5LGT A;  1XD7 A;  4AM3 A;  3HGG A;  4PK4 A;  4UB6 C;  4LLL A;  1V4R A;  3K7A J;  4IQJ A;  5E3M A;  4P5O A;  1YTY A;  1IW7 F;  5LBQ A;  2DN0 A;  4DNC A;  3O6B B;  3CCU I;  3F72 A;  2FX0 A;  2HYF A;  4HQE A;  4OWR B;  1PYV A;  5DCM B;  1ETW A;  2V9K A;  2FBI A;  3KCC A;  2BGC A;  2QQ8 A;  4U0Y A;  3HHG A;  2EJR A;  5FKM A;  2ELH A;  1ODD A;  1SEU A;  2X1E A;  4J19 A;  1XGO A;  4FET A;  2HQ5 A;  2M2E A;  3REO A;  4OAZ A;  1U5T C;  3JTG A;  2V1U A;  4HX4 A;  4QWQ A;  3BR5 A;  1UG2 A;  1TT5 B;  2ZNZ A;  1N25 A;  4KIC A;  4PGG A;  3FKJ A;  3IC7 A;  1JHH A;  5H20 A;  1OCP A;  1XGN A;  3KYC B;  4L18 B;  2L7F P;  1IRZ A;  3K4C A;  2OZU A;  4KYW A;  4XIC A;  3FXO A;  1RKW A;  2CW7 A;  3WTV C;  4GCV A;  2FML A;  2O6G E;  3VDX A;  2NS7 A;  3DCF A;  2RN7 A;  3GCM A;  5EZG A;  4IHV A;  2BY2 A;  1B72 A;  2IT0 A;  2HXO A;  1BR2 A;  1MKM A;  1RC9 A;  2K86 A;  2K9N A;  4XSZ F;  1WJC A;  3WTU C;  3IKV A;  3L1P A;  4I0B A;  2M0M A;  2UV1 A;  3DTI A;  4HLX A;  2HKX A;  5JPM B;  5HOO A;  3DFG A;  4M9X A;  1S7A A;  3GFM A;  3K2A A;  5FRN A;  1ETO A;  3PM1 A;  3WE3 A;  1Y0U A;  1W0U A;  1YHQ I;  5KCM A;  4G9Y A;  3W3C A;  1KGS A;  1ON1 A;  2KIM A;  4GO1 A;  3L2U A;  2HU9 A;  2V6C A;  1YX5 A;  3OIO A;  4M3G A;  1U78 A;  2QWW A;  4M3E A;  1D0Z A;  1IRF A;  5HLT A;  3HM5 A;  2GXG A;  2LOO A;  5K7Z A;  4FX4 A;  2E71 A;  4EM0 B;  2FXA A;  2VOD A;  4CYC B;  2LF7 A;  3WU2 C;  1UB9 A;  3K1N A;  3ML6 A;  2EIN H;  1HW1 A;  5E17 F;  2XKO A;  2ZNY A;  4E4H A;  4LOC A;  2DOA A;  3I4P A;  3CMA I;  1ZTR A;  2F48 A;  2L9V A;  3MZH A;  1U8R A;  1R5H A;  4UY8 I;  1Z91 A;  4CGZ A;  1F1Z A;  4HNT A;  2EFW A;  1KJS A;  2DTR A;  2H8R A;  2AQF A;  4FX0 A;  3FXR A;  2E7X A;  3M1E A;  2RVC A;  3K70 D;  5CYV A;  3KP7 A;  2CFX A;  5EZH A;  3F8F A;  4M72 A;  2OJE D;  5DTD A;  4W1U A;  1YS6 A;  2A5Y B;  5TJJ A;  4JX6 A;  4I6O A;  3T1B A;  2W1O A;  2F5V A;  1ZYR F;  1IXR C;  4J00 A;  4Y52 J;  1S7E A;  3MN2 A;  2QM3 A;  2Y9Y A;  1RI7 A;  2L9S A;  2GA1 A;  1IRX A;  1VQ9 I;  2HTS A;  3IWF A;  2OA4 A;  4EJV A;  5ICC A;  3GTM J;  2FA5 A;  3M9A A;  3JSO A;  1GT0 C;  1T08 B;  3OY9 A;  2Y9Z A;  4EM2 A;  5JVT A;  2ESH A;  2W25 A;  1MND A;  4UXN A;  1VQ7 I;  4OIO F;  3FM3 A;  2A6H F;  2CQQ A;  3M3Y J;  3B6C A;  3EET A;  4FE7 A;  1Q1V A;  4BEH A;  2BHY A;  5LHI A;  3QU3 A;  1NTC A;  3J81 K;  3KIO A;  2ZJP F;  3M07 A;  5DM6 F;  3CO7 C;  4XOT A;  4HNU A;  4MGR A;  1RRJ A;  5HS8 A;  4W97 A;  3NAU A;  3MQ0 A;  1Y8R B;  2XRN A;  2NRA C;  1JGG A;  2KIQ A;  5IYD J;  1TWF J;  2E1M B;  3JRD A;  4BY1 J;  2CH0 A;  3HL2 A;  3MFK A;  1P7J A;  1YYV A;  2XB0 X;  2VBY A;  3ZMD A;  2QQB A;  1WWX A;  1EJ9 A;  2IA2 A;  2VBW A;  3S2D J;  2OV7 A;  1JHF A;  1D5V A;  2G7U A;  3P9K A;  3H35 A;  5GTI C;  1NH3 A;  3OYK A;  1DPU A;  4I01 A;  2EWN A;  3JRB A;  3TDU C;  4BUP A;  1RUO A;  1WZ2 A;  2GIZ A;  1RPW A;  1UCR A;  5M3F J;  3VYS B;  3TKY A;  1KU7 A;  2BVL A;  4HBL A;  2DT5 A;  1X3U A;  3SFI A;  1HC8 A;  4CSW A;  3ROU A;  5E79 C;  1Y8Q B;  1CQT A;  1K4S A;  2WB1 A;  3BQZ A;  1D8J A;  5H6R A;  1G2H A;  2R7T A;  1M1E B;  3HIF A;  1EH8 A;  3W6J B;  2DT6 A;  5E8G A;  4HX8 A;  4N9H A;  2DFF A;  3S14 J;  2CJJ A;  3ABL H;  5GP9 A;  1X3W B;  1YJN I;  4RMN A;  2BYV E;  2TCT A;  1B1B A;  3HUG B;  2M8G X;  2KIS A;  4XRS G;  4AVZ A;  1FLI A;  1KU9 A;  1UMQ A;  3JRF A;  2DFE A;  1FOY A;  1HXD A;  2IGO A;  2WTE A;  4JX5 A;  4KUM A;  3QPH A;  1ZAR A;  5LGN A;  1DGR M;  5K7F A;  1IV6 A;  2QKM B;  3OYF A;  2L9R A;  1ZH5 A;  1FEX A;  2IGK A;  4M6X A;  1T38 A;  1YW8 A;  1R71 A;  1Y56 A;  3HSR A;  1YRN A;  1TT0 A;  2RV8 A;  1J09 A;  4JYK A;  4S0H B;  2H1L A;  2W00 A;  2Y0S A;  3P9C A;  3L2W A;  2MGQ A;  2EFQ A;  3LFK A;  3A4C A;  3HUG A;  4BQN A;  2KJB A;  1C5A A;  3J81 Z;  3LA7 A;  1ITY A;  4IO9 F;  3RYP A;  3TO9 A;  1TWA J;  4CCO A;  1TL8 A;  2M7B A;  2FU4 A;  4CZC A;  1JI8 A;  1YO5 C;  1MMA A;  2VBX A;  3WGG A;  1ZGA A;  2O0Y A;  4B8X A;  5JVG F;  3HRU A;  4BYY A;  1O3T A;  2BEO A;  3DEW A;  2LDU A;  2H09 