1AA7A

Influenza virus matrix protein crystal structure at ph 4.0
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
158
Chain Sequence
b'MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA VIRUS MATRIX PROTEIN
publication title Structure of a bifunctional membrane-RNA binding protein, influenza virus matrix protein M1.
pubmed doi rcsb
molecule tags Matrix protein
total genus 57
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1aa7A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 1aa7A01
4PUSA 1AA7A 3MD2A 2Z16A 1EA3A 5CQEA 4IQ4A 4D9JA 4ITVA 3VDXA
chains in the Genus database with same CATH superfamily
4RAYA 3KE2A 4IOAF 4AIKA 2OZUA 4DYQA 1W36D 2BHYA 3S3NA 3BWGA 2X1CA 1NK3P 2OAZA 3OYCA 5FKMA 3MN2A 2W25A 4XLAA 1PVEA 2HXOA 2CU7A 2OD5A 5D5XB 2XAUA 5K7FA 3LFKA 5CYVA 3MMYB 3IL2A 1KYWA 1NHAA 3CMYA 4EJVA 1IXRC 2KLOA 3HOUJ 5J1RA 2YPRA 3MCZA 3QPSA 2FUG2 2MC3A 3VODA 1D1CA 4XKVA 1YITI 1DGWY 3FDYA 3WTYC 3AFHA 2DDBA 2HFHA 1FX7A 1ON2A 1X1CA 2ZNYA 3O2PE 3AKZA 2IGOA 4HWJA 2F4OB 3OIPA 4L5JA 1FSEA 2XC7A 3IKTA 2X6XA 1PYVA 2KFDA 1WFXA 4DBRA 1PJRA 4M3DA 3GVAA 2H1KA 2R7TA 1JI8A 2IS6A 1ZARA 2DBBA 1FZPB 3K1PA 1IZ1A 5FLXZ 5HS7A 3E97A 1JE8A 3WE2A 2V26A 2UV1A 5E20A 2XAQA 1H89C 2L9SA 4A3GJ 3ISPA 5KAFC 4HBLA 4EMSA 5TJJA 2YX7A 1HKQA 3K0LA 3HJEA 3QYBA 3BTLA 5LLQA 3ZR8X 2RC4A 4B09A 3HOWJ 3GTGJ 2BW3B 3FXUA 4E4HA 1OYWA 1N77A 2EA4A 4GYIA 3OYMA 2DMNA 2Y0SA 4IRHA 4FXGB 3OS1A 5KHDA 3COAC 5D6EA 5IT9K 3KZZA 4KMFA 1Z9CA 4M9ZA 2H27A 2O0YA 2E2IJ 4ESFA 4PFOA 2CUEA 4EGYA 4MGRA 5HODA 4C2MJ 4NC8A 1IXCA 2LD5A 2MW8A 3OSFA 3HPHA 3HYIA 3MEXA 3DBRB 3A0BC 1EH8A 2R7RA 2PEXA 1BL0A 3BP8A 3OYIA 1A5JA 4BBRJ 3IH3A 2K02A 3OOPA 2RAEA 1BOBA 5DV5A 4KNYA 2EQRA 2VOOA 4I02A 2A5YB 1FOYA 3CMAI 1TNSA 5HS8A 1MBHA 4II2A 1WJCA 1MW7A 2CQKA 4WXCA 3RKQA 2ZCWA 2L7ZA 3BR2A 5A2QK 4MQVA 3UR3C 3EDPA 4BAYA 2VBXA 1W1WE 3FXLA 1SC7A 1OLTA 1K61A 3GTPJ 2WB1A 2QEXI 2ISYA 4H0EA 5FFXA 3BJ6A 1EH6A 1MKMA 1BW6A 4ZYHA 2ZBKA 2NNNA 3G71I 3BR1A 5FJ8J 1YQAA 3DXJF 1ERDA 2DFIA 3GZNB 1TWAJ 3EUAA 3FXOA 5D8LB 1CF7B 1E0EA 3SZTA 1BC7C 3RIRA 1H9GA 2RQQA 3BTIA 2R5ZB 3I54A 3FXKA 3QOEA 2XF6A 2QCOA 4M6XA 1WJDA 2QGUA 2B39A 4BEHA 3RPQA 1LEBA 3ROUA 4PGGA 3ZQGA 3OR1C 4WK8F 1IAWA 3NAUA 1YS7A 2H94A 2PI0A 4R8HA 1WI9A 2VASA 2KPMA 5J4VA 2DOEA 5EDNA 2P6SA 2W4SA 3IH4A 1ZYRF 3FZVA 1QVUA 4F91B 2JA5J 1FNNA 2OBPA 2K27A 3GFIA 3CDIA 2HYJA 3IWZA 4L9NA 2DODA 2XAFA 3LSIA 4E7LA 3E0JB 2BE5F 3OS0A 1JUMA 2IA1A 2VUMJ 3KP4A 4DNCA 1XMKA 2DA5A 1XMAA 3O8GA 2I8DA 4IHSA 4Y13A 2VT3A 2HQRA 4ZZDA 1XGNA 1VQOI 3EQLF 3TO6A 2RGVA 3PFIA 4DW6A 1B1BA 1MJAA 2HR3A 2QQAA 1P2FA 2CO5A 1I3QJ 4KIBA 2ID6A 3JAMK 1K83J 2OA4A 4QIWN 2HDDA 2ZMEB 3F9KA 3EPZA 3F8FA 3ZMZA 1BI2A 4D5FA 2IVMA 5JHFA 2IS4A 1FIPA 1N75A 5CLSA 5L3DA 5ILVA 3GTLJ 1ZTRA 1B4AA 3K1NA 1B8IB 2DMTA 2CV1A 4IHYA 2DYSH 5LGUA 5EEHA 5EG0B 2L3DA 4HSTA 4XLFA 4OMZA 1T38A 1YOVB 2L01A 2PMZA 2ZMEC 5GTIC 1U9OA 2E71A 3LFUA 3WTUC 4A3BJ 4CZZA 3SYTA 1PUFA 4EQQA 4O6JA 3ZQ7A 2DXIA 1ZK8A 3MFKA 2R7XA 2QZ8A 2B9SA 2ZXHA 3X2QH 1XB4A 5HLHA 3DEUA 3WGGA 4UB8C 1XCBA 2XSJC 1X1BA 5GAGJ 4WCGA 1QA6A 2PQ8A 3RJPA 2QF7A 4XKWA 1TBXA 2IPQX 4XONA 3ZMVA 4WWCA 2ZXJA 3LSTA 4E7HA 2VI6A 3I56I 3V7SA 3RI4A 2QSFX 4U88A 2FMLA 2XGXA 1ZQ3P 3FK6A 1O3SA 4Q48A 2VE9A 1KU3A 4ENKA 5E8IA 1MSFC 1U2WA 3Q0VA 2MFZA 4OIOF 1ENHA 2BY3A 2DO7A 3OYDA 1GVJA 1SVOA 2BXZA 2JVGA 1IW7F 1ITYA 2L7KA 2X85A 4KN4X 3CCYA 2EV5A 2L9NA 3WG9A 3RPUA 1MNDA 1W7PA 2KZGA 1P4XA 1RESA 4AYBA 1R5GA 4D7MA 3C7JA 1OCZH 2EH3A 1TWGJ 5IYDJ 3PFYA 4KT5C 1PP7U 3HC7A 2QSHX 4DZPA 1RZ4A 3DF8A 2A6HF 1H88C 2XF7A 2FU4A 2O61A 1O4XA 5L3CA 3HB9A 4ZYAA 3RZDJ 3CJNA 5LEKA 3OYJA 1UAAA 2DK8A 2JA7J 2R7ZJ 2GIZA 4XR6A 3VSKA 3GTQJ 4AIDA 3G6EI 3I53A 4EJUA 2DU9A 2QA4I 2EINH 2D5VA 3E5XA 3FMSA 3LQQA 5FLXK 3PUBA 4HW5A 2GBYA 3HTUA 3Q5FA 2JVHA 2MG4A 3V8KA 2FX0A 3ZQIA 2MLKA 2OC6A 4PJ0C 2IA0A 1X1AA 5HS9A 2KIUA 2RQPA 4R1HA 3JCUC 5GPAA 4CCJA 4UY8I 1GT0C 3N97A 2GWRA 2QWWA 4HX8A 2CYYA 3H0GJ 3FKIJ 5E79C 2DAOA 4F55A 2CUFA 2H1LA 4X0GA 3FHZA 3CJTB 3PL8A 3U1KA 4MEXF 2W82A 1T2KA 1JT6A 3WGIA 3SEQA 3QQAA 4JX5A 3D1NI 3OIQA 3OYAA 2BVLA 3PSIA 1X3UA 1TL8A 1EA3A 4CCMA 2BY2A 1I39A 5KCMA 2LF8A 1HXDA 4A6DA 3O6BB 3F23A 2E2HJ 2CS3A 5D5UB 3FXJA 2L02A 1X3WB 4LLGF 5IP7J 3KZYA 4U0VA 4I09A 1G59A 1F36A 2HYGD 1R1TA 2HS5A 1O3RA 2XRNA 3CTAA 4HOBA 5E3MA 4LB5A 4JQFA 2DA4A 3CUOA 3ZXSA 4UUSB 4MO7A 2V9PA 2L4MA 5ICCA 3M3YJ 3ESWB 1HLVA 3JRHA 1QO0D 1D0ZA 3P7NA 4UNOA 1BN5A 1X4PA 2E35A 4N9IA 1FWZA 3KIOA 5D5VB 3IRRA 2R4GA 1QZZA 3GLLA 4LB6B 5M5YJ 2DJIA 4HDUA 1YJNI 3ONQA 3T1BA 1FMWA 3I4NJ 2UXNA 1QHHD 2X9DA 4FT8A 2JRTA 1ZR4A 4ZTFA 1R7JA 4V19K 3QPTA 1MMDA 4XICA 1V5GA 2K9SA 2Y9YA 3JRBA 4KJZA 4FE4A 2ZFUA 4XKCA 2K3PA 1VQLI 2NRAC 4F3QA 4D0PA 2AXLA 1ZGJA 2A5WA 2XPVA 4U0WA 1VTNC 2VBZA 2K4BA 3MAJA 3LQRA 1R23A 6PAXA 2FJ1A 3C1DA 2IGMA 2ME0A 1BOAA 4FQGA 3V8LA 4A3LJ 1PDNC 1ACIA 1TW3A 1KZHA 4EJTA 3MWMA 3HG9A 2O9LA 2LK2A 2CV2A 5HDGA 4ON0A 2NVUB 2NAZA 1UCRA 1DP3A 4N4NB 4BS9A 3WHBA 3KEQA 4XNFA 5ICGA 5K5RA 2A05A 2CQNA 4EV0A 2H6CA 4G8XA 2BBYA 4A3MJ 4FE7A 1ETQA 4IKFA 1OCOH 2W1OA 5EGOB 2LNBA 5B66C 2IBDA 3GFJA 3BR3A 1V5FA 1DDNA 3ABUA 3GMEA 4HEA2 3K1MA 1FEXA 2GIVA 1PUFB 3S14J 2Y30A 5DD4A 1SMTA 2D1VA 4II3A 1FP1D 2ZFWA 3QU3A 3OYEA 1XS9A 3HKZN 4PJNA 1MBGA 2VQHA 2O3FA 1LFUP 1UELB 2LREA 4AWXB 1I1SA 2UZKA 2KJCA 3CUQA 1TC3C 4HPQA 3BG3A 4BQNA 2FBIA 2QQ9A 1ONVA 5FGMA 3K70D 4GO1A 4M3BA 5H6RA 4MHGA 3GXOA 1JUSA 3D5SC 1FIAA 3FF5A 3W2VA 1R6RA 1AHDP 2P81A 1NTCA 3TDZC 2DT6A 3ULQB 4XK4A 2XGCA 4M71A 1NG7A 2FSWA 3C2HA 1FP2A 5BPDA 4RBOA 3GFMA 2A68F 3AAFA 1D8KA 3R4KA 1WJ5A 5E3OA 2R0QC 2E34A 3K4JA 3HGYA 1BR1A 2DPUA 3L2RA 3BY6A 2XROA 1X2NA 2LTPA 3HQBA 3R61A 4EEFG 5LHHA 3B6CA 4NHJA 4HW0A 1P7IA 4P55A 5JR3A 1VQKI 2KDOA 2RNJA 3E5UA 3SEZA 4BE2A 4H4KC 4HF2A 2TRTA 2LC2A 2GXAA 1E3HA 3BR0A 5JFRA 4PSXA 1OR7C 4B3XA 2Y31A 4V2FA 2BGCA 2HNHA 4XLHA 3M7GA 4O5VA 4BHBA 4ZTJA 1WRJA 4EM2A 1VQ7I 2DMQA 1L0OC 5TISC 4A6EA 1SFOJ 5J8CA 2HQ5A 3P5JA 1QQIA 1Z6RA 4BUPA 5LGTA 2EZKA 3OYHA 2KRHA 4OWRB 4RDUA 2STWA 4XLNF 1ETKA 3RYPA 5BQTA 1SFUA 4WXDA 3BPVA 1OYIA 2CW8A 3VSLA 1I6HJ 1JKRC 2DA1A 4A3FJ 2BEOA 1GUUA 1TZLA 3QOPA 5AIQA 4Y7NJ 3QRFF 2R5ZA 2ZC2A 3HHGA 3LL7A 4CCLA 2HQNA 3ZGKA 1BI3A 1TT5B 4XLEA 4IOCF 3F3XA 3PO2J 2R7OA 2Z16A 3J7AY 1LVKA 3EYIA 2VJ5A 4P9FA 3MZHA 1OCCH 1GHCA 2EFNA 4GDFA 2DT7B 2QKLB 2DTRA 3MKZA 3MQ0A 2JUGA 2M1BA 1J7KA 1U6GA 1UHSA 3JSOA 3DU5A 2WAFA 2LF7A 3G1LA 3E5QA 1LDKB 3ZMTA 2DT5A 5DEQA 1OCRH 3FMQA 3Q9SA 4LOCA 1TTYA 1WH5A 2KP6A 4NC7A 3REOA 3L2CA 1VQ6I 1S7AA 5B4PB 4XLCA 5FD5A 3S93A 3QYEA 2F5DA 3K2ZA 3KYDB 1OFCX 1P92A 2ZB9A 2EZIA 4ENJA 1K4SA 2H8RA 2YU9J 3A0HC 3TOBA 1TQMA 3DTEA 3HHHA 1HSTA 3G3ZA 2DFHA 1KGSA 5E1ZB 2Y48A 3LAPA 1HDDC 1R4NB 4BBSJ 3C2BA 2GLOA 4IJAA 4UUTA 1FBSA 4IF4A 1MNMC 4UB6C 2Y69H 3DV8A 5EG0A 1T39A 3NQOA 2M4GA 1IN6A 3PNVA 4J01A 2WAEA 5GAHJ 1V3FA 3M07A 4HDVA 4M9XA 5GP9A 1UG0A 3HEFA 3I4MJ 2OPTA 3CP8A 3DEEA 1KU7A 1YX3A 2VQGA 1ZGWA 1K4TA 