A;  1Z67 A;  1S72 I;  2DPU A;  3NAR A;  1K6O A;  2IRF G;  3TW6 A;  4E70 A;  3ZGK A;  3I53 A;  4U0W A;  1IDZ A;  2X4H A;  3DKY A;  1VFC A;  2EZK A;  2LF8 A;  3U1D A;  3VB2 A;  1O57 A;  3RSN A;  1QU3 A;  2XRL A;  1IJW C;  4DBR A;  2EZH A;  5IP9 J;  4HG2 A;  1G59 A;  1X1B A;  3PO2 J;  2IA0 A;  3QWL A;  3OR1 C;  4G12 A;  3ISP A;  5J6X A;  4P9F A;  2JMW A;  2E1N A;  2RC4 A;  2I10 A;  3L2C A;  3FK6 A;  1MBH A;  2K27 A;  5LLQ A;  1MDM B;  2VOP A;  3IH4 A;  3SFZ A;  4L9T A;  5BQT A;  3IRQ A;  4DZP A;  4IKF A;  2JSP A;  1B4A A;  3C3W A;  2IW5 A;  3NEU A;  2HDW A;  2PMH A;  4ENM A;  4UNO A;  3JRA A;  2FE3 A;  4RAF A;  2RQQ A;  1WJ5 A;  4GDF A;  2M34 A;  2EH3 A;  4UVA A;  2YU3 A;  1IN4 A;  4YEL A;  2HFH A;  1SFE A;  3ZN1 A;  1MMN A;  3HB9 A;  2BXZ A;  4JK1 X;  3DBH B;  4RBO A;  1ETX A;  1R22 A;  4L9N A;  5L3E A;  1I6X A;  2ZC2 A;  2ZXJ A;  4PJM A;  5DDG A;  3F21 A;  2E7W A;  4ZTJ A;  3GXO A;  3OV8 A;  1XSX A;  2BY3 A;  3HOU J;  3PSI A;  5EEG A;  2DOE A;  2DBB A;  1WCM J;  2DA6 A;  4JP0 A;  4CCK A;  4E7K A;  4MEY F;  3HPG A;  4BHC A;  2BBY A;  3L7W A;  4KJZ A;  3A02 A;  4U87 A;  1FJL A;  3GZN B;  3OYH A;  3HXL A;  3VYT B;  3CCJ I;  3OSG A;  3JRI A;  1FPQ A;  2IVM A;  5IP6 A;  1ZR4 A;  3K10 A;  4BQA A;  3H0G J;  4Y17 A;  3M7G A;  3W2V A;  4QPO A;  2BV6 A;  4A3E J;  2R3S A;  2P8T A;  4WXC A;  2I8D A;  2BZT A;  3FHN A;  3LSM A;  3SHF A;  2XDV A;  2LKS A;  4CUG A;  1J9I A;  1E3P A;  1P7I A;  5EJC A;  2R7W A;  3CCV I;  2VC0 A;  4IEJ A;  3TDZ C;  3TP0 A;  4I6Z A;  1BW5 A;  3I59 B;  2ETH A;  4H0E A;  1BJA A;  1DQU A;  2JTV A;  4NQW B;  5B3S H;  4PFO A;  4FT8 A;  5HLI A;  3LSJ A;  2GXB A;  1SAX A;  2F4M B;  4M6V A;  3GTO J;  2P6S A;  2QF7 A;  2M1B A;  2XB5 A;  2YR2 A;  3WU0 A;  2VC1 A;  3AFH A;  3L00 A;  5GTH C;  1O3Q A;  1FMV A;  2JZY A;  2VBZ A;  1J0R A;  4A2U A;  5FFZ A;  1BIA A;  4LG0 B;  4P3A A;  3FZV A;  1LDK B;  1SFO J;  2Z99 A;  1P4W A;  1T0F C;  1OPC A;  1HST A;  2VT3 A;  2FF4 A;  2R7Q A;  3I59 A;  4G6T B;  3I5U A;  2XUB A;  2ZSH B;  3CLQ A;  1WVR A;  3DV8 A;  4CCL A;  2X0L A;  2LBF A;  2ZJQ F;  1ACI A;  3G1M A;  2QCO A;  3BJO A;  1JGS A;  4QPQ A;  1FSE A;  1TW2 A;  2KIU A;  5M3M J;  4WWC A;  5TGT A;  1JUS A;  3MZ8 A;  4BQQ A;  1VQ5 I;  2W48 A;  3KP2 A;  5J4Y A;  3RZO J;  3KLS A;  3JTH A;  2WAD A;  2FJ1 A;  4P55 A;  3HSF A;  3DPU A;  2X48 A;  3CJR B;  3K1P A;  1WRJ A;  1E3H A;  3BRO A;  1Y39 A;  4PGH A;  5K5Q A;  2NNY A;  1W36 C;  5FLX K;  3OYE A;  1FIA A;  3PIP F;  3O3K A;  3R0A A;  4HX7 A;  4ZTF A;  2L01 A;  3J7Y J;  4WB3 A;  4XLA A;  3JAM K;  3RQI A;  3TO7 A;  1QBJ A;  2PLY A;  4XN0 A;  3PUF A;  2YX7 A;  2EIK H;  2RRE A;  5IT3 A;  2PMZ N;  1VQM I;  5FD6 A;  2F2E A;  3E3V A;  4RGS A;  3K9T A;  3TL4 X;  1R4N B;  2DMP A;  5DD8 A;  3A2K A;  3D5S C;  1GV5 A;  5HDG A;  4FCY A;  1H8A C;  4A3C J;  1FTZ A;  3ABK H;  2MW8 A;  1XG1 A;  2A05 A;  1T2K A;  3QOE A;  4BXU A;  2WAE A;  3RCO A;  3CCL I;  2M30 A;  3GW2 A;  3ERE D;  3NQO A;  4PJJ A;  3ECO A;  2MD0 A;  3NWT A;  2P4W A;  2V1N A;  4KIF A;  4LK0 F;  2LFB A;  3BTL A;  1NHA A;  2Q1Z B;  2VKV A;  3T8T A;  4HQM A;  2QQ9 A;  3E5U A;  1ZKG A;  2WY8 Q;  4PJ0 C;  3S3O A;  4M71 A;  2XSD C;  2HQR A;  3OS0 A;  3LOC A;  3AAF A;  4E7Z A;  4A3B J;  1IO2 A;  1OR7 C;  3K6G A;  1YI2 I;  3ECH A;  1X1P A;  2W84 A;  3BC8 A;  5H6Q A;  2DMQ A;  2BY1 A;  1TTY A;  3SYT A;  3MKL A;  3H1C A;  1OCO H;  2F5E A;  4EEF G;  3CCM I;  5F0C A;  2EA4 A;  3BTC A;  2GZW A;  1BN5 A;  2VL8 A;  1SAU A;  1RNL A;  4FXG B;  1TC3 C;  4B09 A;  3IL2 A;  3L09 A;  3KZI C;  3OYN A;  2KPM A;  2HEO A;  1T95 A;  3ZPL A;  4A69 C;  1C0W A;  4UUT A;  2E5Z A;  4V19 K;  2R7V A;  3S8P A;  4BNC A;  1UHS A;  4ASN A;  1T6S A;  1HOM A;  1LJ9 A;  4I2O A;  3SDG A;  2CQX A;  2ACJ A;  2G7H A;  3DLA A;  3KYD B;  4H4K C;  2EV5 A;  4XON A;  5DEQ A;  4B43 A;  1GLN A;  3VSK A;  2IS4 A;  5L3G A;  2L9N A;  4TV7 A;  1NK2 P;  2R7R A;  1Z3X A;  2OUM A;  1D3Y A;  1XTA A;  1VI0 A;  2QYO A;  2RNJ A;  4BGD A;  2L5Q A;  3COA C;  3HEF A;  3AL0 C;  