4F7ZA 3BG7A 3CD6I 2BXYA 2K9NA 1AWCA 4LGWA 3E6MA 3CO6C 1HKSA 1USTA 4KICA 4HZFA 3VYUB 3LSRA 5IP9J 2CW7A 4UV8A 2IT0A 2LY1A 3I59A 3PIPF 2R7SA 1BIBA 1XSDA 1JJ8C 1MJBA 2MGQA 4DBQA 2XPWA 2QBYB 2HPIA 2WAQA 2VJJA 4JP0A 3G2BA 4AIJA 3OSGA 1TP4A 2F5VA 2EFQA 1BW5A 3DU6A 4ZDOA 4ZDPA 2WA0A 3PSFA 3K2AA 4N9HA 3L2VA 2CW0F 2FE3A 3NARA 2LMDA 2AO9A 3WHCA 2TDXA 4CZCA 2EV0A 5L3GA 3QAHA 5E8GA 2ZJ2A 1TQIA 5K5QA 4PUSA 5EZHA 2G0EA 4HG2A 3JW4A 2VB6A 1DGRM 2E7WA 3IC7A 4MLOA 3ZQHA 4O3MA 3KETA 4KDPA 3CUQB 1YX5A 4CCOA 1ON1A 3QU6A 1F9NA 3CJRB 4IRIA 2VBWA 3HIFA 4M6VA 1RR7A 1HCRA 3GZ6A 3IH2A 4TV7A 2HKXA 2HOTA 4CO8A 1C5AA 4IEJA 5JPMB 4G94A 4PJMA 1YIJI 4PCQA 1ZRDA 2D2WA 1PUEE 3CUQC 2NVXJ 2GA2A 1O3TA 2MSYA 5B3SH 2NVYJ 5LRSA 1S7EA 3LSGA 4AIHA 4EJOA 1TNTA 2EZHA 1RNLA 4XN0A 5DUKA 3HPGA 1SFKA 1C0WA 5DM6F 3P9KA 2DJNA 3TGNA 4Q47A 2BY1A 4AC0A 2E5ZA 3I55I 2V4JC 2CSOA 4GFBA 4HF1A 3QP5A 1CFAA 4V2GA 1WJFA 2FEZA 5CVRA 3B02A 4MIMA 3EETA 2JT1A 1Y8RB 1FY7A 1QRYA 3S15J 4EJWA 4R79A 1T56A 3ABMH 3L2WA 1R1UA 4A12A 1KQ8A 1W4MA 1A04A 4Y17A 4A3JJ 1O7FA 2CV0A 3ZN0A 2HEOA 4U0YA 1MH3A 4JBAA 2HPMA 2EA2A 3DPUA 3N4MA 2P0WA 3DLLF 1MBFA 1F4KA 1T98A 3KYCB 4QTRA 3CLQA 3D5RC 4WX9A 5D5WB 3HOSA 4I2OA 2PFBA 3HDDA 2RV8A 2IP2A 1YG2A 2VKHA 3NEUA 3G4SI 1ZELA 3OY9A 3AG3H 4BACA 1WCMJ 3CC4I 2LBFA 1CQTA 1YYVA 4YEJA 2NYXA 4N4OB 4ANJA 2L54A 3P9IA 2M9HA 1Y8QB 3IRQA 4UUSA 5E17F 3R0JA 2HTSA 1NG6A 2PMUA 4MFEA 2DCEA 3VYSB 1USSA 3HM5A 1O7LA 1W7PD 2X6OA 3K4NA 1MDMA 1FMVA 5L3FA 2MH9A 2DOAA 3I0TA 2L9RA 1D1BA 2F4IA 4X6AJ 3TO9A 2XAJA 4RB1A 1Z0XA 1S8NA 3BQYA 3EUHA 4KN7X 3VDXA 1MMSA 1LJ9A 2QYOA 1BBYA 3DBHB 4PFPA 1YRNB 3F8BA 1R22A 5JVTA 1FSHA 2NVTJ 4K2EA 4CH7A 1K78B 3JSPA 5FLMJ 3SQNA 2F6CA 2F5CA 3TKYA 5FKNA 2E1OA 4X1EA 4HV5A 5BS6A 3SDGA 1TT0A 2CQXA 3HSEA 1MMNA 2HWVA 2VT2A 3LSHA 4KMUX 2GQQA 1A36A 3LA7A 4Z6YA 2JJ7A 4N0BA 2ZJPF 2KQRA 3J80K 3K4LA 3H36A 2BYVE 3RKWA 4ZZLA 5F08A 3OL3A 2Z1DA 4YFXF 4G7HF 3OIOA 5ED4A 1BC8C 2E36A 2ISZA 4L9JA 4P9UA 2CWEA 3M8EA 1H8AC 4I6OA 4HQEA 1I3AA 3SHFA 1TWCJ 2EZLA 4XBFA 2M34A 5LFAA 2XPUA 2YR2A 3SZGA 1SD5A 4BXXJ 3FXRA 3U1DA 4Y52J 3KP6A 2OF7A 3VOEA 4YIFA 1EKEA 1OISA 1P6RA 3LMMA 1W0UA 2OCEA 2F48A 1B72B 5EGOA 4AYBN 3CO7C 4XIDA 4L5EA 4A0XA 4YFKF 2HI3A 3VWBA 1F5TA 1A31A 2Q1ZB 1BIAA 3CCRI 2C6YA 3KLSA 3OYGA 1NH3A 1YHQI 2ZO4A 2LKXA 2NOGA 3J7ZI 1R36A 2Q8KA 4RB2C 5DTDA 1CGPA 2GM4A 2E7XA 3K4CA 4JX6A 4ZJZA 2VPLA 4XM3A 2K4JA 4D9JA 3K9TA 4BH9A 2ZSHB 5LHIA 1IUFA 5ILUA 5TGTA 1E2XA 2QUFA 3I59B 4OIQF 1YI2I 4A3CJ 1S72I 2LG4A 1SAUA 3OL4A 2R93J 2LKSA 3RQIA 3CCJI 4A93J 2CG4A 4BXUA 2DI3A 2FOWA 4EM1A 1Z67A 3BPXA 2BVMA 4KT6A 2PJRB 3RSNA 3GTOJ 2IRFG 3KPHA 2XHKA 1JXSA 5H20A 4Q4ZF 4J19A 3WG7H 1VQ4I 1IN4A 3S3OA 4G12A 5B5EC 2PBIA 5K7HA 4XRSA 1Z3YA 3F6VA 2ELKA 4PDKA 2V79A 3L2UA 1FBUA 3JRCA 2HU9A 3VFZA 2L9VA 3BC8A 4G6DA 4RM3A 5FRMA 4NNJA 4LD5A 5M5WJ 2LY2A 3DBLB 1G8XA 1K6OA 2OV7A 4CDGA 1IC8A 1ZH5A 3S1NJ 1OR7A 4XSXF 2VJIA 3WTXC 4KIFA 4G6TB 1EH7A 3HBLA 3H9GA 1YE9A 4D1QA 2VN2A 4C3HJ 1GV2A 2L7MP 5J47A 1XCVA 5KAIC 1FYLA 1MNEA 2G9WA 2DA6A 3M8JA 1W5SA 5C4JJ 2OZ6A 2K7LA 1IRFA 2CGPA 1SD6A 2MA3A 3PNTA 3L2QA 3GWZA 1G6NA 1BA5A 3VYTB 1MSEC 3H3VK 4HAMA 3H3UA 3JTGA 5HVQC 2XAHA 5DDGA 2OQGA 1X4OA 3LA2A 3W2AA 3HRUA 3DKXA 1X2MA 2PMHA 2AHQA 1WQ2A 5CQGA 4ZC3A 4A0YA 5C4XJ 4G9YA 5IYBJ 3GW2A 2AS5F 2F2EA 1ETWA 1ULYA 3HRMA 4Y4RA 5BNGA 2UXXA 3G1MA 1ZRFA 2HGCA 2CJJA 1N78A 2DK5A 5HNFA 3S16J 2R7VA 3E3VA 4GRIA 4M73A 2D45A 1D5VA 1JHHA 3K6GA 4YIIA 4HNUA 2IA2A 3JTHA 2L7FP 4P3AA 3HUGA 1MMGA 4ETSA 2R7WA 2DA3A 2FRHA 4HF0A 4D5CA 5GAEJ 3QWLA 1MIJA 1LE8B 1T8IA 1VQNI 1WSUA 1QBJA 2XASA 2LBFB 4MQ9F 4IRGA 3I3LA 1U8RA 5GTHC 1G3SA 2ZJQF 2EIKH 3ELKA 2Y9ZA 2IGNA 4XQFA 2X0LA 2H09A 5J6XA 2P8TA 4OU0A 4CXFA 3OYKA 3BJOA 3DTKA 1MDMB 2KHMA 4C3IJ 3E6CC 1HW1A 4A3IJ 3K4BA 1S6LA 3RCOA 1VQ9I 2LKPA 5J3LA 2ELJA 2FXAA 4UXNA 2PLYA 2CMPA 2XSDC 4HSRA 1O3QA 5D4SA 2P7VB 4UU9C 5F27A 2F5FA 2IAIA 4XRMA 3H3ZA 5F0FA 3BR5A 1FOKA 4MFDA 4JOMA 3MD2A 2V6CA 2M4KA 1I1GA 5LGNA 4LG3A 2VODA 2P5KA 3SXYA 3ML6A 4DYRA 5BMZA 1T6SA 4IHXA 5CKTA 3OS2A 3LAJA 3KX2A 2STTA 1ZLJA 3EUHC 1GXPA 2XGDA 1D5YA 1W36C 4BQOA 4XRFA 3ZOBA 4DYCA 3AL0B 3FISA 2K40A 4Z2YA 1P4WA 3GCMA 3KLNA 3RDIA 3NWSA 5M5XJ 2CFOA 3NWTA 1O57A 3E6DA 3OOUA 1K6YA 3GEZA 2Z33A 3GUDA 5IP6A 4UHTA 2ZXIA 3BOQA 1YJWI 2KZVA 2KKOA 3AL0C 3KLOA 4KUMA 4NBQA 1E3OC 1IUYA 2QBYA 1FTZA 2M7BA 1RUOA 4UUVA 3OWTA 2WV1A 3C2GA 3GF2A 5J1YA 1KQ9A 4ENMA 1BR2A 3DCFA 4A2UA 5IPAA 4XL9A 1SMYF 4BXFA 4B8XA 2W85A 1RKTA 3W6JB 3A01A 4PK4A 3WTSC 1X19A 3DLAA 1ZAOA 4QSHA 3HOXJ 3KFWX 4I6ZA 1J0RA 3UKGA 4NUBA 4AD9A 3VEPA 3E6BA 1YS6A 2K3FA 1IN8A 5CPRB 3SDBA 1YW7A 1G3WA 1I27A 1DP7P 2AQFA 1ZGAA 5GADJ 2Y75A 2HZDA 5LHGA 3H35A 3VB2A 2LR8A 3CJQB 3ZRGA 2QVOA 3L00A 1HBXG 4P39A 1U5TB 2V9VA 1J75A 2DN0A 3BG9A 4LG0A 3IKVA 2FNAA 2VIXA 3FK7A 2YU3A 3B73A 2V7FA 3ZMUA 2HOAA 1D1AA 4M9SA 4ZYDA 4AM3A 1ZREA 4XOPA 2GXBA 2QM3A 2WY7Q 1U5TC 3BCBA 4P1WA 3K7AJ 2M8EA 3MKLA 3Q0WA 5FKKA 2XUBA 4RGSA 4RAGA 2E60A 2HQAA 3CCLI 3B6AA 3LOCA 1QVTA 2DMPA 3OR2C 2KIQA 3O3KA 1RC9A 3ECHA 2EBIA 1LUJB 4BHCA 4YG2F 4C2TA 4HA8A 1BI0A 4QPOA 4UV9A 1S7OA 1R49A 1RETA 3D0SA 4IPAA 4AVZA 3IV5A 4A5MA 1MH4A 5M3MJ 1P4AA 2M0CA 1EJ9A 4CYDA 3CLOA 1A35A 1W0TA 2N8GA 5LBQA 5F64A 3VYRB 4S05A 3OMYA 4P96A 1SD4A 3R6SA 4ZYEA 1V4RA 2XB5A 3NRVA 3JRFA 1OKRA 1XTAA 2P6TA 1XG1A 3S1QJ 3HOVJ 4MEYF 3LSMA 4CA0A 4KITB 4WB3A 1IN7A 2GAUA 3T5XA 2OTJI 4FX0A 2XGEA 5CQEA 1MMAA 2QQ8A 4OMYA 2P5VA 2K86A 1H9TA 3QPHA 1T95A 3TBIA 5F0HA 5HLTA 2FBKA 4CUGA 4OOIA 1LQ1A 3HUGB 3TEDA 2A73B 1Z7UA 3FKJA 2LSOA 4BE1A 1RKWA 4M6YA 3MVPA 3ZP5A 5CVJA 2FA5A 5FKOA 1YRNA 1S5LC 3H92A 5HNHA 2K9QA 5CJ9A 2R7DA 1K78A 3Q0UA 1V5EA 2A07F 2HKOA 2V1NA 3ZQLA 4MTDA 4JYKA 2Y2ZA 2UUZA 2L5QA 2KDZA 1GXQA 1T33A 2FNPA 2ZXWH 4L0YB 2IS1A 1Z6TA 5JPNB 3U21A 1F43A 1YIOA 3DFGA 3CCUI 1XPXA 4NB5A 1R00A 2ACJA 3KP2A 3TOAA 2BHZA 2IW5A 3ABTA 4LIVA 5HLIA 5EJCA 1OYYA 1XX5A 4NQWB 1U9NA 4BJ6C 3WTTC 1AKHB 3JAMZ 3BQZA 3RQ4A 4F52A 5BOXA 2IXSA 3WGHA 3DKYA 3ZQFA 1Z1DA 2M2EA 3BTJA 3CDHA 1HC8A 2LFBA 2MD5A 4RA2A 5F04A 3BROA 3G1OA 3DEWA 1B72A 2R5YB 3U2RA 3W6KB 4C3JJ 2EJRA 4KIGA 1DQUA 1OMIA 2ESNA 2MYSA 3TL4X 5E1XA 4PGHA 1J9IA 5JLWA 3N05A 1UMQA 2GXGA 1Y0NA 1Z91A 1VI0A 2WV0A 3H5AA 3M9AA 2RKHA 2O8XA 4F93B 4IXAA 5EF6A 2VOPA 1SVLA 2HOSA 1K7AA 4DIQA 1XGOA 4DZJA 3ZQCA 2Y0SN 4M72A 1YFHA 3DPLC 2HDCA 3M4OJ 3F6OA 4RB3C 3OYBA 1P7JA 3K4MA 3F21A 3J7YJ 1IG7A 3VPRA 2WY8Q 1WI3A 3GTJJ 2ID3A 3MZ8A 5DYMA 1JUPA 4HQMA 2O8KA 2B0LA 3L1PA 2WADA 2CRGA 4BU2A 2PX9A 2JSPA 3A4CA 4DOZA 2PJRA 1LFPA 1WVRA 4LITA 2KMUA 3M1CA 4WXHA 2H8WA 2HVQA 2EK5A 1FBQA 3SFIA 3A01B 2JQ7A 3L09A 1TWFJ 1WJEA 2RVCA 2JA6J 2FOKA 5M3FJ 4XOTA 2M8GX 2Z9OA 1XDUA 3HSRA 5HDKA 4XKBA 3F8CA 2QLZA 2NS0A 5JHUA 1MD0A 4Q5SF 4A3EJ 3RZOJ 5FKLA 3CQZJ 4CHUA 2A61A 3M8FA 1T0FA 2CFXA 1XN7A 5J1UA 2AXTC 4CYCA 4GXOA 3HL2A 1YTYA 3FXQA 4RAFA 5DCFA 2NS8A 4ESJA 2E1CA 2WB1N 3BG6A 1QGPA 2GOXB 3I64A 2OQRA 3PQJA 3ZMSA 1U78A 1D8JA 1PP8F 4LG0B 1FOWA 