3HQB A;  1P4X A;  1WQ2 A;  5B5E C;  3VPR A;  4Z6Y A;  1B6A A;  2R5Z B;  1R5I D;  2F5D A;  5FO5 A;  1PJR A;  5LHH A;  4DJA A;  3JAM Z;  1U5T A;  4A6E A;  2DXI A;  2ELK A;  2VXD A;  4PSW A;  3F6O A;  4A5M A;  2A73 B;  2KZG A;  2DA4 A;  1JT6 A;  1PVE A;  4L9V A;  5HS9 A;  3I58 A;  4MQ9 F;  1ZGW A;  3CUO A;  3ZOB A;  1BR4 A;  3M1C A;  2CW8 A;  2QZ8 A;  4BH9 A;  9ANT A;  3EUH C;  3PIO F;  3N05 A;  1MBF A;  3FXM A;  4HDV A;  2COB A;  2YU9 J;  2KDO A;  2W82 A;  4RB3 C;  3HKZ A;  1QNT A;  1TWC J;  4ANJ A;  4FQG A;  5LFA A;  5TRD A;  5DS9 A;  1PP7 U;  2IS6 A;  1X4O A;  5DUI A;  1MBJ A;  2L7K A;  4PJL A;  4WF2 A;  1YFH A;  4C2M J;  6PAX A;  1LDJ A;  2VKE A;  1TQI A;  1MNM C;  2JA5 J;  2E60 A;  1IXS B;  3DTK A;  3R4K A;  4B3X A;  3CCE I;  2DLL A;  1BC7 C;  1G3S A;  1WKM A;  2JJ7 A;  4XN3 A;  1F43 A;  3ZMU A;  2V79 A;  3C2B A;  2HDC A;  1J5Y A;  1T39 A;  3HYI A;  2HYG D;  4Y13 A;  2O61 A;  3EUA A;  2R7F A;  1VQ6 I;  4RGX A;  3G1O A;  3E6D A;  5CVR A;  5EGO A;  3ZR8 X;  2V1X A;  3H36 A;  1SD4 A;  3FMQ A;  4DBQ A;  1I1S A;  5GAH J;  1K83 J;  1D1C A;  2JVH A;  2Y31 A;  1EH6 A;  3J80 K;  1IAW A;  3QOD A;  4YIR X;  3WTT C;  4M74 A;  2ZME B;  1O7F A;  4C2U A;  1DU0 A;  3CLO A;  3D1N I;  2YS9 A;  1A35 A;  1XN7 A;  4BHP A;  1B8I B;  4ZZL A;  2ESN A;  2LG4 A;  2LRD A;  3OYD A;  1Z6R A;  1G3W A;  1Z05 A;  2Y48 A;  4HOB A;  4ZYH A;  3WTS C;  3TO6 A;  2V7F A;  2ZJR F;  2VLA A;  3RQ4 A;  1SD6 A;  5D8L B;  4AD9 A;  2OD5 A;  3DKW A;  1SMY F;  1H0M A;  1HF0 A;  2AQE A;  4RAZ A;  3RDI A;  4PSX A;  3K0L A;  1H9G A;  2KRH A;  4XL9 A;  5HNH A;  3SJM A;  4PFP A;  1ZG3 A;  5J47 A;  2KMU A;  2JK3 A;  5ICG A;  4O3M A;  2P5K A;  1USS A;  3RZD J;  3BG7 A;  2KP6 A;  1A6Q A;  4BKX A;  1B8I A;  4IHX A;  2VB6 A;  1IGN A;  3DKX A;  1A04 A;  5E3L A;  5HOD A;  2ZFU A;  1QA6 A;  1XMK A;  1RR7 A;  1QRY A;  3IUO A;  1FTT A;  2PFB A;  1K4T A;  2DOD A;  5CQE A;  2K9L A;  3KEQ A;  3SZP A;  3P7N A;  1OCT C;  3CJT B;  2HDD A;  2DJI A;  1P2F A;  1ETV A;  5J4V A;  1B72 B;  5GPC A;  1J2X A;  3UKG A;  3SZG A;  4E7S A;  3OYJ A;  1TP4 A;  2ZXH A;  2MSY A;  3SXY A;  1VZ0 A;  2BW3 B;  4HV5 A;  2DDA A;  3I4M J;  1L3L A;  2M4K A;  2F6C A;  4MLO A;  2XGX A;  2KRF A;  2O7O A;  4FIS A;  1MSE C;  4C3H J;  5LEJ A;  2K4B A;  5K5R A;  2JVG A;  5D5U B;  2FQ3 A;  2WWY A;  2YX4 A;  3H3U A;  1W5S A;  5JLW A;  2NVQ J;  1I3Q J;  2MC4 A;  2CRG A;  4KMU X;  1HKT A;  4UVC A;  1SC7 A;  1JKQ C;  3J80 Z;  3KLO A;  4E7H A;  2VJ5 A;  3FXK A;  2QBY A;  4A0Y A;  2IJL A;  3E6M A;  2QUF A;  3G2B A;  1PP8 F;  2BW3 A;  5M5Y J;  3TQN A;  3KLN A;  3WG7 H;  2K9M A;  5K7H A;  2GLO A;  2ZKZ A;  4A3I J;  4BXX J;  2JA2 A;  3V7C A;  1XGM A;  3H3Z A;  1R1U A;  4XLP F;  3CF5 F;  4GYG A;  4D7N A;  2VE8 A;  3FWE A;  4RDU A;  3S1Q J;  4Q4Z F;  3LAJ A;  3ABT A;  5ICE A;  1JE8 A;  1YJ9 I;  1IN5 A;  5BS6 A;  2JRT A;  2DTZ A;  4CCJ A;  4KIB A;  2JA6 J;  2H8W A;  4KIS A;  3DEE A;  3OMY A;  2IS1 A;  1GVJ A;  3WTY C;  2AO9 A;  1XDU A;  1K78 A;  1MMS A;  1KQ8 A;  4OIR F;  1V5F A;  2GM4 A;  3KYL A;  2P5L C;  1XSV A;  3WTZ A;  3H92 A;  3E5Q A;  1R1V A;  3PNV A;  4HSR A;  3U21 A;  4LLG F;  2NYX A;  2X6O A;  3EDP A;  3VSL A;  4CIC A;  3HBL A;  5C3E J;  1BL0 A;  2QQA A;  2CWE A;  5J1U A;  1Z3Y A;  4EAT A;  4RAG A;  1S8N A;  4A3F J;  2LY2 A;  3K4L A;  4M3B A;  3BR6 A;  3HOW J;  4RAY A;  1MJ9 A;  3LMM A;  3PFY A;  4LJZ F;  4EGY A;  1Z1D A;  2STW A;  3S17 J;  1R7J A;  3P5J A;  1BIB A;  1Y1V J;  4WX9 A;  4A3K J;  3BCA A;  4BAC A;  1ETY A;  4BEH B;  5EDN A;  3F8C A;  1V5E A;  2EFO A;  1UHW A;  2CUZ A;  4RLF A;  1APL C;  1G3T A;  5TIS C;  4U88 A;  1RES A;  1FBU A;  1LVK A;  5ILU A;  5J40 A;  1GHC A;  5M5X J;  4LLN A;  1FC3 A;  1A6I A;  4HZF A;  1GVD A;  1Q1H A;  5JPN B;  1PDN C;  3GZ5 A;  1A31 A;  4OMZ A;  1J75 A;  5HLH A;  4N4O B;  4JX4 A;  2GAU A;  2GBY A;  1JUM A;  4XRF A;  3KET A;  1IUY A;  3CQZ J;  1BJZ A;  2MYS A;  2EIL H;  2F4I A;  4UB8 C;  1IZ1 A;  1OCC H;  2PG4 A;  3HGY A;  5F1J A;  2NAZ A;  1JTX A;  4PJN A;  3MZY