3WTZA 3BR6A 3SFZA 2VXDA 1SFEA 4M3FA 4RAZA 4BJTA 4I7HA 3HOYJ 4BDYA 4QWQA 4E7SA 3PO3J 1P9QC 4J00A 3WU1B 4A3KJ 2JUCA 4AU7A 2VC0A 1S9HA 1EF4A 5IOYA 3H0DA 1XGMA 2EWNA 3ASNH 1FLIA 2LH9A 5CVIA 2KRCA 5K1YA 2XVCA 4A5NA 3EYYA 3GTKJ 4Y15A 3QODA 2GOMA 4L0ZB 1G4DA 1R1VA 4ITVA 3CCVI 2V9KA 4FXKB 1NK2P 2R7FA 4WB2A 2W48A 5HDNA 1ZLKA 3I9V2 4IHWA 3DWLE 4B44A 5K5OA 3OYFA 4I01A 2E19A 4DQ2A 2DA2A 2JA2A 2Z3YA 3GLXA 2FMYA 3A02A 3LSJA 1ZKGA 2VKVA 5FO5A 1IDZA 3C3WA 3BLYA 2W57A 4UVBA 1LVAA 4LK1F 3TQNA 5BPIA 3W2WA 3EUKL 4BJ5C 2LY9A 5IOZA 9ANTA 3GBGA 4OIPF 4IX7A 3ERED 1H0MA 1HW5A 2G7UA 2X6WA 3RKXA 1LEAA 2VPRA 3KEYA 3AG2H 1LE8A 4OAZA 3TP0A 2XKPA 3AG4H 3LA3A 3LWFA 1UHMA 2JPCA 3ZMDA 1IN5A 4RLQA 1T08B 4Y33A 4E7ZA 5E18F 1FPQA 5IT3A 1STZA 3F72A 5B1AH 2K9MA 1Y39A 1HSJA 3MKWB 4RGRA 3OYLA 1YLFA 1I6XA 1XMXA 5AONA 1R71A 1Z77A 3DKWA 3HZJA 5C3EJ 2RNGA 2Q2EA 3PQKA 4W1UA 2LOOA 3RPUD 2DLLA 3HTSB 1Y1VJ 3WODF 3OYNA 4ABZA 2RDPA 2CUJA 1LNWA 3QYFA 1A6QA 5E3NA 3GX4X 2PMZN 2MBFA 4C2UA 4LMYA 3I71A 3PUFA 1MGTA 5CVVA 3DQVC 5IYCJ 1YW8A 1BJAA 3E1SA 1G3TA 4KFCA 1QU3A 1DPUA 5J8FA 1SEUA 2VL8A 2MH2A 2A6EF 1ZG5A 3TW6A 3S2WA 1DU6A 3T8TA 1XD7A 1VQMI 2DFFA 2IJLA 2ZNZA 3OV8A 4U87A 4S0HB 1IDYA 1EV7A 1OCPA 2LP0A 2HXIA 2FD5A 1K79A 3BZCA 4S04A 2ZKZA 4RLFA 5FFZA 2YUSA 3FIWA 2COMA 2L4AA 4YRVA 4FTHA 1B6AA 3J81Z 2Z99A 1FJLA 3L7WA 1Y56A 2OCCH 2V1XA 5DCMA 5D8KB 1SANA 1IV6A 2IS2A 1WWXA 5EEAA 5D4RA 2FF4A 3FBIB 1XSXA 2O03A 5J40A 1Z21A 4RM2A 4BQQA 2YSRA 4YFNF 5E3LA 4HX4A 3M1EA 2DYRH 4C30A 1LB2A 1Y0UA 4DGWB 2JK3A 4XSZF 4EGZA 1JKPC 1E3PA 2MC4A 3QPLA 1AOYA 4E7IA 1FC3A 3ERMA 5ICFA 1JHFA 3S1RJ 4G7OF 3RKYA 1XSVA 3T8RA 4L9VA 4L18B 5AIPA 2B63J 2AQEA 1JKQC 2K9LA 4Y3OA 4KA4A 2ADUA 4GCVA 1U8BA 4HYEA 2I5UA 2VQCA 1D0XA 4OIRF 1Y1WJ 4HLXA 1GVDA 2A69F 2XAGA 2ZSIB 3FX3A 1TWHJ 3I4PA 3IHUA 4GYGA 3V7CA 4D7NA 3BTCA 3HGGA 2W84A 3Q9VA 1SD7A 1I5ZA 3CMEI 5HLGA 1HA8A 2EFPA 2ZJRF 2HDWA 2L0KA 3K70C 2WC2A 1R9TJ 1OQYA 1RPWA 1YW9A 2M30A 3ABKH 3F8MA 4L9TA 4C9YA 2VONA 2JWTA 4G6QA 3CF5F 3ECOA 2I10A 3SZPA 2OU2A 1V54H 3ABLH 3S32A 2A3SA 2HYFA 1U5TA 2DQRA 1ZHFA 3GZ5A 1ZN2A 5DM7F 4PZJA 2O6GE 3DP7A 1ETYA 1TW2A 1BM9A 3PIOF 4IHTA 1GDTA 4ENNA 2OJED 3T0YA 3GO5A 4BL0B 1FT9A 2LVSA 3CMMA 2XDVA 2VKEA 2X1EA 2FQ4A 3WTVC 2PG4A 2QENA 5CVUA 1LFBA 2NVQJ 1W5TA 5JI6A 1VQ5I 5FLVA 1BR4A 4RB0A 1R58A 2LDUA 5KNLA 5GPCA 5DS9A 4IZZA 1JJ6C 2RN7A 1RI7A 4CYCB 1U3EM 4RS8A 2EPFA 1ORKA 1JGGA 3KP5A 3I58A 4B4CA 4FASD 2O5RA 2E1NA 4FISA 3TO7A 1I50J 3CP2A 3TMOA 2R92J 1TQPA 2FQ3A 1UZCA 3KP3A 5D6FA 3DPTA 3CU7A 2JPBA 1J2XA 4QPQA 3UNGC 1BI1A 1T0FC 1F1ZA 2F4MB 2K5CA 4CCNA 3BZKA 3HSFA 4KYWA 2G7HA 3K69A 3HOTA 3CCMI 3KCCA 3GYHX 3IAS2 2E2JJ 1SAXA 2CUZA 1J09A 1OPCA 4XN3A 2VBYA 2NOJB 3RYRA 4RGUA 1J59A 3BG5A 4PSWA 2CQ7A 1MBJA 3BT9A 1GV5A 2JMWA 4HV6A 1WKMA 4F92B 1D3YA 4FX4A 3TP3A 3AG1H 2HVSA 1X3ZB 2JTVA 4BE0A 4CGZA 1M1EB 3JRAA 4A3DJ 3Q3SA 3S2DJ 4HLYA 2EV6A 1KA8A 4CICA 1B59A 1FYMA 3W6VA 3HRSA 3V8JA 1RR8C 5DD8A 1KU2A 3CC2I 3U9GA 1WZ2A 3KZIC 2ICWG 1Z7LA 2Z2SB 4ZDLA 3J7AO 5L3EA 4BQAA 1IF1A 1B9MA 2PN6A 4IQ4A 2Q0OA 2KIFA 1DUXC 1UJ8A 4IL6C 3PM1A 2HTJA 3ZQQA 5KVRA 2EFOA 3SJMA 2QSGX 4LLNA 3WU2C 4DJAA 2W24A 2A6TA 4FETA 2OTLI 2VQLA 4WF2A 2X51A 4ZH4F 4BKXA 3JREA 2Q2EB 2WTEA 2KIMA 3HOZJ 1D0YA 2VLAA 3CC7I 1BJZA 3S2HJ 3BJAA 2BOLA 3WU0A 3I5UA 1POGA 4NQWA 1AKHA 4UVCA 2MLGA 1VFCA 4E6KG 3LSPA 1YJ9I 1HF0A 1S3JA 1VF9A 2BY0A 4A0ZA 2LYCA 1ETVA 1R5HA 5LD2C 1IRGA 5K7ZA 2JN6A 2E5NA 2ETHA 1APLC 2XIGA 2EIMH 1L3LA 4LLLA 3FBNB 2EFWA 3A2KA 3PNYA 4L5IA 3ZN1A 4FCYA 3D5LA 1MBKA 1ODDA 1J5YA 3V42A 5H2FC 5ICEA 2DTZA 3ZPLA 2BZTA 3R60A 2DOFA 4G7ZF 2R5YA 3CCSI 1WJAA 2NS7A 1VZ0A 1IJWC 1ETXA 1WHUA 3V4GA 4BNCA 1KQ0A 4HNTA 1B9NA 1VQPI 4M3EA 2KRFA 4BEHB 5DCMB 5F1RA 5ERIA 4BY7J 4QLCU 3WTWC 2KT0A 1IV8A 2XKOA 3GTMJ 4EM0B 1HOMA 5H6QA 3TW7A 2LLKA 2DA7A 2E1MB 4JK1X 1LPQA 2DMUA 5F0CA 2NXNB 4A69C 2R7UA 2B7EA 1UFMA 3H9QA 2BV6A 3J81K 3HXLA 3F22A 2HVRA 2WBMA 4IVNA 2EIJH 2JSCA 5F1JA 3C18A 3F0CA 2QKMB 4RGXA 4B48A 4MNUA 2E1MC 3R0AA 4E70A 1N25A 4M3GA 3IUOA 4IHVA 1HKTA 2TCTA 2H6BA 2Z5UA 3CZ6A 1IO2A 1RRJA 2X6YA 3QP6A 4CSWA 4YELA 4I76A 2M3AA 2V1DA 3A1YA 2EILH 5JLXA 1JGSA 2VC1A 2M7AA 1DPRA 1JTYA 4B43A 4LJZF 4PJJA 1LKXA 2HZTA 1E17A 4LFUA 2L2OA 3JRDA 3FMRA 1ZG3A 5C44J 1ZG1A 4OAYA 3H1CA 3GFLA 3RTRA 4BGDA 3CCQI 1XC5A 1DU0A 3IAM2 5LRRA 1ZRCA 2ME6A 4I0BA 1KU9A 2OUMA 4P3BA 1W5CC 2DQLA 4E7KA 3CCEI 2MD0A 2W00A 1GLNA 5F6FA 3F8NA 3KP7A 4NC6A 4MTEA 3JR9A 4U7DA 2JA8J 3ASOH 5LEJA 1JKOC 2D1HA 2O7OA 1Y6IA 2COBA 5IT9Z 1A6IA 4XLPF 3S3MA 3HQAA 1WH7A 4UVAA 2KL4A 3FM3A 3E7LA 3K10A 2R3SA 1UHWA 2EB7A 4BHPA 1FYKA 2ESHA 1QPIA 3S8PA 4FHTA 4M74A 1AU7A 2BW3A 5KK1A 5IY5H 3FXMA 2HOEA 4YIRX 3O8HA 1AA7A 1VNDA 2JRMA 2M45A 5DUIA 3CF2A 5B1BH 1Q1HA 4AVPA 1W7PB 1Q1VA 1UB9A 3S1MJ 4BDZA 5A2QZ 3HRTA 1YO5C 3BCAA 2LRDA 3G73A 2NNYA 1QNTA 4E7JA 5E1WA 1XDSA 1WGXA 1IXSB 3MZYA 2XRLA 2DPDA 1U0JA 1MJ9A 1X1DA 4I0AA 4P5OA 3TDUC 1R5ID 4CCKA 3HKZA 1G3YA 1REPC 2J5PA 2IGKA 3DTIA 5FROA 4BYYA 3V7RA 4LIUA 2W7NA 4B1RA 2VXZA 3PJRA 2CQQA 2ECBA 5ILSA 2DFEA 4XMYA 4AUXA 5J4YA 5JVGF 3CESA 4BY1J 2Y0MA 1IGNA 2CH0A 1KONA 2DW4A 3JRIA 3S17J 3BZ6A 3K4KA 2UWMA 2FBHA 4LK0F 4HRIA 2RREA 3L9FA 4I99C 2VKDA 2V6EA 4ZYGA 4NDLA 3LNQA 1Z3XA 2J5OA 2QQBA 2X48A 2VE8A 1MBEA 2YX4A 2ECCA 1CF7A 2YS9A 1WPKA 2JZYA 4I98B 3A03A 3CDLA 2K85A 1HQCA 2WAQN 1XGSA 1X58A 1G2HA 1SFXA 2DDAA 2KJBA 2GZWA 2MABA 3KYLA 1QHGA 1S29A 3FWEA 1HDPA 1LDJA 4KISA 1QPMA 4RMNA 1JT0A 3J80Z 1TLHB 3FHNA 2P4WA 1FOXA 1UG2A 1QZYA 1MZBA 4B47A 2R7QA 5EEGA 4IQJA 4W97A 1LDDA 4JX4A 5FD6A 3JRGA 1ETOA 2V1UA 1IRXA 1V55H 1RIOH 1QZEA 3IP4B 4B3AA 1VQ8I 1WJBA 3H5NA 5HOOA 4ASNA 3ZCOA 4HNVA 1KYZA 3FM5A 1IRZA 1KJSA 1HW2A 4HX7A 5FB2A 4XRSG 3WE3A 4EVIA 3BDDA 2X1DA 1FTTA 3KEOA 4U7BA 4GGGA 5EZGA 3W3CA 1OCTC 2X4HA 3MKYB 5EYRA 2P5LC 5TRDA 4OINF 1R4MB 3LSKA 2M87A 2ZMEA 2M5WA 2ELHA 1JTXA 2GA1A 3P9CA 1ZR2A 4XORA 2XF5A 5FRNA 1B8IA 2KISA 3IWFA 4IO9F 2WWYA 4ESBA 2XV4S 5L3BA 1OJLA 2VJ4A 2F5EA 4PJLA 1SVMA 3H5RA 2IEKA 1X1PA 2P7CB 1RUNA 2XB0X 3H9JA 2M0MA 2PJPA 1Z05A 4EATA
chains in the Genus database with same CATH topology
1NG7A 3C2HA 2R7VA 4YRVA 4GRIA 3K6GA 1Y56A 1W36D 4HNUA 3S3NA 2X1CA 1WJ5A 3OYCA 2IS2A 1MMGA 2R7WA 3K4JA 1BR1A 3L2RA 4XLAA 3FBIB 1Z21A 4RM2A 4BQQA 2XAUA 3MMYB 4C30A 4DGWB 2KLOA 2LBFB 3I3LA 2KDOA 2MC4A 3SEZA 4BE2A 4H4KC 2FUG2 4E7IA 2LC2A 2IGNA 1D1CA 4XQFA 4XKVA 1DGWY 2AQEA 3FDYA 4PSXA 2K9LA 3AFHA 1OR7C 4Y3OA 3OYKA 1X1CA 4B3XA 3DTKA 2IGOA 3AKZA 2HNHA 4XLHA 2KHMA 3OIPA 3K4BA 2XC7A 2VQCA 1D0XA 2X6XA 1PYVA 3RCOA 4F91B 2ELJA 2ZSIB 4ZTJA 1WFXA 4DBRA 1PJRA 2CMPA 2R7TA 1JI8A 4HSRA 2IS6A 1HA8A 2HDWA 3K70C 4BUPA 2V26A 4JOMA 2UV1A 3MD2A 2L9SA 4C9YA 3OYHA 2KRHA 2M4KA 4LG3A 4OWRB 5CKTA 3OS2A 3QYBA 3S32A 3KX2A 3ZR8X 2CW8A 3VSLA 3EUHC 1W36C 4BQOA 2BW3B 1TZLA 4E4HA 1N77A 3AL0B 3LL7A 2Y0SA 3NWSA 4CCLA 3ZGKA 4XLEA 3OS1A 3OYMA 5KHDA 4BL0B 2CFOA 4FXGB 3NWTA 2R7OA 2Z16A 3J7AY 3CMMA 1LVKA 2VJ5A 2XDVA 2X1EA 3OOUA 1K6YA 2DT7B 4PFOA 2QKLB 3MKZA 4NC8A 2ZXIA 2JUGA 2KZVA 3HPHA 2R7RA 1BR4A 3AL0C 5KNLA 3DU5A 3OYIA 2WAFA 4IZZA 1LDKB 2M7BA 3OWTA 3C2GA 1BOBA 4FASD 2O5RA 1BR2A 3CP2A 2KP6A 4NC7A 4XL9A 4II2A 1WJCA 3TMOA 1MW7A 4BXFA 3DPTA 4XLCA 3S93A 3QYEA 3UNGC 4QPQA 4PK4A 1T0FC 2K5CA 4CCNA 1X19A 3UR3C 3DLAA 3HOTA 4NUBA 3IAS2 3DTEA 1OLTA 2CUZA 1J09A 3SDBA 5CPRB 4XN3A 2WB1A 2NOJB 2AQFA 4PSWA 2HZDA 3H35A 4F92B 3ZRGA 3CJQB 2M4GA 2HVSA 4BE0A 1ERDA 3PNVA 3EUAA 4J01A 2WAEA 1E0EA 1UG0A 5HNFA 2VIXA 2RQQA 3CP8A 3DEEA 1YX3A 2VQGA 2V7FA 3QOEA 2XF6A 1D1AA 1WJDA 3BG7A 4BEHA 4XOPA 1Z7LA 2Z2SB 4ZDLA 2WY7Q 3OR1C 3VYUB 3BCBA 4P1WA 2CW7A 2LY1A 2VASA 2KPMA 2R7SA 4IQ4A 2W4SA 2E60A 4DBQA 2HQAA 2HPIA 2WAQA 2VJJA 3G2BA 3OR2C 2F5VA 4E7LA 3ZQQA 3LSIA 3E0JB 3DU6A 4ZDOA 3OS0A 4ZDPA 2WA0A 4C2TA 3PSFA 4DJAA 2I8DA 3L2VA 4QPOA 2A6TA 4FETA 2VQLA 2X51A 4AVZA 2Q2EB 4CZCA 1D0YA 2VLAA 2BOLA 4PUSA 4HG2A 3VYRB 3F9KA 3EPZA 5JHFA 2VB6A 3OMYA 1DGRM 2IS4A 4E6KG 4MLOA 1N75A 2LYCA 5LD2C 1YX5A 2CV1A 4CCOA 2E5NA 3CJRB 4HSTA 4XLFA 3FBNB 3LSMA 4CA0A 3PNYA 4KITB 3A2KA 3D5LA 2PMZA 3V42A 3LFUA 5CQEA 5JPMB 1MMAA 4PJMA 1WJAA 3SYTA 1VZ0A 4HNTA 1T95A 3TBIA 2DXIA 2R7XA 4BEHB 5HLTA 2ZXHA 4CUGA 3LSGA 3HUGB 4XN0A 3HPGA 3FKJA 2XSJC 1X1BA 1SFKA 4BE1A 4XKWA 4XONA 2E1MB 2E5ZA 5HNHA 2V4JC 4E7HA 2R7UA 1WJFA 1V5EA 3H9QA 2V1NA 3HXLA 2HVRA 2WBMA 2UUZA 2L5QA 4R79A 3L2WA 2IS1A 2QKMB 4B48A 3U21A 2CV0A 2E1MC 2MFZA 2HPMA 3IUOA 3OYDA 3DPUA 2P0WA 2JVGA 3CZ6A 4LIVA 2L7KA 2X85A 2X6YA 3D5RC 4CSWA 4NQWB 4BJ6C 4YELA 2L9NA 3HOSA 2M3AA 3A1YA 1MNDA 3RQ4A 2VKHA 4F52A 1ZELA 2IXSA 3OY9A 2M7AA 4BACA 3DKYA 4B43A 4AYBA 4PJJA 2LBFA 1LKXA 4YEJA 3PFYA 4ANJA 2L2OA 4N4OB 3HC7A 2XF7A 4OAYA 4ZYAA 3RTRA 4BGDA 1NG6A 3OYJA 3IAM2 2DCEA 1UAAA 1DQUA 3VYSB 4XR6A 3VSKA 3K4NA 1FMVA 2OUMA 2MYSA 3TL4X 2DOAA 4E7KA 1D1BA 2F4IA 3N05A 2MD0A 2W00A 1GLNA 3PUBA 2JVHA 3H5AA 4F93B 3VDXA 2OC6A 4PFPA 4DIQA 1X1AA 4CCJA 1Y6IA 3S3MA 3DPLC 4CH7A 2F6CA 2KL4A 3OYBA 3K10A 3K4MA 4F55A 1TT0A 2WY8Q 4X0GA 1MMNA 3PL8A 3LSHA 3S8PA 2W82A 2WADA 2BW3A 4BU2A 3SEQA 3A4CA 2JSPA 4DOZA 2PJRA 1LFPA 4LITA 3OIQA 3OYAA 2KQRA 2KMUA 2BVLA 3K4LA 3M1CA 3PSIA 1AA7A 2HVQA 1EA3A 4CCMA 3OL3A 5KCMA 2Z1DA 2CS3A 1WJEA 3CF2A 4XOTA 4XKBA 5LFAA 4BDZA 1G59A 3SZGA 3BCAA 2LRDA 4E7JA 4JQFA 3ZXSA 3HL2A 3LMMA 1U0JA 1X1DA 4P5OA 4CCKA 1D0ZA 3BG6A 2GOXB 3HKZA 1X4PA 3VWBA 2Q1ZB 2IGKA 3DTIA 2R4GA 2VXDA 5FROA 2DJIA 4BJTA 3OYGA 4LIUA 4BDYA 4E7SA 2W7NA 3ONQA 1FMWA 1QHHD 2VXZA 1P9QC 3PJRA 3K4CA 4XMYA 4J00A 4ZJZA 4ZTFA 2VPLA 3CESA 4XM3A 2CH0A 4D9JA 1KONA 1MMDA 2ZSHB 4AU7A 1V5GA 1S9HA 5TGTA 3H0DA 4KJZA 3K4KA 2ZFUA 4XKCA 2K3PA 2UWMA 2LG4A 1SAUA 2LH9A 3OL4A 2RREA 4F3QA 4HRIA 2VKDA 2KRCA 2V6EA 1Z3XA 2A5WA 3QODA 2GOMA 4ITVA 2V9KA 2BVMA 3I9V2 4KT6A 3DWLE 3RSNA 4B44A 2PJRB 2IGMA 3OYFA 2JA2A 3KYLA 2MABA 1QHGA 3HG9A 3BLYA 3S3OA 4KISA 4RMNA 1Z3YA 3W2WA 3EUKL 3FHNA 4BJ5C 2CV2A 3L2UA 3GBGA 4IX7A 2HU9A 2X6WA 3BC8A 4N4NB 4RM3A 4BS9A 5FRMA 4NNJA 1DP3A 2LY2A 4B47A 1G8XA 2R7QA 2OV7A 4XNFA 4IQJA 3KEYA 4OAZA 1IRXA 2VJIA 4RLQA 4IKFA 4G6TB 3IP4B 1WJBA 4Y33A 3H9GA 4E7ZA 1YE9A 3H5NA 2W1OA 5HOOA 4D1QA 3ZCOA 2K9MA 1V5FA 3MKWB 3OYLA 4HEA2 1MNEA 3M8JA 2X1DA 2RNGA 3RPUD 2LOOA 4U7BA 4II3A 3W3CA 3PNTA 3OYNA 3L2QA 3MKYB 2CUJA 3QYFA 3VYTB 3OYEA 4C2UA 3LSKA 4PJNA 2VQHA 5HVQC 3DQVC 1UELB 2LREA 1X4OA 3E1SA 3W2AA 3DKXA 1QU3A 2VL8A 4XORA 2XF5A 5FRNA 5CQGA 4ZC3A 4HPQA 4BQNA 3K70D 4U87A 2VJ4A 4PJLA 3D5SC 3W2VA 3H5RA 1R6RA 4Y4RA 2DT6A 2M0MA 3H9JA 1N78A 4RLFA 4EATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUS A;  1AA7 A;  3MD2 A;  2Z16 A;  1EA3 A;  5CQE A;  4IQ4 A;  4D9J A;  4ITV A;  3VDX A; 
#chains in the Genus database with same CATH topology
 4RAY A;  3KE2 A;  4IOA F;  4AIK A;  2OZU A;  4DYQ A;  1W36 D;  2BHY A;  3S3N A;  3BWG A;  2X1C A;  1NK3 P;  2OAZ A;  3OYC A;  5FKM A;  3MN2 A;  2W25 A;  4XLA A;  1PVE A;  2HXO A;  2CU7 A;  2OD5 A;  5D5X B;  2XAU A;  5K7F A;  3LFK A;  5CYV A;  3MMY B;  3IL2 A;  1KYW A;  1NHA A;  3CMY A;  4EJV A;  1IXR C;  2KLO A;  3HOU J;  5J1R A;  2YPR A;  3MCZ A;  3QPS A;  2FUG 2;  2MC3 A;  3VOD A;  1D1C A;  4XKV A;  1YIT I;  1DGW Y;  3FDY A;  3WTY C;  3AFH A;  2DDB A;  2HFH A;  1FX7 A;  1ON2 A;  1X1C A;  2ZNY A;  3O2P E;  3AKZ A;  2IGO A;  4HWJ A;  2F4O B;  3OIP A;  4L5J A;  1FSE A;  2XC7 A;  3IKT A;  2X6X A;  1PYV A;  2KFD A;  1WFX A;  4DBR A;  1PJR A;  4M3D A;  3GVA A;  2H1K A;  2R7T A;  1JI8 A;  2IS6 A;  1ZAR A;  2DBB A;  1FZP B;  3K1P A;  1IZ1 A;  5FLX Z;  5HS7 A;  3E97 A;  1JE8 A;  3WE2 A;  2V26 A;  2UV1 A;  5E20 A;  2XAQ A;  1H89 C;  2L9S A;  4A3G J;  3ISP A;  5KAF C;  4HBL A;  4EMS A;  5TJJ A;  2YX7 A;  1HKQ A;  3K0L A;  3HJE A;  3QYB A;  3BTL A;  5LLQ A;  3ZR8 X;  2RC4 A;  4B09 A;  3HOW J;  3GTG J;  2BW3 B;  3FXU A;  4E4H A;  1OYW A;  1N77 A;  2EA4 A;  4GYI A;  3OYM A;  2DMN A;  2Y0S A;  4IRH A;  4FXG B;  3OS1 A;  5KHD A;  3COA C;  5D6E A;  5IT9 K;  3KZZ A;  4KMF A;  1Z9C A;  4M9Z A;  2H27 A;  2O0Y A;  2E2I J;  4ESF A;  4PFO A;  2CUE A;  4EGY A;  4MGR A;  5HOD A;  4C2M J;  4NC8 A;  1IXC A;  2LD5 A;  2MW8 A;  3OSF A;  3HPH A;  3HYI A;  3MEX A;  3DBR B;  3A0B C;  1EH8 A;  2R7R A;  2PEX A;  1BL0 A;  3BP8 A;  3OYI A;  1A5J A;  4BBR J;  3IH3 A;  2K02 A;  3OOP A;  2RAE A;  1BOB A;  5DV5 A;  4KNY A;  2EQR A;  2VOO A;  4I02 A;  2A5Y B;  1FOY A;  3CMA I;  1TNS A;  5HS8 A;  1MBH A;  4II2 A;  1WJC A;  1MW7 A;  2CQK A;  4WXC A;  3RKQ A;  2ZCW A;  2L7Z A;  3BR2 A;  5A2Q K;  4MQV A;  3UR3 C;  3EDP A;  4BAY A;  2VBX A;  1W1W E;  3FXL A;  1SC7 A;  1OLT A;  1K61 A;  3GTP J;  2WB1 A;  2QEX I;  2ISY A;  4H0E A;  5FFX A;  3BJ6 A;  1EH6 A;  1MKM A;  1BW6 A;  4ZYH A;  2ZBK A;  2NNN A;  3G71 I;  3BR1 A;  5FJ8 J;  1YQA A;  3DXJ F;  1ERD A;  2DFI A;  3GZN B;  1TWA J;  3EUA A;  3FXO A;  5D8L B;  1CF7 B;  1E0E A;  3SZT A;  1BC7 C;  3RIR A;  1H9G A;  2RQQ A;  3BTI A;  2R5Z B;  3I54 A;  3FXK A;  3QOE A;  2XF6 A;  2QCO A;  4M6X A;  1WJD A;  2QGU A;  2B39 A;  4BEH A;  3RPQ A;  1LEB A;  3ROU A;  4PGG A;  3ZQG A;  3OR1 C;  4WK8 F;  1IAW A;  3NAU A;  1YS7 A;  2H94 A;  2PI0 A;  4R8H A;  1WI9 A;  2VAS A;  2KPM A;  5J4V A;  2DOE A;  5EDN A;  2P6S A;  2W4S A;  3IH4 A;  1ZYR F;  3FZV A;  1QVU A;  4F91 B;  2JA5 J;  1FNN A;  2OBP A;  2K27 A;  3GFI A;  3CDI A;  2HYJ A;  3IWZ A;  4L9N A;  2DOD A;  2XAF A;  3LSI A;  4E7L A;  3E0J B;  2BE5 F;  3OS0 A;  1JUM A;  2IA1 A;  2VUM J;  3KP4 A;  4DNC A;  1XMK A;  2DA5 A;  1XMA A;  3O8G A;  2I8D A;  4IHS A;  4Y13 A;  2VT3 A;  2HQR A;  4ZZD A;  1XGN A;  1VQO I;  3EQL F;  3TO6 A;  2RGV A;  3PFI A;  4DW6 A;  1B1B A;  1MJA A;  2HR3 A;  2QQA A;  1P2F A;  2CO5 A;  1I3Q J;  4KIB A;  2ID6 A;  3JAM K;  1K83 J;  2OA4 A;  4QIW N;  2HDD A;  2ZME B;  3F9K A;  3EPZ A;  3F8F A;  3ZMZ A;  1BI2 A;  4D5F A;  2IVM A;  5JHF A;  2IS4 A;  1FIP A;  1N75 A;  5CLS A;  5L3D A;  5ILV A;  3GTL J;  1ZTR A;  1B4A A;  3K1N A;  1B8I B;  2DMT A;  2CV1 A;  4IHY A;  