A;  1R23 A;  5BNG A;  3M8F A;  4S05 A;  2MH2 A;  4OAY A;  3B02 A;  4AVP A;  1FMW A;  5J1R A;  2HI3 A;  3CDI A;  1MH3 A;  3DF8 A;  2H27 A;  4IHT A;  1Y0N A;  1H88 C;  3AKZ A;  2EBI A;  1SVO A;  2LVS A;  3FHZ A;  5BPD A;  4NDL A;  3CP8 A;  2PBI A;  2DU9 A;  1ETK A;  2M0C A;  4PDK A;  4A0X A;  1HDD C;  3TW7 A;  4A12 A;  2MLK A;  3ZQI A;  1TQM A;  2JRM A;  2M87 A;  4CHU A;  2QVO A;  4UU9 C;  5JI6 A;  4YFK F;  2Z33 A;  1Z21 A;  4XLE A;  1N78 A;  3KP4 A;  3FF5 A;  4IHY A;  1LFP A;  2EIM H;  1LEA A;  2HGC A;  1CF7 B;  1ZHF A;  1MH4 A;  1G3Y A;  1X19 A;  3B6A A;  2A69 F;  3LSI A;  3W2W A;  3N97 A;  3BQY A;  3QAH A;  4ZYG A;  1YRN B;  2LTP A;  2L02 A;  1ZG1 A;  2X9D A;  3CES A;  2X51 A;  2L54 A;  5ED4 A;  4ZH4 F;  2EV0 A;  4WK8 F;  1KQ9 A;  2Y0M A;  3CCR I;  1MMD A;  2MG4 A;  2RDP A;  3C2H A;  3V4G A;  4XKB A;  2H6C A;  5K1Y A;  1BM9 A;  4XOR A;  3GUD A;  4EMS A;  3QOP A;  1KON A;  3KP3 A;  4RGU A;  1CF7 A;  3MKW B;  2JWT A;  2CUF A;  4F93 B;  3I55 I;  5DD4 A;  1XGS A;  2LSO A;  2XAQ A;  3QU6 A;  5C4J J;  2XC7 A;  3I4N J;  1WH7 A;  1QVU A;  5E1W A;  2L3D A;  4XNF A;  1MBK A;  2XAS A;  2MFZ A;  2M5W A;  3CC7 I;  4XRS A;  2KQR A;  2XPW A;  1XMX A;  3S1M J;  5FKO A;  3AG1 H;  3E5X A;  4ENJ A;  2FRH A;  3GTK J;  5LHG A;  2CS3 A;  1S29 A;  2NS0 A;  2G0E A;  2FOK A;  1T0F A;  2QEN A;  2O9L A;  2A6E F;  1VQ8 I;  2EIJ H;  2HKO A;  3PL8 A;  2VKH A;  1P9Q C;  2TDX A;  2XPU A;  4A3M J;  3A01 B;  1Z6T A;  3DBR B;  4AUX A;  1BW6 A;  2HZT A;  2WV1 A;  2Z1D A;  1FNN A;  1F9N A;  4NNJ A;  3R6S A;  3DPL C;  4V2F A;  2CGP A;  4IRG A;  1ZN2 A;  3S16 J;  4YFN F;  3IAS 2;  2VUM J;  5EG0 A;  2CFO A;  4AYB A;  4I99 C;  1POG A;  1MIJ A;  2PI0 A;  3TP3 A;  1PUF A;  1I39 A;  5F64 A;  3WHB A;  4Q48 A;  1EV7 A;  1X4P A;  3PFI A;  5AIP A;  3RIR A;  4J01 A;  1HCR A;  3IH3 A;  3BPV A;  3A01 A;  1ZRF A;  5GPA A;  2BY0 A;  3RPQ A;  3N4M A;  1YIT I;  3BDD A;  2RKH A;  4RB0 A;  2UXN A;  3FXU A;  2EQR A;  1N77 A;  1XX5 A;  3HKZ N;  2QLZ A;  3L9F A;  2JPB A;  3IAM 2;  4JQF A;  3HDD A;  1JUP A;  1T56 A;  1QHG A;  2ICW G;  1N75 A;  1V55 H;  4AIH A;  1Z7L A;  4A3G J;  1ONV A;  2DJN A;  2VQC A;  5LRS A;  2NVT J;  4GGG A;  3BTJ A;  2O03 A;  5LRR A;  1BA5 A;  2K5C A;  1IV8 A;  3R60 A;  4WXH A;  3ULQ B;  3ZMZ A;  2VN2 A;  3E97 A;  2MC3 A;  4G7O F;  1DDN A;  2XKP A;  2NVX J;  4Q47 A;  2D5V A;  1PUE E;  3HOS A;  2B63 J;  3QP5 A;  4F3Q A;  4MTE A;  3ZQC A;  2HOS A;  1OLT A;  1TLH B;  2DMN A;  3SEZ A;  2DAO A;  4JBA A;  4UHT A;  4E7J A;  2ISZ A;  4BBS J;  1LKX A;  1V3F A;  1HSJ A;  1OR7 A;  5E18 F;  3VFZ A;  3KZY A;  5BPI A;  5FKK A;  2DMU A;  5DM7 F;  4JOM A;  1YG2 A;  4NB5 A;  4CDG A;  2B39 A;  1FP2 A;  2E1M C;  2E2H J;  4CO8 A;  2V9V A;  4D1Q A;  2MBF A;  4LB5 A;  3V8L A;  2P5V A;  5B1A H;  1B9N A;  3DP7 A;  2Z9O A;  3D5L A;  3MWM A;  3HOY J;  2CQN A;  2WAQ N;  3FMS A;  1TQP A;  4YG2 F;  5BMZ A;  3GEZ A;  4DYQ A;  4M9Z A;  5FD5 A;  1LQ1 A;  2A6T A;  1IN8 A;  1UST A;  1X58 A;  2LBF B;  2K40 A;  1TWH J;  1UJ8 A;  2Y75 A;  3PJR A;  1TNT A;  3F0C A;  1ZG5 A;  1FOX A;  2JSC A;  3AG4 H;  2CG4 A;  4YIF A;  3E7L A;  3S3M A;  5E3N A;  2IPQ X;  1FP1 D;  1HKS A;  1OIS A;  1XSD A;  5JLX A;  4QTR A;  5D6E A;  4ITV A;  4F55 A;  2DCE A;  1R5G A;  2G9W A;  1E0E A;  1SVL A;  1WI3 A;  5CLS A;  4B48 A;  3S93 A;  2O3F A;  4I76 A;  3VOD A;  1BBY A;  1WHU A;  3M4O J;  4HWJ A;  3DLL F;  2LYC A;  2HS5 A;  3CF2 A;  3PQJ A;  4XLH A;  2XPV A;  3X2Q H;  1E3O C;  2LKX A;  2XF7 A;  2VXZ A;  2JQ7 A;  4M9S A;  2EPF A;  3I0T A;  1Z0X A;  4UUS B;  1JTY A;  3BOQ A;  4EJW A;  3Q0V A;  4BE0 A;  3KE2 A;  3EUH A;  3Q0W A;  5ICF A;  4L0Y B;  4XID A;  3KP6 A;  2GOX B;  2XAG A;  1U0J A;  4LK1 F;  5M5W J;  2K85 A;  3OS2 A;  3M8J A;  1KYZ A;  2VAS A;  1ZRC A;  5FKL A;  1H89 C;  1DU6 A;  4N0B A;  3OWT A;  2QSF X;  3H9Q A;  1DUX C;  3L2V A;  2DA5 A;  3BR2 A;  4MTD A;  2XV4 S;  4IRI A;  5KNL A;  3LSG A;  3BR3 A;  4XQF A;  2IA1 A;  1RIO H;  1O3R A;  4U7D A;  2MLG A;  4KT6 A;  1W4M A;  5KAI C;  1ERD A;  2K3P A;  4UUS A;  2UUZ A;  4LIV A;  4NC8 A;  1XCV A;  1IN7 A;  1U2W A;  1XDS A;  2GIV A;  3I64 A;  5EEA A;  1W36 D;  2XRO A;  3K4N A;  3BWG A;  4HAM A;  1OYI A;  1QPI A;  1MMG A;  1UAA A;  4ENK A;  3JRC A;  4IQ4 A;  2Z5U A;  2YPR A;  1KQ0 A;  2DA7 A;  3CP2 A;  4BU2 A;  5EF6 A;  5FB2 A;  4N9I A;  3BG6 A;  4FE4 A;  3U9G A;  4IHW A;  1IG7 A;  2N8G A;  3D5R C;  3R0J A;  2LLK A;  4BAY A;  3KPH A;  5JHF A;  1OYY A;  3GME A;  2DQR A;  3HQA A;  1SFK A;  2P6T A;  5D4S A;  4NC7 A;  3EQL F;  1ON2 A;  2LY9 A;  4BS9 A;  1OCZ H;  3BG5 A;  3KFW X;  5HDN A;  4HRI A;  3H3V K;  4UV8 A;  5GAD J;  3H9J A;  2J5P A;  2VOO A;  1YLF A;  1E17 A;  4E6K G;  2B7E A;  4LGW A;  3DPT A;  2IGM A;  3DWL E;  1TZL A;  3Q0U A;  1MW7 A;  1FY7 A;  2DFH A;  3TOA A;  3HZJ A;  3OYB A;  1ZEL A;  2FEZ A;  1UG0 A;  4ENN A;  5B4P B;  2OC6 A;  4IJA A;  3K4K A;  4DIQ A;  2K02 A;  2VIX A;  1U5T B;  1ETQ A;  1P92 A;  4D0P A;  2XAF A;  2M4G A;  4ZJZ A;  5L3F A;  3F22 A;  3CU7 A;  1JJ8 C;  3F9K A;  1STZ A;  2UWM A;  3FIS A;  2RQP A;  2CV0 A;  1R6R A;  3LWF A;  1D5Y A;  3W6V A;  3RTR A;  2E2I J;  2HWV A;  3DTE A;  4CYD A;  4XR6 A;  3JW4 A;  2R92 J;  1VND A;  2MD5 A;  2ME6 A;  3IH2 A;  4EM1 A;  2TRT A;  2ZXW H;  2RNG A;  3LST A;  5HS7 A;  1FOW A;  1UZC A;  4C30 A;  4NUB A;  2XGD A;  2RGV A;  5CJ9 A;  4A0Z A;  3ZQG A;  1LFU P;  1JKR C;  4MNU A;  2AS5 F;  3LAP A;  3HSE A;  1DP3 A;  3BT9 A;  2CQ7 A;  5EYR A;  5JFR A;  1H9T A;  3MKZ A;  2PJP A;  4AID A;  3FIW A;  3LQQ A;  1BI3 A;  5D6F A;  2HXI A;  3EYI A;  4IPA A;  3DBL B;  5KVR A;  3ZMT A;  3FXL A;  1FWZ A;  4HST A;  1ZLJ A;  4DGW B;  4HW0 A;  4Y15 A;  1ZGJ A;  4AC0 A;  2MAB A;  1WJB A;  3BY6 A;  3GYH X;  5EGO B;  2Q2E B;  3NWS A;  4ZYA A;  3E6B A;  2E35 A;  2Z2S B;  3EPZ A;  1IRG A;  5F1R A;  2E34 A;  1D1A A;  1B59 A;  4AIK A;  3V7S A;  4G94 A;  2UZK A;  5GAG J;  3OOP A;  1WPK A;  3ZMS A;  3ZN0 A;  1WJD A;  3LL7 A;  4MO7 A;  1SAN A;  2VQL A;  3DQV C;  3L2R A;  3K4M A;  3IP4 B;  3T0Y A;  4F92 B;  4XM3 A;  4EQQ A;  2JA8 J;  3QPT A;  2OQR A;  4IXA A;  2XAJ A;  4XLN F;  1S5L C;  2FD5 A;  3G73 A;  4MIM A;  1Z9C A;  1BOB A;  3F8B A;  2Z3Y A;  4D7M A;  3JRE A;  2O8K A;  2Q2E A;  3ZP5 A;  3LA3 A;  2ME0 A;  2HPI A;  2KDZ A;  2E1C A;  1XC5 A;  4LFU A;  1FIP A;  4IHS A;  2IEK A;  3KEO A;  4L0Z B;  3HOZ J;  3UR3 C;  4PUS A;  2EB7 A;  2JPC A;  3OSF A;  5A2Q K;  3PSF A;  4DW6 A;  2R93 J;  5E20 A;  1X1C A;  2WB1 N;  4XRM A;  2R0Q C;  3LSP A;  2DA2 A;  4RGR A;  3K2Z A;  4EVI A;  2OBP A;  2PJR A;  1UEL B;  3B73 A;  5IOZ A;  4DYC A;  2GOM A;  2NVY J;  4GYI A;  1JT0 A;  3A03 A;  4MFE A;  2E5N A;  1WFX A;  1QGP A;  2L4A A;  4QIW N;  1QPM A;  1ZRE A;  3K4B A;  4HV6 A;  1ORK A;  4D9J A;  2HQN A;  4ESB A;  3CDL A;  2EK5 A;  2QKL B;  3PNT A;  4U7B A;  3GX4 X;  5J8F A;  2A68 F;  2GXA A;  4CCM A;  1LDD A;  4HNV A;  5HVQ C;  2CMP A;  3GFJ A;  3GO5 A;  5BOX A;  4KMF A;  3MAJ A;  2STT A;  5FFX A;  3J7A O;  2LH9 A;  4BQO A;  2HNH A;  3HHH A;  3GLL A;  2R7U A;  1R36 A;  2M7A A;  2VPR A;  2Y0S N;  2B9S A;  2DYR H;  3ASN H;  3HG9 A;  1NK3 P;  1CFA A;  3NRV A;  3QPS A;  4ESJ A;  3TED A;  2XIG A;  4ABZ A;  5IPA A;  1LEB A;  4M73 A;  2XF6 A;  3QYE A;  5L3C A;  1JXS A;  1S9H A;  2ID6 A;  2DA1 A;  1LE8 A;  3H9G A;  2XAU A;  4OOI A;  3GTL J;  4CA0 A;  2LK2 A;  3HC7 A;  4Y33 A;  3JR9 A;  4KFC A;  1ZR2 A;  1SD7 A;  4Y4R A;  1YW7 A;  4RA2 A;  1BI0 A;  5KHD A;  5ILV A;  2V1D A;  4IOA F;  4O6J A;  2QBY B;  2EZL A;  2HZD A;  2ZSI B;  3A0H C;  5F08 A;  1I27 A;  1W7P A;  4QSH A;  4EJO A;  2FSW A;  3OL4 A;  3CO6 C;  3O2P E;  4A3L J;  2DK8 A;  4O5V A;  3CUQ A;  1QO0 D;  3V8K A;  2CUE A;  1VQL I;  2GA2 A;  1TBX A;  2HVR A;  2OPT A;  1GUU A;  1UFM A;  3A1Y A;  3LSK A;  3HOT A;  2VJ4 A;  1UHM A;  3Q9S A;  2RAE A;  2Y69 H;  4AYB N;  4BL0 B;  3H0D A;  1OFC X;  2BE5 F;  2COM A;  5A2Q Z;  2PMU A;  4G6Q A;  1F4K A;  4I02 A;  3LSH A;  1K78 B;  1MBG A;  4R1H A;  1KA8 A;  1REP C;  1WJF A;  5H2F C;  4OIP F;  3F8N A;  4II3 A;  4GRI A;  1AOY A;  2W4S A;  3JCU C;  2W57 A;  