2DYS H;  5LGU A;  5EEH A;  5EG0 B;  2L3D A;  4HST A;  4XLF A;  4OMZ A;  1T38 A;  1YOV B;  2L01 A;  2PMZ A;  2ZME C;  5GTI C;  1U9O A;  2E71 A;  3LFU A;  3WTU C;  4A3B J;  4CZZ A;  3SYT A;  1PUF A;  4EQQ A;  4O6J A;  3ZQ7 A;  2DXI A;  1ZK8 A;  3MFK A;  2R7X A;  2QZ8 A;  2B9S A;  2ZXH A;  3X2Q H;  1XB4 A;  5HLH A;  3DEU A;  3WGG A;  4UB8 C;  1XCB A;  2XSJ C;  1X1B A;  5GAG J;  4WCG A;  1QA6 A;  2PQ8 A;  3RJP A;  2QF7 A;  4XKW A;  1TBX A;  2IPQ X;  4XON A;  3ZMV A;  4WWC A;  2ZXJ A;  3LST A;  4E7H A;  2VI6 A;  3I56 I;  3V7S A;  3RI4 A;  2QSF X;  4U88 A;  2FML A;  2XGX A;  1ZQ3 P;  3FK6 A;  1O3S A;  4Q48 A;  2VE9 A;  1KU3 A;  4ENK A;  5E8I A;  1MSF C;  1U2W A;  3Q0V A;  2MFZ A;  4OIO F;  1ENH A;  2BY3 A;  2DO7 A;  3OYD A;  1GVJ A;  1SVO A;  2BXZ A;  2JVG A;  1IW7 F;  1ITY A;  2L7K A;  2X85 A;  4KN4 X;  3CCY A;  2EV5 A;  2L9N A;  3WG9 A;  3RPU A;  1MND A;  1W7P A;  2KZG A;  1P4X A;  1RES A;  4AYB A;  1R5G A;  4D7M A;  3C7J A;  1OCZ H;  2EH3 A;  1TWG J;  5IYD J;  3PFY A;  4KT5 C;  1PP7 U;  3HC7 A;  2QSH X;  4DZP A;  1RZ4 A;  3DF8 A;  2A6H F;  1H88 C;  2XF7 A;  2FU4 A;  2O61 A;  1O4X A;  5L3C A;  3HB9 A;  4ZYA A;  3RZD J;  3CJN A;  5LEK A;  3OYJ A;  1UAA A;  2DK8 A;  2JA7 J;  2R7Z J;  2GIZ A;  4XR6 A;  3VSK A;  3GTQ J;  4AID A;  3G6E I;  3I53 A;  4EJU A;  2DU9 A;  2QA4 I;  2EIN H;  2D5V A;  3E5X A;  3FMS A;  3LQQ A;  5FLX K;  3PUB A;  4HW5 A;  2GBY A;  3HTU A;  3Q5F A;  2JVH A;  2MG4 A;  3V8K A;  2FX0 A;  3ZQI A;  2MLK A;  2OC6 A;  4PJ0 C;  2IA0 A;  1X1A A;  5HS9 A;  2KIU A;  2RQP A;  4R1H A;  3JCU C;  5GPA A;  4CCJ A;  4UY8 I;  1GT0 C;  3N97 A;  2GWR A;  2QWW A;  4HX8 A;  2CYY A;  3H0G J;  3FKI J;  5E79 C;  2DAO A;  4F55 A;  2CUF A;  2H1L A;  4X0G A;  3FHZ A;  3CJT B;  3PL8 A;  3U1K A;  4MEX F;  2W82 A;  1T2K A;  1JT6 A;  3WGI A;  3SEQ A;  3QQA A;  4JX5 A;  3D1N I;  3OIQ A;  3OYA A;  2BVL A;  3PSI A;  1X3U A;  1TL8 A;  1EA3 A;  4CCM A;  2BY2 A;  1I39 A;  5KCM A;  2LF8 A;  1HXD A;  4A6D A;  3O6B B;  3F23 A;  2E2H J;  2CS3 A;  5D5U B;  3FXJ A;  2L02 A;  1X3W B;  4LLG F;  5IP7 J;  3KZY A;  4U0V A;  4I09 A;  1G59 A;  1F36 A;  2HYG D;  1R1T A;  2HS5 A;  1O3R A;  2XRN A;  3CTA A;  4HOB A;  5E3M A;  4LB5 A;  4JQF A;  2DA4 A;  3CUO A;  3ZXS A;  4UUS B;  4MO7 A;  2V9P A;  2L4M A;  5ICC A;  3M3Y J;  3ESW B;  1HLV A;  3JRH A;  1QO0 D;  1D0Z A;  3P7N A;  4UNO A;  1BN5 A;  1X4P A;  2E35 A;  4N9I A;  1FWZ A;  3KIO A;  5D5V B;  3IRR A;  2R4G A;  1QZZ A;  3GLL A;  4LB6 B;  5M5Y J;  2DJI A;  4HDU A;  1YJN I;  3ONQ A;  3T1B A;  1FMW A;  3I4N J;  2UXN A;  1QHH D;  2X9D A;  4FT8 A;  2JRT A;  1ZR4 A;  4ZTF A;  1R7J A;  4V19 K;  3QPT A;  1MMD A;  4XIC A;  1V5G A;  2K9S A;  2Y9Y A;  3JRB A;  4KJZ A;  4FE4 A;  2ZFU A;  4XKC A;  2K3P A;  1VQL I;  2NRA C;  4F3Q A;  4D0P A;  2AXL A;  1ZGJ A;  2A5W A;  2XPV A;  4U0W A;  1VTN C;  2VBZ A;  2K4B A;  3MAJ A;  3LQR A;  1R23 A;  6PAX A;  2FJ1 A;  3C1D A;  2IGM A;  2ME0 A;  1BOA A;  4FQG A;  3V8L A;  4A3L J;  1PDN C;  1ACI A;  1TW3 A;  1KZH A;  4EJT A;  3MWM A;  3HG9 A;  2O9L A;  2LK2 A;  2CV2 A;  5HDG A;  4ON0 A;  2NVU B;  2NAZ A;  1UCR A;  1DP3 A;  4N4N B;  4BS9 A;  3WHB A;  3KEQ A;  4XNF A;  5ICG A;  5K5R A;  2A05 A;  2CQN A;  4EV0 A;  2H6C A;  4G8X A;  2BBY A;  4A3M J;  4FE7 A;  1ETQ A;  4IKF A;  1OCO H;  2W1O A;  5EGO B;  2LNB A;  5B66 C;  2IBD A;  3GFJ A;  3BR3 A;  1V5F A;  1DDN A;  3ABU A;  3GME A;  4HEA 2;  3K1M A;  1FEX A;  2GIV A;  1PUF B;  3S14 J;  2Y30 A;  5DD4 A;  1SMT A;  2D1V A;  4II3 A;  1FP1 D;  2ZFW A;  3QU3 A;  3OYE A;  1XS9 A;  3HKZ N;  4PJN A;  1MBG A;  2VQH A;  2O3F A;  1LFU P;  1UEL B;  2LRE A;  4AWX B;  1I1S A;  2UZK A;  2KJC A;  3CUQ A;  1TC3 C;  4HPQ A;  3BG3 A;  4BQN A;  2FBI A;  2QQ9 A;  1ONV A;  5FGM A;  3K70 D;  4GO1 A;  4M3B A;  5H6R A;  4MHG A;  3GXO A;  1JUS A;  3D5S C;  1FIA A;  3FF5 A;  3W2V A;  1R6R A;  1AHD P;  2P81 A;  1NTC A;  3TDZ C;  2DT6 A;  3ULQ B;  4XK4 A;  2XGC A;  4M71 A;  1NG7 A;  2FSW A;  3C2H A;  1FP2 A;  5BPD A;  4RBO A;  3GFM A;  2A68 F;  3AAF A;  1D8K A;  3R4K A;  1WJ5 A;  5E3O A;  2R0Q C;  2E34 A;  3K4J A;  3HGY A;  1BR1 A;  2DPU A;  3L2R A;  3BY6 A;  2XRO A;  1X2N A;  2LTP A;  3HQB A;  3R61 A;  4EEF G;  5LHH A;  3B6C A;  4NHJ A;  4HW0 A;  1P7I A;  4P55 A;  5JR3 A;  1VQK I;  2KDO A;  2RNJ A;  3E5U A;  3SEZ A;  4BE2 A;  4H4K C;  4HF2 A;  2TRT A;  2LC2 A;  2GXA A;  1E3H A;  3BR0 A;  5JFR A;  4PSX A;  1OR7 C;  4B3X A;  2Y31 A;  4V2F A;  2BGC A;  2HNH A;  4XLH A;  3M7G A;  4O5V A;  4BHB A;  4ZTJ A;  1WRJ A;  4EM2 A;  1VQ7 I;  2DMQ A;  1L0O C;  5TIS C;  4A6E A;  1SFO J;  5J8C A;  2HQ5 A;  3P5J A;  1QQI A;  1Z6R A;  4BUP A;  5LGT A;  2EZK A;  3OYH A;  2KRH A;  4OWR B;  4RDU A;  2STW A;  4XLN F;  1ETK A;  3RYP A;  5BQT A;  1SFU A;  4WXD A;  3BPV A;  1OYI A;  2CW8 A;  3VSL A;  1I6H J;  1JKR C;  2DA1 A;  4A3F J;  2BEO A;  1GUU A;  1TZL A;  3QOP A;  5AIQ A;  4Y7N J;  3QRF F;  2R5Z A;  2ZC2 A;  3HHG A;  3LL7 A;  4CCL A;  2HQN A;  3ZGK A;  1BI3 A;  1TT5 B;  4XLE A;  4IOC F;  3F3X A;  3PO2 J;  2R7O A;  2Z16 A;  3J7A Y;  1LVK A;  3EYI A;  2VJ5 A;  4P9F A;  3MZH A;  1OCC H;  1GHC A;  2EFN A;  4GDF A;  2DT7 B;  2QKL B;  2DTR A;  3MKZ A;  3MQ0 A;  2JUG A;  2M1B A;  1J7K A;  1U6G A;  1UHS A;  3JSO A;  3DU5 A;  2WAF A;  2LF7 A;  3G1L A;  3E5Q A;  1LDK B;  3ZMT A;  2DT5 A;  5DEQ A;  1OCR H;  3FMQ A;  3Q9S A;  4LOC A;  1TTY A;  1WH5 A;  2KP6 A;  4NC7 A;  3REO A;  3L2C A;  1VQ6 I;  1S7A A;  5B4P B;  4XLC A;  5FD5 A;  3S93 A;  3QYE A;  2F5D A;  3K2Z A;  3KYD B;  1OFC X;  1P92 A;  2ZB9 A;  2EZI A;  4ENJ A;  1K4S A;  2H8R A;  2YU9 J;  3A0H C;  3TOB A;  1TQM A;  3DTE A;  3HHH A;  1HST A;  3G3Z A;  2DFH A;  1KGS A;  5E1Z B;  2Y48 A;  3LAP A;  1HDD C;  1R4N B;  4BBS J;  3C2B A;  2GLO A;  4IJA A;  4UUT A;  1FBS A;  4IF4 A;  1MNM C;  4UB6 C;  2Y69 H;  3DV8 A;  5EG0 A;  1T39 A;  3NQO A;  2M4G A;  1IN6 A;  3PNV A;  4J01 A;  2WAE A;  5GAH J;  1V3F A;  3M07 A;  4HDV A;  4M9X A;  5GP9 A;  1UG0 A;  3HEF A;  3I4M J;  2OPT A;  3CP8 A;  3DEE A;  1KU7 A;  1YX3 A;  2VQG A;  1ZGW A;  1K4T A;  4F7Z A;  3BG7 A;  3CD6 I;  2BXY A;  2K9N A;  1AWC A;  4LGW A;  3E6M A;  3CO6 C;  1HKS A;  1UST A;  4KIC A;  4HZF A;  3VYU B;  3LSR A;  5IP9 J;  2CW7 A;  4UV8 A;  2IT0 A;  2LY1 A;  3I59 A;  3PIP F;  2R7S A;  1BIB A;  1XSD A;  1JJ8 C;  1MJB A;  2MGQ A;  4DBQ A;  2XPW A;  2QBY B;  2HPI A;  2WAQ A;  2VJJ A;  4JP0 A;  3G2B A;  4AIJ A;  3OSG A;  1TP4 A;  2F5V A;  2EFQ A;  1BW5 A;  3DU6 A;  4ZDO A;  4ZDP A;  2WA0 A;  3PSF A;  3K2A A;  4N9H A;  3L2V A;  2CW0 F;  2FE3 A;  3NAR A;  2LMD A;  2AO9 A;  3WHC A;  2TDX A;  4CZC A;  2EV0 A;  5L3G A;  3QAH A;  5E8G A;  2ZJ2 A;  1TQI A;  5K5Q A;  4PUS A;  5EZH A;  2G0E A;  4HG2 A;  3JW4 A;  2VB6 A;  1DGR M;  2E7W A;  3IC7 A;  4MLO A;  3ZQH A;  4O3M A;  3KET A;  4KDP A;  3CUQ B;  1YX5 A;  4CCO A;  1ON1 A;  3QU6 A;  1F9N A;  3CJR B;  4IRI A;  2VBW A;  3HIF A;  4M6V A;  1RR7 A;  1HCR A;  3GZ6 A;  3IH2 A;  4TV7 A;  2HKX A;  2HOT A;  4CO8 A;  1C5A A;  4IEJ A;  5JPM B;  4G94 A;  4PJM A;  1YIJ I;  4PCQ A;  1ZRD A;  2D2W A;  1PUE E;  3CUQ C;  2NVX J;  2GA2 A;  1O3T A;  2MSY A;  5B3S H;  2NVY J;  5LRS A;  1S7E A;  3LSG A;  4AIH A;  4EJO A;  1TNT A;  2EZH A;  1RNL A;  4XN0 A;  5DUK A;  3HPG A;  1SFK A;  1C0W A;  5DM6 F;  3P9K A;  2DJN A;  3TGN A;  4Q47 A;  2BY1 A;  4AC0 A;  2E5Z A;  3I55 I;  2V4J C;  2CSO A;  4GFB A;  4HF1 A;  3QP5 A;  1CFA A;  4V2G A;  1WJF A;  2FEZ A;  5CVR A;  3B02 A;  4MIM A;  3EET A;  2JT1 A;  1Y8R B;  1FY7 A;  1QRY A;  3S15 J;  4EJW A;  4R79 A;  1T56 A;  3ABM H;  3L2W A;  1R1U A;  4A12 A;  1KQ8 A;  1W4M A;  1A04 A;  4Y17 A;  4A3J J;  1O7F A;  2CV0 A;  3ZN0 A;  2HEO A;  4U0Y A;  1MH3 A;  4JBA A;  2HPM A;  2EA2 A;  3DPU A;  3N4M A;  2P0W A;  3DLL F;  1MBF A;  1F4K A;  1T98 A;  3KYC B;  4QTR A;  3CLQ A;  3D5R C;  4WX9 A;  5D5W B;  3HOS A;  4I2O A;  2PFB A;  3HDD A;  2RV8 A;  2IP2 A;  1YG2 A;  2VKH A;  3NEU A;  3G4S I;  1ZEL A;  3OY9 A;  3AG3 H;  4BAC A;  1WCM J;  3CC4 I;  2LBF A;  1CQT A;  1YYV A;  4YEJ A;  2NYX A;  4N4O B;  4ANJ A;  2L54 A;  3P9I A;  2M9H A;  1Y8Q B;  3IRQ A;  4UUS A;  5E17 F;  3R0J A;  2HTS A;  1NG6 A;  2PMU A;  4MFE A;  2DCE A;  3VYS B;  1USS A;  3HM5 A;  1O7L A;  1W7P D;  2X6O A;  3K4N A;  1MDM A;  1FMV A;  5L3F A;  2MH9 A;  2DOA A;  3I0T A;  2L9R A;  1D1B A;  2F4I A;  4X6A J;  3TO9 A;  2XAJ A;  4RB1 A;  1Z0X A;  1S8N A;  3BQY A;  3EUH A;  4KN7 X;  3VDX A;  1MMS A;  1LJ9 A;  2QYO A;  1BBY A;  3DBH B;  4PFP A;  1YRN B;  3F8B A;  1R22 A;  5JVT A;  1FSH A;  2NVT J;  4K2E A;  4CH7 A;  1K78 B;  3JSP A;  5FLM J;  3SQN A;  2F6C A;  2F5C A;  3TKY A;  5FKN A;  2E1O A;  4X1E A;  4HV5 A;  5BS6 A;  3SDG A;  1TT0 A;  2CQX A;  3HSE A;  1MMN A;  2HWV A;  2VT2 A;  3LSH A;  4KMU X;  2GQQ A;  1A36 A;  3LA7 A;  4Z6Y A;  2JJ7 A;  4N0B A;  2ZJP F;  2KQR A;  3J80 K;  3K4L A;  3H36 A;  2BYV E;  3RKW A;  4ZZL A;  5F08 A;  3OL3 A;  2Z1D A;  4YFX F;  4G7H F;  3OIO A;  5ED4 A;  1BC8 C;  2E36 A;  2ISZ A;  4L9J A;  4P9U A;  2CWE A;  3M8E A;  1H8A C;  4I6O A;  4HQE A;  1I3A A;  3SHF A;  1TWC J;  2EZL A;  4XBF A;  2M34 A;  5LFA A;  2XPU A;  2YR2 A;  3SZG A;  1SD5 A;  4BXX J;  3FXR A;  3U1D A;  4Y52 J;  3KP6 A;  2OF7 A;  3VOE A;  4YIF A;  1EKE A;  1OIS A;  1P6R A;  3LMM A;  1W0U A;  2OCE A;  2F48 A;  1B72 B;  5EGO A;  4AYB N;  3CO7 C;  4XID A;  4L5E A;  4A0X A;  4YFK F;  2HI3 A;  3VWB A;  1F5T A;  1A31 A;  2Q1Z B;  1BIA A;  3CCR I;  2C6Y A;  3KLS A;  3OYG A;  1NH3 A;  1YHQ I;  2ZO4 A;  2LKX A;  2NOG A;  3J7Z I;  1R36 A;  2Q8K A;  4RB2 C;  5DTD A;  1CGP A;  2GM4 A;  2E7X A;  3K4C A;  4JX6 A;  4ZJZ A;  2VPL A;  4XM3 A;  2K4J A;  4D9J A;  3K9T A;  4BH9 A;  2ZSH B;  5LHI A;  1IUF A;  5ILU A;  5TGT A;  1E2X A;  2QUF A;  3I59 B;  4OIQ F;  1YI2 I;  4A3C J;  1S72 I;  2LG4 A;  1SAU A;  3OL4 A;  2R93 J;  2LKS A;  3RQI A;  3CCJ I;  4A93 J;  2CG4 A;  4BXU A;  2DI3 A;  2FOW A;  4EM1 A;  1Z67 A;  3BPX A;  2BVM A;  4KT6 A;  2PJR B;  3RSN A;  3GTO J;  2IRF G;  3KPH A;  2XHK A;  1JXS A;  5H20 A;  4Q4Z F;  4J19 A;  3WG7 H;  1VQ4 I;  1IN4 A;  3S3O A;  4G12 A;  5B5E C;  2PBI A;  5K7H A;  4XRS A;  1Z3Y A;  3F6V A;  2ELK A;  4PDK A;  2V79 A;  3L2U A;  1FBU A;  3JRC A;  2HU9 A;  3VFZ A;  2L9V A;  3BC8 A;  4G6D A;  4RM3 A;  5FRM A;  4NNJ A;  4LD5 A;  5M5W J;  2LY2 A;  3DBL B;  1G8X A;  1K6O A;  2OV7 A;  4CDG A;  1IC8 A;  1ZH5 A;  3S1N J;  1OR7 A;  4XSX F;  2VJI A;  3WTX C;  4KIF A;  4G6T B;  1EH7 A;  3HBL A;  3H9G A;  1YE9 A;  4D1Q A;  2VN2 A;  4C3H J;  1GV2 A;  2L7M P;  5J47 A;  1XCV A;  5KAI C;  1FYL A;  1MNE A;  2G9W A;  2DA6 A;  3M8J A;  1W5S A;  5C4J J;  2OZ6 A;  2K7L A;  1IRF A;  2CGP A;  1SD6 A;  2MA3 A;  3PNT A;  3L2Q A;  3GWZ A;  1G6N A;  1BA5 A;  3VYT B;  1MSE C;  3H3V K;  4HAM A;  3H3U A;  3JTG A;  5HVQ C;  2XAH A;  5DDG A;  2OQG A;  1X4O A;  3LA2 A;  3W2A A;  3HRU A;  3DKX A;  1X2M A;  2PMH A;  2AHQ A;  1WQ2 A;  5CQG A;  4ZC3 A;  4A0Y A;  5C4X J;  4G9Y A;  5IYB J;  3GW2 A;  2AS5 F;  2F2E A;  1ETW A;  1ULY A;  3HRM A;  4Y4R A;  5BNG A;  2UXX A;  3G1M A;  1ZRF A;  2HGC A;  2CJJ A;  1N78 A;  2DK5 A;  5HNF A;  3S16 J;  2R7V A;  3E3V A;  4GRI A;  4M73 A;  2D45 A;  1D5V A;  1JHH A;  3K6G A;  4YII A;  4HNU A;  2IA2 A;  3JTH A;  2L7F P;  4P3A A;  3HUG A;  1MMG A;  4ETS A;  2R7W A;  2DA3 A;  2FRH A;  4HF0 A;  4D5C A;  5GAE J;  3QWL A;  1MIJ A;  1LE8 B;  1T8I A;  1VQN I;  1WSU A;  1QBJ A;  2XAS A;  2LBF B;  4MQ9 F;  4IRG A;  3I3L A;  1U8R A;  5GTH C;  1G3S A;  2ZJQ F;  2EIK H;  3ELK A;  2Y9Z A;  2IGN A;  4XQF A;  2X0L A;  2H09 A;  5J6X A;  2P8T A;  4OU0 A;  4CXF A;  3OYK A;  3BJO A;  3DTK A;  1MDM B;  2KHM A;  4C3I J;  3E6C C;  1HW1 A;  4A3I J;  3K4B A;  1S6L A;  3RCO A;  1VQ9 I;  2LKP A;  5J3L A;  2ELJ A;  2FXA A;  4UXN A;  2PLY A;  2CMP A;  2XSD C;  4HSR A;  1O3Q A;  5D4S A;  2P7V B;  4UU9 C;  5F27 A;  2F5F A;  2IAI A;  4XRM A;  3H3Z A;  5F0F A;  3BR5 A;  1FOK A;  4MFD A;  4JOM A;  3MD2 A;  2V6C A;  2M4K A;  1I1G A;  5LGN A;  4LG3 A;  2VOD A;  2P5K A;  3SXY A;  3ML6 A;  4DYR A;  5BMZ A;  1T6S A;  4IHX A;  5CKT A;  3OS2 A;  3LAJ A;  3KX2 A;  2STT A;  1ZLJ A;  3EUH C;  1GXP A;  2XGD A;  1D5Y A;  1W36 C;  4BQO A;  4XRF A;  3ZOB A;  4DYC A;  3AL0 B;  3FIS A;  2K40 A;  4Z2Y A;  1P4W A;  3GCM A;  3KLN A;  3RDI A;  3NWS A;  5M5X J;  2CFO A;  3NWT A;  1O57 A;  3E6D A;  3OOU A;  1K6Y A;  3GEZ A;  2Z33 A;  3GUD A;  5IP6 A;  4UHT A;  2ZXI A;  3BOQ A;  1YJW I;  2KZV A;  2KKO A;  3AL0 C;  3KLO A;  4KUM A;  4NBQ A;  1E3O C;  1IUY A;  2QBY A;  1FTZ A;  2M7B A;  1RUO A;  4UUV A;  3OWT A;  2WV1 A;  3C2G A;  3GF2 A;  5J1Y A;  1KQ9 A;  4ENM A;  1BR2 A;  3DCF A;  4A2U A;  5IPA A;  4XL9 A;  1SMY F;  4BXF A;  4B8X A;  2W85 A;  1RKT A;  3W6J B;  3A01 A;  4PK4 A;  3WTS C;  1X19 A;  3DLA A;  1ZAO A;  4QSH A;  3HOX J;  3KFW X;  4I6Z A;  1J0R A;  3UKG A;  4NUB A;  4AD9 A;  3VEP A;  3E6B A;  1YS6 A;  2K3F A;  1IN8 A;  5CPR B;  3SDB A;  1YW7 A;  1G3W A;  1I27 A;  1DP7 P;  2AQF A;  1ZGA A;  5GAD J;  2Y75 A;  2HZD A;  5LHG A;  3H35 A;  3VB2 A;  2LR8 A;  3CJQ B;  3ZRG A;  2QVO A;  3L00 A;  1HBX G;  4P39 A;  1U5T B;  2V9V A;  1J75 A;  2DN0 A;  3BG9 A;  4LG0 A;  3IKV A;  2FNA A;  2VIX A;  3FK7 A;  2YU3 A;  3B73 A;  2V7F A;  3ZMU A;  2HOA A;  1D1A A;  4M9S A;  4ZYD A;  4AM3 A;  1ZRE A;  4XOP A;  2GXB A;  2QM3 A;  2WY7 Q;  1U5T C;  3BCB A;  4P1W A;  3K7A J;  2M8E A;  3MKL A;  3Q0W A;  5FKK A;  2XUB A;  4RGS A;  4RAG A;  2E60 A;  2HQA A;  3CCL I;  3B6A A;  3LOC A;  1QVT A;  2DMP A;  3OR2 C;  2KIQ A;  3O3K A;  1RC9 A;  3ECH A;  2EBI A;  1LUJ B;  4BHC A;  4YG2 F;  4C2T A;  4HA8 A;  1BI0 A;  4QPO A;  4UV9 A;  1S7O A;  1R49 A;  1RET A;  3D0S A;  4IPA A;  4AVZ A;  3IV5 A;  4A5M A;  1MH4 