3MKY B;  2CSO A;  3LNQ A;  4A93 J;  5DCM A;  4DOZ A;  1FOK A;  2PMZ A;  4I0A A;  1T8I A;  3BJA A;  4KDP A;  3E0J B;  3VWB A;  1WI9 A;  2IP2 A;  2KLO A;  1ZLK A;  4II2 A;  4P3B A;  2CU7 A;  1I50 J;  2JUC A;  4HPQ A;  4XBF A;  5L3B A;  2E19 A;  1G8X A;  4MQV A;  3CC4 I;  1MJB A;  2AXL A;  2FQ4 A;  2LY1 A;  4I09 A;  4LIT A;  2P7C B;  5F27 A;  1U3E M;  2XSJ C;  3CTA A;  5C44 J;  3BZK A;  3OYC A;  2K9S A;  2FMY A;  3QPL A;  2FNA A;  1JKO C;  1OQY A;  1S6L A;  2IAI A;  2VI6 A;  4B1R A;  1BR1 A;  2ZBK A;  1QVT A;  3DEU A;  1YIO A;  1K7A A;  1VF9 A;  3C2G A;  1I1G A;  1T33 A;  1HW5 A;  2Z16 A;  4RS8 A;  4LB6 B;  5IYC J;  2AHQ A;  2Y2Z A;  2KL4 A;  1BC8 C;  5FGM A;  4ZDP A;  3ONQ A;  4FXK B;  2ZXI A;  2O8X A;  1S3J A;  2DT7 B;  1MJA A;  2OZ6 A;  3ZRG A;  2HOA A;  3K70 C;  1I6H J;  2PN6 A;  2O5R A;  1VQN I;  2R5Y B;  4CH7 A;  3OIP A;  4C3J J;  3GTJ J;  2HR3 A;  2YSR A;  1XPX A;  1VQO I;  3BP8 A;  4UUV A;  1E2X A;  2E2J J;  3HRS A;  3FMR A;  3RPU D;  3WGI A;  1FYM A;  1AA7 A;  2A07 F;  2KRC A;  4OU0 A;  5CPR B;  4HW5 A;  2JT1 A;  1R9T J;  3V42 A;  3GTQ J;  1R1T A;  3V8J A;  2F4O B;  2ZME C;  2F5C A;  2R7D A;  4YII A;  2ZB9 A;  3DU6 A;  5AIQ A;  2A5W A;  4CYC A;  3CCY A;  4NBQ A;  3S15 J;  1K61 A;  1K6Y A;  2R5Y A;  1IC8 A;  1SFX A;  2YUS A;  3V7R A;  5JR3 A;  3AG3 H;  2OTJ I;  4XKW A;  1QZY A;  4ZYD A;  2LNB A;  2DFI A;  4MHG A;  2P7V B;  4IF4 A;  1FBS A;  3HRT A;  3OYL A;  5IOY A;  3ZQH A;  3CUQ C;  4BXF A;  2IBD A;  4L9J A;  1Z7U A;  3BR1 A;  4BJ5 C;  4EGZ A;  3OIQ A;  3GFL A;  3CJQ B;  1A36 A;  2X6W A;  1NG7 A;  5E8I A;  2MA3 A;  2OTL I;  4BE2 A;  1W7P D;  2WAF A;  2OCC H;  3I54 A;  3RI4 A;  4RM2 A;  4IL6 C;  2ECB A;  3HRM A;  4EV0 A;  5FRM A;  2EFP A;  2FNP A;  1A5J A;  3JRG A;  5K5O A;  4L5E A;  1OYW A;  1O3S A;  2X1D A;  5HDK A;  2L4M A;  3DXJ F;  3OR2 C;  3OYA A;  2FBH A;  2CV2 A;  1VQK I;  3BG3 A;  3SZT A;  2XGE A;  3MMY B;  1XB4 A;  1YW9 A;  1X1D A;  3ZQF A;  4G6D A;  4CZZ A;  3H5R A;  4ZYE A;  5JHU A;  1HW2 A;  3LSR A;  5E1Z B;  2ZFW A;  1CGP A;  4QLC U;  4HEA 2;  4BHB A;  2FBK A;  3IWZ A;  1K79 A;  3CME I;  3GWZ A;  2H1K A;  3M8E A;  2CV1 A;  2HQA A;  1ZQ3 P;  1W0T A;  2OQG A;  1G4D A;  1IUF A;  2CQK A;  3W6K B;  3W2A A;  4G7Z F;  2VE9 A;  4FHT A;  2DI3 A;  3WHC A;  3L2Q A;  2EZI A;  2VQG A;  2M9H A;  3CCS I;  4A3D J;  1RUN A;  1U6G A;  5CQG A;  3CMM A;  2QA4 I;  4HF2 A;  2R4G A;  2P0W A;  2VJJ A;  5F0H A;  1KU2 A;  1BI2 A;  5DCF A;  4R8H A;  3O8G A;  3CJN A;  1KYW A;  3OL3 A;  2XHK A;  4HDU A;  5LGU A;  1B9M A;  5FJ8 J;  1QHH D;  2Y30 A;  3WU1 B;  1FZP B;  2GWR A;  2BHZ A;  1YS7 A;  2KZV A;  2DW4 A;  3KX2 A;  4Y3O A;  1G6N A;  4L5I A;  2DPD A;  4NC6 A;  1R58 A;  3BCB A;  3EUK L;  2JA7 J;  5EG0 B;  2E1O A;  2E36 A;  4BDZ A;  1Z77 A;  3LA2 A;  1LFB A;  1F36 A;  3PNY A;  4N4N B;  1PUF B;  2CYY A;  1FSH A;  2NXN B;  2LC2 A;  2IGN A;  2ID3 A;  4DZJ A;  3IV5 A;  4WB2 A;  4ZDL A;  2KJC A;  4XKC A;  2K7L A;  3PQK A;  1FX7 A;  1OJL A;  3S2W A;  5C4X J;  4OIQ F;  3ZMV A;  5HNF A;  3SQN A;  2IS2 A;  2DMT A;  4LD5 A;  4GFB A;  4A3J J;  2PQ8 A;  1DP7 P;  3GZ6 A;  1RR8 C;  4IRH A;  1WGX A;  2W85 A;  3BTI A;  1ZK8 A;  4X0G A;  1GXQ A;  3WTX C;  1MSF C;  2V26 A;  5F6F A;  2X6Y A;  2WC2 A;  3HPH A;  3R61 A;  4B4C A;  2KFD A;  5L3D A;  2H94 A;  4YEJ A;  2HOT A;  1HDP A;  2HVS A;  4DYR A;  1J59 A;  4EJT A;  3VEP A;  3RKQ A;  1IXC A;  3S3N A;  1F5T A;  4KNY A;  3RKW A;  2C6Y A;  2X6X A;  4I98 B;  4C3I J;  4LG3 A;  1SMT A;  4KIT B;  1GXP A;  2QSH X;  1JKP C;  1MD0 A;  1X2N A;  1YJW I;  3GBG A;  3OOU A;  1GDT A;  2VON A;  3ELK A;  4KN4 X;  1HLV A;  1W5C C;  3FBN B;  3FXQ A;  3JSP A;  2L0K A;  4RB1 A;  5IY5 H;  3CC2 I;  5KK1 A;  1SD5 A;  2LD5 A;  2X1C A;  2A3S A;  3WG9 A;  3MD2 A;  2VPL A;  2VJI A;  3ABM H;  1XCB A;  2NNN A;  1P4A A;  1R00 A;  2JN6 A;  1FT9 A;  4C9Y A;  1XMA A;  3CMY A;  3ERM A;  2DK5 A;  3RYR A;  1T98 A;  3K1M A;  3ZQQ A;  2WV0 A;  2JUG A;  3ZQ7 A;  4OMY A;  4IZZ A;  3Q3S A;  5ERI A;  3GLX A;  1WJA A;  4RB2 