A;  5M3M J;  1P4A A;  2M0C A;  1EJ9 A;  4CYD A;  3CLO A;  1A35 A;  1W0T A;  2N8G A;  5LBQ A;  5F64 A;  3VYR B;  4S05 A;  3OMY A;  4P96 A;  1SD4 A;  3R6S A;  4ZYE A;  1V4R A;  2XB5 A;  3NRV A;  3JRF A;  1OKR A;  1XTA A;  2P6T A;  1XG1 A;  3S1Q J;  3HOV J;  4MEY F;  3LSM A;  4CA0 A;  4KIT B;  4WB3 A;  1IN7 A;  2GAU A;  3T5X A;  2OTJ I;  4FX0 A;  2XGE A;  5CQE A;  1MMA A;  2QQ8 A;  4OMY A;  2P5V A;  2K86 A;  1H9T A;  3QPH A;  1T95 A;  3TBI A;  5F0H A;  5HLT A;  2FBK A;  4CUG A;  4OOI A;  1LQ1 A;  3HUG B;  3TED A;  2A73 B;  1Z7U A;  3FKJ A;  2LSO A;  4BE1 A;  1RKW A;  4M6Y A;  3MVP A;  3ZP5 A;  5CVJ A;  2FA5 A;  5FKO A;  1YRN A;  1S5L C;  3H92 A;  5HNH A;  2K9Q A;  5CJ9 A;  2R7D A;  1K78 A;  3Q0U A;  1V5E A;  2A07 F;  2HKO A;  2V1N A;  3ZQL A;  4MTD A;  4JYK A;  2Y2Z A;  2UUZ A;  2L5Q A;  2KDZ A;  1GXQ A;  1T33 A;  2FNP A;  2ZXW H;  4L0Y B;  2IS1 A;  1Z6T A;  5JPN B;  3U21 A;  1F43 A;  1YIO A;  3DFG A;  3CCU I;  1XPX A;  4NB5 A;  1R00 A;  2ACJ A;  3KP2 A;  3TOA A;  2BHZ A;  2IW5 A;  3ABT A;  4LIV A;  5HLI A;  5EJC A;  1OYY A;  1XX5 A;  4NQW B;  1U9N A;  4BJ6 C;  3WTT C;  1AKH B;  3JAM Z;  3BQZ A;  3RQ4 A;  4F52 A;  5BOX A;  2IXS A;  3WGH A;  3DKY A;  3ZQF A;  1Z1D A;  2M2E A;  3BTJ A;  3CDH A;  1HC8 A;  2LFB A;  2MD5 A;  4RA2 A;  5F04 A;  3BRO A;  3G1O A;  3DEW A;  1B72 A;  2R5Y B;  3U2R A;  3W6K B;  4C3J J;  2EJR A;  4KIG A;  1DQU A;  1OMI A;  2ESN A;  2MYS A;  3TL4 X;  5E1X A;  4PGH A;  1J9I A;  5JLW A;  3N05 A;  1UMQ A;  2GXG A;  1Y0N A;  1Z91 A;  1VI0 A;  2WV0 A;  3H5A A;  3M9A A;  2RKH A;  2O8X A;  4F93 B;  4IXA A;  5EF6 A;  2VOP A;  1SVL A;  2HOS A;  1K7A A;  4DIQ A;  1XGO A;  4DZJ A;  3ZQC A;  2Y0S N;  4M72 A;  1YFH A;  3DPL C;  2HDC A;  3M4O J;  3F6O A;  4RB3 C;  3OYB A;  1P7J A;  3K4M A;  3F21 A;  3J7Y J;  1IG7 A;  3VPR A;  2WY8 Q;  1WI3 A;  3GTJ J;  2ID3 A;  3MZ8 A;  5DYM A;  1JUP A;  4HQM A;  2O8K A;  2B0L A;  3L1P A;  2WAD A;  2CRG A;  4BU2 A;  2PX9 A;  2JSP A;  3A4C A;  4DOZ A;  2PJR A;  1LFP A;  1WVR A;  4LIT A;  2KMU A;  3M1C A;  4WXH A;  2H8W A;  2HVQ A;  2EK5 A;  1FBQ A;  3SFI A;  3A01 B;  2JQ7 A;  3L09 A;  1TWF J;  1WJE A;  2RVC A;  2JA6 J;  2FOK A;  5M3F J;  4XOT A;  2M8G X;  2Z9O A;  1XDU A;  3HSR A;  5HDK A;  4XKB A;  3F8C A;  2QLZ A;  2NS0 A;  5JHU A;  1MD0 A;  4Q5S F;  4A3E J;  3RZO J;  5FKL A;  3CQZ J;  4CHU A;  2A61 A;  3M8F A;  1T0F A;  2CFX A;  1XN7 A;  5J1U A;  2AXT C;  4CYC A;  4GXO A;  3HL2 A;  1YTY A;  3FXQ A;  4RAF A;  5DCF A;  2NS8 A;  4ESJ A;  2E1C A;  2WB1 N;  3BG6 A;  1QGP A;  2GOX B;  3I64 A;  2OQR A;  3PQJ A;  3ZMS A;  1U78 A;  1D8J A;  1PP8 F;  4LG0 B;  1FOW A;  3WTZ A;  3BR6 A;  3SFZ A;  2VXD A;  1SFE A;  4M3F A;  4RAZ A;  4BJT A;  4I7H A;  3HOY J;  4BDY A;  4QWQ A;  4E7S A;  3PO3 J;  1P9Q C;  4J00 A;  3WU1 B;  4A3K J;  2JUC A;  4AU7 A;  2VC0 A;  1S9H A;  1EF4 A;  5IOY A;  3H0D A;  1XGM A;  2EWN A;  3ASN H;  1FLI A;  2LH9 A;  5CVI A;  2KRC A;  5K1Y A;  2XVC A;  4A5N A;  3EYY A;  3GTK J;  4Y15 A;  3QOD A;  2GOM A;  4L0Z B;  1G4D A;  1R1V A;  4ITV A;  3CCV I;  2V9K A;  4FXK B;  1NK2 P;  2R7F A;  4WB2 A;  2W48 A;  5HDN A;  1ZLK A;  3I9V 2;  4IHW A;  3DWL E;  4B44 A;  5K5O A;  3OYF A;  4I01 A;  2E19 A;  4DQ2 A;  2DA2 A;  2JA2 A;  2Z3Y A;  3GLX A;  2FMY A;  3A02 A;  3LSJ A;  1ZKG A;  2VKV A;  5FO5 A;  1IDZ A;  3C3W A;  3BLY A;  2W57 A;  4UVB A;  1LVA A;  4LK1 F;  3TQN A;  5BPI A;  3W2W A;  3EUK L;  4BJ5 C;  2LY9 A;  5IOZ A;  9ANT A;  3GBG A;  4OIP F;  4IX7 A;  3ERE D;  1H0M A;  1HW5 A;  2G7U A;  2X6W A;  3RKX A;  1LEA A;  2VPR A;  3KEY A;  3AG2 H;  1LE8 A;  4OAZ A;  3TP0 A;  2XKP A;  3AG4 H;  3LA3 A;  3LWF A;  1UHM A;  2JPC A;  3ZMD A;  1IN5 A;  4RLQ A;  1T08 B;  4Y33 A;  4E7Z A;  5E18 F;  1FPQ A;  5IT3 A;  1STZ A;  3F72 A;  5B1A H;  2K9M A;  1Y39 A;  1HSJ A;  3MKW B;  4RGR A;  3OYL A;  1YLF A;  1I6X A;  1XMX A;  5AON A;  1R71 A;  1Z77 A;  3DKW A;  3HZJ A;  5C3E J;  2RNG A;  2Q2E A;  3PQK A;  4W1U A;  2LOO A;  3RPU D;  2DLL A;  3HTS B;  1Y1V J;  3WOD F;  3OYN A;  4ABZ A;  2RDP A;  2CUJ A;  1LNW A;  3QYF A;  1A6Q A;  5E3N A;  3GX4 X;  2PMZ N;  2MBF A;  4C2U A;  4LMY A;  3I71 A;  3PUF A;  1MGT A;  5CVV A;  3DQV C;  5IYC J;  1YW8 A;  1BJA A;  3E1S A;  1G3T A;  4KFC A;  1QU3 A;  1DPU A;  5J8F A;  1SEU A;  2VL8 A;  2MH2 A;  2A6E F;  1ZG5 A;  3TW6 A;  3S2W A;  1DU6 A;  3T8T A;  1XD7 A;  1VQM I;  2DFF A;  2IJL A;  2ZNZ A;  3OV8 A;  4U87 A;  4S0H B;  1IDY A;  1EV7 A;  1OCP A;  2LP0 A;  2HXI A;  2FD5 A;  1K79 A;  3BZC A;  4S04 A;  2ZKZ A;  4RLF A;  5FFZ A;  2YUS A;  3FIW A;  2COM A;  2L4A A;  4YRV A;  4FTH A;  1B6A A;  3J81 Z;  2Z99 A;  1FJL A;  3L7W A;  1Y56 A;  2OCC H;  2V1X A;  5DCM A;  5D8K B;  1SAN A;  1IV6 A;  2IS2 A;  1WWX A;  5EEA A;  5D4R A;  2FF4 A;  3FBI B;  1XSX A;  2O03 A;  5J40 A;  1Z21 A;  4RM2 A;  4BQQ A;  2YSR A;  4YFN F;  5E3L A;  4HX4 A;  3M1E A;  2DYR H;  4C30 A;  1LB2 A;  1Y0U A;  4DGW B;  2JK3 A;  4XSZ F;  4EGZ A;  1JKP C;  1E3P A;  2MC4 A;  3QPL A;  1AOY A;  4E7I A;  1FC3 A;  3ERM A;  5ICF A;  1JHF A;  3S1R J;  4G7O F;  3RKY A;  1XSV A;  3T8R A;  4L9V A;  4L18 B;  5AIP A;  2B63 J;  2AQE A;  1JKQ C;  2K9L A;  4Y3O A;  4KA4 A;  2ADU A;  4GCV A;  1U8B A;  4HYE A;  2I5U A;  2VQC A;  1D0X A;  4OIR F;  1Y1W J;  4HLX A;  1GVD A;  2A69 F;  2XAG A;  2ZSI B;  3FX3 A;  1TWH J;  3I4P A;  3IHU A;  4GYG A;  3V7C A;  4D7N A;  3BTC A;  3HGG A;  2W84 A;  3Q9V A;  1SD7 A;  1I5Z A;  3CME I;  5HLG A;  1HA8 A;  2EFP A;  2ZJR F;  2HDW A;  2L0K A;  3K70 C;  2WC2 A;  1R9T J;  1OQY A;  1RPW A;  1YW9 A;  2M30 A;  3ABK H;  3F8M A;  4L9T A;  4C9Y A;  2VON A;  2JWT A;  4G6Q A;  3CF5 F;  3ECO A;  2I10 A;  3SZP A;  2OU2 A;  1V54 H;  3ABL H;  3S32 A;  2A3S A;  2HYF A;  1U5T A;  2DQR A;  1ZHF A;  3GZ5 A;  1ZN2 A;  5DM7 F;  4PZJ A;  2O6G E;  3DP7 A;  1ETY A;  1TW2 A;  1BM9 A;  3PIO F;  4IHT A;  1GDT A;  4ENN A;  2OJE D;  3T0Y A;  3GO5 A;  4BL0 B;  1FT9 A;  2LVS A;  3CMM A;  2XDV A;  2VKE A;  2X1E A;  2FQ4 A;  3WTV C;  2PG4 A;  2QEN A;  5CVU A;  1LFB A;  2NVQ J;  1W5T A;  5JI6 A;  1VQ5 I;  5FLV A;  1BR4 A;  4RB0 A;  1R58 A;  2LDU A;  5KNL A;  5GPC A;  5DS9 A;  4IZZ A;  1JJ6 C;  2RN7 A;  1RI7 A;  4CYC B;  1U3E M;  4RS8 A;  2EPF A;  1ORK A;  1JGG A;  3KP5 A;  3I58 A;  4B4C A;  4FAS D;  2O5R A;  2E1N A;  4FIS A;  3TO7 A;  1I50 J;  3CP2 A;  3TMO A;  2R92 J;  1TQP A;  2FQ3 A;  1UZC A;  3KP3 A;  5D6F A;  3DPT A;  3CU7 A;  2JPB A;  1J2X A;  4QPQ A;  3UNG C;  1BI1 A;  1T0F C;  1F1Z A;  2F4M B;  2K5C A;  4CCN A;  3BZK A;  3HSF A;  4KYW A;  2G7H A;  3K69 A;  3HOT A;  3CCM I;  3KCC A;  3GYH X;  3IAS 2;  2E2J J;  1SAX A;  2CUZ A;  1J09 A;  1OPC A;  4XN3 A;  2VBY A;  2NOJ B;  3RYR A;  4RGU A;  1J59 A;  3BG5 A;  4PSW A;  2CQ7 A;  1MBJ A;  3BT9 A;  1GV5 A;  2JMW A;  4HV6 A;  1WKM A;  4F92 B;  1D3Y A;  4FX4 A;  3TP3 A;  3AG1 H;  2HVS A;  