C;  1RET A;  1MBE A;  2LP0 A;  2KHM A;  4V2G A;  1LUJ B;  3C1D A;  4XLF A;  1MDM A;  2K4J A;  3HTS B;  2DO7 A;  1AWC A;  4E7I A;  3TMO A;  3AL0 B;  5CVU A;  2VKD A;  3RKX A;  2AXT C;  3BJ6 A;  3CDH A;  3S1R J;  1LPQ A;  1U8B A;  3H5A A;  4KN7 X;  4XKV A;  5FLM J;  5DYM A;  1R49 A;  3HOX J;  3K4J A;  4NHJ A;  2R7Z J;  1AU7 A;  3JRH A;  3D0S A;  3A0B C;  3S1N J;  2CUJ A;  5E3O A;  3SEQ A;  3C18 A;  4G7H F;  3F8M A;  3IKT A;  2LRE A;  4D5F A;  1VTN C;  4FTH A;  1RKT A;  1W5T A;  4WCG A;  1P6R A;  4B3A A;  4EJU A;  2HYJ A;  3Q5F A;  1YIJ I;  2LR8 A;  2X85 A;  1DGW Y;  3S2H J;  2ZCW A;  1FYL A;  4AU7 A;  4Q5S F;  4HLY A;  1TW3 A;  3OYI A;  2L7M P;  3KP5 A;  5D5W B;  4ETS A;  4E7L A;  2DA3 A;  4XMY A;  4S04 A;  2NS8 A;  5LD2 C;  3BPX A;  2ZO4 A;  4LIU A;  4BBR J;  3DU5 A;  2WY7 Q;  1V54 H;  2R7O A;  1LVA A;  3C7J A;  2EFN A;  3ASO H;  4P39 A;  2VT2 A;  3OYM A;  1SFU A;  4BE1 A;  3BG9 A;  4UVB A;  5D5X B;  3CZ6 A;  1EKE A;  3GTG J;  1WJE A;  4ZC3 A;  3H5N A;  4HA8 A;  3BR0 A;  1YOV B;  4NQW A;  4Y7N J;  1TNS A;  5EEH A;  1MNE A;  4WXD A;  2NOJ B;  1J7K A;  5IP7 J;  3GTP J;  5FRO A;  3AG2 H;  1X3Z B;  2NOG A;  1ULY A;  1D1B A;  4RM3 A;  2VQH A;  5IT9 K;  3T5X A;  3TGN A;  2L7Z A;  2M8E A;  1EA3 A;  3WTW C;  1LB2 A;  2LKP A;  1QZZ A;  2QGU A;  1L0O C;  1BOA A;  1OCR H;  4I7H A;  5D5V B;  4MFD A;  2L2O A;  3FX3 A;  2DOF A;  5B66 C;  4BDY A;  1U9N A;  4LG0 A;  3FBI B;  2IXS A;  2OAZ A;  3QYB A;  3QP6 A;  4A5N A;  1FYK A;  5LEK A;  1I3A A;  2K3F A;  1I5Z A;  2CO5 A;  1IDY A;  3FK7 A;  2DQL A; 
#chains in the Genus database with same CATH homology
 2QKL B;  3PNT A;  4HG2 A;  1G59 A;  4U7B A;  1X1B A;  3OR1 C;  4N4O B;  4CCM A;  5HVQ C;  2CMP A;  1YE9 A;  3J7A Y;  2MYS A;  1NG6 A;  2LH9 A;  4BJ6 C;  4BQO A;  2F4I A;  2HNH A;  2R7U A;  2M7A A;  4IKF A;  4PJN A;  3HG9 A;  2JSP A;  4ZDO A;  4B47 A;  2HDW A;  4OAY A;  1FMW A;  2XF6 A;  3QYE A;  1S9H A;  2RQQ A;  3VYR B;  1WJ5 A;  3H9G A;  4YEL A;  2XAU A;  1MMN A;  4CA0 A;  3HC7 A;  3AKZ A;  4Y33 A;  4PJM A;  3CP8 A;  3ZCO A;  4RLQ A;  4Y4R A;  5KHD A;  4ZTJ A;  2HZD A;  2ZSI B;  3PSI A;  2V6E A;  3OL4 A;  2ELJ A;  4CCK A;  4E7K A;  3HPG A;  4KJZ A;  1Z21 A;  4BJT A;  4XLE A;  4U87 A;  1N78 A;  3OYH A;  3HXL A;  3VYT B;  4FAS D;  2HVR A;  1LFP A;  3LSK A;  3A1Y A;  3HOT A;  2V4J C;  2VJ4 A;  4B44 A;  3LFU A;  3K10 A;  3W2V A;  1X19 A;  4BL0 B;  4QPO A;  3LSI A;  3W2W A;  3H0D A;  2I8D A;  3FHN A;  3LSM A;  3LSH A;  3CES A;  2X51 A;  2XDV A;  4CUG A;  4F91 B;  1WJF A;  2R7W A;  4II3 A;  4GRI A;  3S32 A;  2W4S A;  3MKY B;  1DQU A;  4NQW B;  4IX7 A;  1MMD A;  4PFO A;  4DOZ A;  2PMZ A;  3OS1 A;  2M3A A;  3C2H A;  3E0J B;  3VWB A;  2HPM A;  4XKB A;  2KLO A;  4XOR A;  1YX3 A;  4II2 A;  3QYF A;  1Y6I A;  1KON A;  2WA0 A;  4HPQ A;  1G8X A;  3MKW B;  3I9V 2;  3UNG C;  3AFH A;  4F93 B;  1FMV A;  4C2T A;  3VYU B;  4XLC A;  2LY1 A;  4LIT A;  4P1W A;  4R79 A;  1LDK B;  2PJR B;  1T0F C;  2XC7 A;  2FUG 2;  2XSJ C;  2R7Q A;  4G6T B;  3OYC A;  4XNF A;  2MFZ A;  2ZSH B;  3E1S A;  2KQR A;  4CCL A;  3OYG A;  2LBF A;  1BR1 A;  1X1A A;  4QPQ A;  3C2G A;  1D0Y A;  1D0X A;  2CS3 A;  2BVM A;  2Z16 A;  5TGT A;  2KL4 A;  4BQQ A;  1HA8 A;  3BLY A;  4ZDP A;  2WAD A;  3ONQ A;  2ZXI A;  3DPU A;  3CJR B;  2DT7 B;  3ZRG A;  3PL8 A;  2VKH A;  3K70 C;  1P9Q C;  1W36 C;  3OYE A;  2O5R A;  4ZTF A;  3PUB A;  4CH7 A;  3OIP A;  4XOP A;  3FDY A;  4XLA A;  3ZXS A;  4XN0 A;  2Z1D A;  4NNJ A;  2WBM A;  2RRE A;  3DPL C;  3RPU D;  2HVQ A;  2R7X A;  3TL4 X;  1AA7 A;  1V5G A;  2KRC A;  3I3L A;  2BOL A;  3A2K A;  3D5S C;  3IAS 2;  5CPR B;  3SDB A;  3KEY A;  3V42 A;  2CFO A;  4AYB A;  2W7N A;  5CKT A;  4YRV A;  3DU6 A;  2A5W A;  3QOE A;  1X4P A;  2WAE A;  3RCO A;  2XF5 A;  4J01 A;  1K6Y A;  2WAQ A;  4CCN A;  4PJJ A;  3TBI A;  2MD0 A;  3NWT A;  2V1N A;  1N77 A;  2R7S A;  2Q1Z B;  4XKW A;  3IAM 2;  4JQF A;  1QHG A;  2WY8 Q;  1N75 A;  3S3O A;  3OYL A;  4F52 A;  3OS0 A;  1Z7L A;  2VQC A;  4E7Z A;  4BXF A;  1OR7 C;  3K6G A;  3BC8 A;  3SYT A;  2K5C A;  4BJ5 C;  4PK4 A;  3OIQ A;  4IQJ A;  3CJQ B;  2X6W A;  1NG7 A;  4P5O A;  2VL8 A;  3HOS A;  4BE2 A;  4F3Q A;  1SAU A;  2WAF A;  4FXG B;  1OLT A;  4RM2 A;  3SEZ A;  4OWR B;  5FRM A;  4E7J A;  1PYV A;  2V9K A;  3OYN A;  2KPM A;  1LKX A;  1T95 A;  2X1D A;  2E5Z A;  2R7V A;  3OR2 C;  3S8P A;  3OYA A;  2CV2 A;  2X1E A;  4FET A;  4JOM A;  3MMY B;  4OAZ A;  3DLA A;  4H4K C;  4XON A;  4B43 A;  1GLN A;  1X1D A;  3VSK A;  2IS4 A;  3H5R A;  2E1M C;  2L9N A;  4D1Q A;  2R7R A;  1Z3X A;  2OUM A;  3FKJ A;  4HEA 2;  4BGD A;  2L5Q A;  3D5L A;  3AL0 C;  3K4C A;  2CV1 A;  2HQA A;  2CW7 A;  2A6T A;  1PJR A;  4DJA A;  2LBF B;  3VDX A;  2DXI A;  2VXD A;  3W2A A;  4PSW A;  3PJR A;  3L2Q A;  2VQG A;  3S3M A;  1BR2 A;  5CQG A;  3CMM A;  1WJC A;  2R4G A;  2P0W A;  2M0M A;  2UV1 A;  3DTI A;  1BR4 A;  2VJJ A;  2CW8 A;  3M1C A;  2DCE A;  4ITV A;  4F55 A;  5JPM B;  3EUH C;  5HOO A;  3N05 A;  1E0E A;  4B48 A;  3S93 A;  5FRN A;  2KDO A;  3OL3 A;  2W82 A;  3HKZ A;  2LYC A;  5KCM A;  4ANJ A;  3CF2 A;  5LFA A;  4XLH A;  2IS6 A;  1X4O A;  1QHH D;  3W3C A;  2L7K A;  4PJL A;  2XF7 A;  2VXZ A;  3L2U A;  2HU9 A;  2KZV A;  1YX5 A;  3KX2 A;  4Y3O A;  2E60 A;  1D0Z A;  3BCB A;  3DTK A;  3EUK L;  5HLT A;  2LOO A;  4B3X A;  4BE0 A;  4BDZ A;  3PNY A;  4XN3 A;  4N4N B;  2GOX B;  2LC2 A;  1U0J A;  2IGN A;  3EUA A;  3OS2 A;  3M8J A;  2VAS A;  4ZDL A;  4XKC A;  3OWT A;  3H9Q A;  3ZR8 X;  3L2V A;  4E4H A;  4DBQ A;  2DOA A;  5KNL A;  3LSG A;  1D1C A;  2JVH A;  4XQF A;  5HNF A;  2IS2 A;  3QOD A;  4KT6 A;  4C2U A;  4HNT A;  1ERD A;  2AQF A;  2K3P A;  2UUZ A;  4LIV A;  4NC8 A;  4X0G A;  3K70 D;  2V26 A;  1W36 D;  3K4N A;  2X6Y A;  2LRD A;  2LG4 A;  3OYD A;  1MMG A;  1UAA A;  3HPH A;  4YEJ A;  4IQ4 A;  2HVS A;  2V7F A;  2VLA A;  3RQ4 A;  2W1O A;  2F5V A;  3CP2 A;  3S3N A;  4BU2 A;  4J00 A;  2AQE A;  2X6X A;  3BG6 A;  2L9S A;  1IRX A;  4LG3 A;  4PSX A;  4KIT B;  2KRH A;  4XL9 A;  3D5R C;  5HNH A;  3GBG A;  3OOU A;  4PFP A;  5JHF A;  3OY9 A;  2KMU A;  1MND A;  1SFK A;  3FBN B;  4NC7 A;  3BG7 A;  2KP6 A;  4BS9 A;  4HRI A;  2X1C A;  2VB6 A;  3MD2 A;  3DKX A;  2VPL A;  2VJI A;  3H9J A;  4BEH A;  4E6K G;  2ZFU A;  3DPT A;  2IGM A;  3DWL E;  1TZL A;  4C9Y A;  3IUO A;  1MW7 A;  4XOT A;  4HNU A;  3OYB A;  5CQE A;  2K9L A;  1ZEL A;  1UG0 A;  2OC6 A;  3K4K A;  3ZQQ A;  4DIQ A;  2VIX A;  2JUG A;  4IZZ A;  2E1M B;  2CH0 A;  2DJI A;  3HL2 A;  2M4G A;  1WJA A;  4ZJZ A;  3F9K A;  2KHM A;  4XLF A;  2UWM A;  3SZG A;  4E7S A;  3OYJ A;  4E7I A;  3TMO A;  2CV0 A;  1R6R A;  3AL0 B;  2OV7 A;  2ZXH A;  1VZ0 A;  2VKD A;  2BW3 B;  3RTR A;  3H35 A;  3DTE A;  3H5A A;  4XKV A;  2M4K A;  2F6C A;  4MLO A;  4XR6 A;  3OYK A;  3K4J A;  2RNG A;  4BUP A;  4C30 A;  2JVG A;  4NUB A;  3VYS B;  2CUJ A;  2BVL A;  3SEQ A;  2MC4 A;  2LRE A;  4CSW A;  1DP3 A;  4E7H A;  2VJ5 A;  3MKZ A;  2WB1 A;  2R7T A;  2X85 A;  1DGW Y;  2DT6 A;  3G2B A;  4AU7 A;  2BW3 A;  4HST A;  2K9M A;  4DGW B;  2MAB A;  4RMN A;  3OYI A;  2JA2 A;  1WJB A;  3HUG B;  2Q2E B;  3NWS A;  4ZYA A;  4AVZ A;  3EPZ A;  2Z2S B;  4E7L A;  2IGO A;  4XMY A;  1D1A A;  1DGR M;  2QKM B;  4CCJ A;  5LD2 C;  3OYF A;  4LIU A;  3DU5 A;  2WY7 Q;  4KIS A;  3DEE A;  2IGK A;  3OMY A;  1WJD A;  2R7O A;  3LL7 A;  2IS1 A;  2VQL A;  3DQV C;  3L2R A;  1Y56 A;  3K4M A;  3IP4 B;  4F92 B;  3OYM A;  4XM3 A;  1TT0 A;  4BE1 A;  3CZ6 A;  1J09 A;  2W00 A;  2Y0S A;  1WJE A;  3L2W A;  1V5F A;  4ZC3 A;  1BOB A;  3H5N A;  3KYL A;  3A4C A;  4BQN A;  1MNE A;  2NOJ B;  3PNV A;  4HSR A;  5FRO A;  2HPI A;  3U21 A;  1D1B A;  4CCO A;  4RM3 A;  2VQH A;  2M7B A;  3UR3 C;  4CZC A;  4PUS A;  3VSL A;  1EA3 A;  3PSF A;  1JI8 A;  1Z3Y A;  4EAT A;  1MMA A;  2LY2 A;  3K4L A;  1X1C A;  3LMM A;  3PFY A;  2L2O A;  4BDY A;  3BCA A;  3FBI B;  4BAC A;  2PJR A;  1UEL B;  2IXS A;  4BEH B;  3QYB A;  2GOM A;  1V5E A;  3ZGK A;  2CUZ A;  4RLF A;  2E5N A;  1WFX A;  3DKY A;  1LVK A;  1QU3 A;  3K4B A;  4D9J A;  3RSN A;  4DBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...