1X3Z B;  2JTV A;  4BE0 A;  4CGZ A;  1M1E B;  3JRA A;  4A3D J;  3Q3S A;  3S2D J;  4HLY A;  2EV6 A;  1KA8 A;  4CIC A;  1B59 A;  1FYM A;  3W6V A;  3HRS A;  3V8J A;  1RR8 C;  5DD8 A;  1KU2 A;  3CC2 I;  3U9G A;  1WZ2 A;  3KZI C;  2ICW G;  1Z7L A;  2Z2S B;  4ZDL A;  3J7A O;  5L3E A;  4BQA A;  1IF1 A;  1B9M A;  2PN6 A;  4IQ4 A;  2Q0O A;  2KIF A;  1DUX C;  1UJ8 A;  4IL6 C;  3PM1 A;  2HTJ A;  3ZQQ A;  5KVR A;  2EFO A;  3SJM A;  2QSG X;  4LLN A;  3WU2 C;  4DJA A;  2W24 A;  2A6T A;  4FET A;  2OTL I;  2VQL A;  4WF2 A;  2X51 A;  4ZH4 F;  4BKX A;  3JRE A;  2Q2E B;  2WTE A;  2KIM A;  3HOZ J;  1D0Y A;  2VLA A;  3CC7 I;  1BJZ A;  3S2H J;  3BJA A;  2BOL A;  3WU0 A;  3I5U A;  1POG A;  4NQW A;  1AKH A;  4UVC A;  2MLG A;  1VFC A;  4E6K G;  3LSP A;  1YJ9 I;  1HF0 A;  1S3J A;  1VF9 A;  2BY0 A;  4A0Z A;  2LYC A;  1ETV A;  1R5H A;  5LD2 C;  1IRG A;  5K7Z A;  2JN6 A;  2E5N A;  2ETH A;  1APL C;  2XIG A;  2EIM H;  1L3L A;  4LLL A;  3FBN B;  2EFW A;  3A2K A;  3PNY A;  4L5I A;  3ZN1 A;  4FCY A;  3D5L A;  1MBK A;  1ODD A;  1J5Y A;  3V42 A;  5H2F C;  5ICE A;  2DTZ A;  3ZPL A;  2BZT A;  3R60 A;  2DOF A;  4G7Z F;  2R5Y A;  3CCS I;  1WJA A;  2NS7 A;  1VZ0 A;  1IJW C;  1ETX A;  1WHU A;  3V4G A;  4BNC A;  1KQ0 A;  4HNT A;  1B9N A;  1VQP I;  4M3E A;  2KRF A;  4BEH B;  5DCM B;  5F1R A;  5ERI A;  4BY7 J;  4QLC U;  3WTW C;  2KT0 A;  1IV8 A;  2XKO A;  3GTM J;  4EM0 B;  1HOM A;  5H6Q A;  3TW7 A;  2LLK A;  2DA7 A;  2E1M B;  4JK1 X;  1LPQ A;  2DMU A;  5F0C A;  2NXN B;  4A69 C;  2R7U A;  2B7E A;  1UFM A;  3H9Q A;  2BV6 A;  3J81 K;  3HXL A;  3F22 A;  2HVR A;  2WBM A;  4IVN A;  2EIJ H;  2JSC A;  5F1J A;  3C18 A;  3F0C A;  2QKM B;  4RGX A;  4B48 A;  4MNU A;  2E1M C;  3R0A A;  4E70 A;  1N25 A;  4M3G A;  3IUO A;  4IHV A;  1HKT A;  2TCT A;  2H6B A;  2Z5U A;  3CZ6 A;  1IO2 A;  1RRJ A;  2X6Y A;  3QP6 A;  4CSW A;  4YEL A;  4I76 A;  2M3A A;  2V1D A;  3A1Y A;  2EIL H;  5JLX A;  1JGS A;  2VC1 A;  2M7A A;  1DPR A;  1JTY A;  4B43 A;  4LJZ F;  4PJJ A;  1LKX A;  2HZT A;  1E17 A;  4LFU A;  2L2O A;  3JRD A;  3FMR A;  1ZG3 A;  5C44 J;  1ZG1 A;  4OAY A;  3H1C A;  3GFL A;  3RTR A;  4BGD A;  3CCQ I;  1XC5 A;  1DU0 A;  3IAM 2;  5LRR A;  1ZRC A;  2ME6 A;  4I0B A;  1KU9 A;  2OUM A;  4P3B A;  1W5C C;  2DQL A;  4E7K A;  3CCE I;  2MD0 A;  2W00 A;  1GLN A;  5F6F A;  3F8N A;  3KP7 A;  4NC6 A;  4MTE A;  3JR9 A;  4U7D A;  2JA8 J;  3ASO H;  5LEJ A;  1JKO C;  2D1H A;  2O7O A;  1Y6I A;  2COB A;  5IT9 Z;  1A6I A;  4XLP F;  3S3M A;  3HQA A;  1WH7 A;  4UVA A;  2KL4 A;  3FM3 A;  3E7L A;  3K10 A;  2R3S A;  1UHW A;  2EB7 A;  4BHP A;  1FYK A;  2ESH A;  1QPI A;  3S8P A;  4FHT A;  4M74 A;  1AU7 A;  2BW3 A;  5KK1 A;  5IY5 H;  3FXM A;  2HOE A;  4YIR X;  3O8H A;  1AA7 A;  1VND A;  2JRM A;  2M45 A;  5DUI A;  3CF2 A;  5B1B H;  1Q1H A;  4AVP A;  1W7P B;  1Q1V A;  1UB9 A;  3S1M J;  4BDZ A;  5A2Q Z;  3HRT A;  1YO5 C;  3BCA A;  2LRD A;  3G73 A;  2NNY A;  1QNT A;  4E7J A;  5E1W A;  1XDS A;  1WGX A;  1IXS B;  3MZY A;  2XRL A;  2DPD A;  1U0J A;  1MJ9 A;  1X1D A;  4I0A A;  4P5O A;  3TDU C;  1R5I D;  4CCK A;  3HKZ A;  1G3Y A;  1REP C;  2J5P A;  2IGK A;  3DTI A;  5FRO A;  4BYY A;  3V7R A;  4LIU A;  2W7N A;  4B1R A;  2VXZ A;  3PJR A;  2CQQ A;  2ECB A;  5ILS A;  2DFE A;  4XMY A;  4AUX A;  5J4Y A;  5JVG F;  3CES A;  4BY1 J;  2Y0M A;  1IGN A;  2CH0 A;  1KON A;  2DW4 A;  3JRI A;  3S17 J;  3BZ6 A;  3K4K A;  2UWM A;  2FBH A;  4LK0 F;  4HRI A;  2RRE A;  3L9F A;  4I99 C;  2VKD A;  2V6E A;  4ZYG A;  4NDL A;  3LNQ A;  1Z3X A;  2J5O A;  2QQB A;  2X48 A;  2VE8 A;  1MBE A;  2YX4 A;  2ECC A;  1CF7 A;  2YS9 A;  1WPK A;  2JZY A;  4I98 B;  3A03 A;  3CDL A;  2K85 A;  1HQC A;  2WAQ N;  1XGS A;  1X58 A;  1G2H A;  1SFX A;  2DDA A;  2KJB A;  2GZW A;  2MAB A;  3KYL A;  1QHG A;  1S29 A;  3FWE A;  1HDP A;  1LDJ A;  4KIS A;  1QPM A;  4RMN A;  1JT0 A;  3J80 Z;  1TLH B;  3FHN A;  2P4W A;  1FOX A;  1UG2 A;  1QZY A;  1MZB A;  4B47 A;  2R7Q A;  5EEG A;  4IQJ A;  4W97 A;  1LDD A;  4JX4 A;  5FD6 A;  3JRG A;  1ETO A;  2V1U A;  1IRX A;  1V55 H;  1RIO H;  1QZE A;  3IP4 B;  4B3A A;  1VQ8 I;  1WJB A;  3H5N A;  5HOO A;  4ASN A;  3ZCO A;  4HNV A;  1KYZ A;  3FM5 A;  1IRZ A;  1KJS A;  1HW2 A;  4HX7 A;  5FB2 A;  4XRS G;  3WE3 A;  4EVI A;  3BDD A;  2X1D A;  1FTT A;  3KEO A;  4U7B A;  4GGG A;  5EZG A;  3W3C A;  1OCT C;  2X4H A;  3MKY B;  5EYR A;  2P5L C;  5TRD A;  4OIN F;  1R4M B;  3LSK A;  2M87 A;  2ZME A;  2M5W A;  2ELH A;  1JTX A;  2GA1 A;  3P9C A;  1ZR2 A;  4XOR A;  2XF5 A;  5FRN A;  1B8I A;  2KIS A;  3IWF A;  4IO9 F;  2WWY A;  4ESB A;  2XV4 S;  5L3B A;  1OJL A;  2VJ4 A;  2F5E A;  4PJL A;  1SVM A;  3H5R A;  2IEK A;  1X1P A;  2P7C B;  1RUN A;  2XB0 X;  3H9J A;  2M0M A;  2PJP A;  1Z05 A;  4EAT A; 
#chains in the Genus database with same CATH homology
 1NG7 A;  3C2H A;  2R7V A;  4YRV A;  4GRI A;  3K6G A;  1Y56 A;  1W36 D;  4HNU A;  3S3N A;  2X1C A;  1WJ5 A;  3OYC A;  2IS2 A;  1MMG A;  2R7W A;  3K4J A;  1BR1 A;  3L2R A;  4XLA A;  3FBI B;  1Z21 A;  4RM2 A;  4BQQ A;  2XAU A;  3MMY B;  4C30 A;  4DGW B;  2KLO A;  2LBF B;  3I3L A;  2KDO A;  2MC4 A;  3SEZ A;  4BE2 A;  4H4K C;  2FUG 2;  4E7I A;  2LC2 A;  2IGN A;  1D1C A;  4XQF A;  4XKV A;  1DGW Y;  2AQE A;  3FDY A;  4PSX A;  2K9L A;  3AFH A;  1OR7 C;  4Y3O A;  3OYK A;  1X1C A;  4B3X A;  3DTK A;  2IGO A;  3AKZ A;  2HNH A;  4XLH A;  2KHM A;  3OIP A;  3K4B A;  2XC7 A;  2VQC A;  1D0X A;  2X6X A;  1PYV A;  3RCO A;  4F91 B;  2ELJ A;  2ZSI B;  4ZTJ A;  1WFX A;  4DBR A;  1PJR A;  2CMP A;  2R7T A;  1JI8 A;  4HSR A;  2IS6 A;  1HA8 A;  2HDW A;  3K70 C;  4BUP A;  2V26 A;  4JOM A;  2UV1 A;  3MD2 A;  2L9S A;  4C9Y A;  3OYH A;  2KRH A;  2M4K A;  4LG3 A;  4OWR B;  5CKT A;  3OS2 A;  3QYB A;  3S32 A;  3KX2 A;  3ZR8 X;  2CW8 A;  3VSL A;  3EUH C;  1W36 C;  4BQO A;  2BW3 B;  1TZL A;  4E4H A;  1N77 A;  3AL0 B;  3LL7 A;  2Y0S A;  3NWS A;  4CCL A;  3ZGK A;  4XLE A;  3OS1 A;  3OYM A;  5KHD A;  4BL0 B;  2CFO A;  4FXG B;  3NWT A;  2R7O A;  2Z16 A;  3J7A Y;  3CMM A;  1LVK A;  2VJ5 A;  2XDV A;  2X1E A;  3OOU A;  1K6Y A;  2DT7 B;  4PFO A;  2QKL B;  3MKZ A;  4NC8 A;  2ZXI A;  2JUG A;  2KZV A;  3HPH A;  2R7R A;  1BR4 A;  3AL0 C;  5KNL A;  3DU5 A;  3OYI A;  2WAF A;  4IZZ A;  1LDK B;  2M7B A;  3OWT A;  3C2G A;  1BOB A;  4FAS D;  2O5R A;  1BR2 A;  3CP2 A;  2KP6 A;  4NC7 A;  4XL9 A;  4II2 A;  1WJC A;  3TMO A;  1MW7 A;  4BXF A;  3DPT A;  4XLC A;  3S93 A;  3QYE A;  3UNG C;  4QPQ A;  4PK4 A;  1T0F C;  2K5C A;  4CCN A;  1X19 A;  3UR3 C;  3DLA A;  3HOT A;  4NUB A;  3IAS 2;  3DTE A;  1OLT A;  2CUZ A;  1J09 A;  3SDB A;  5CPR B;  4XN3 A;  2WB1 A;  2NOJ B;  2AQF A;  4PSW A;  2HZD A;  3H35 A;  4F92 B;  3ZRG A;  3CJQ B;  2M4G A;  2HVS A;  4BE0 A;  1ERD A;  3PNV A;  3EUA A;  4J01 A;  2WAE A;  1E0E A;  1UG0 A;  5HNF A;  2VIX A;  2RQQ A;  3CP8 A;  3DEE A;  1YX3 A;  2VQG A;  2V7F A;  3QOE A;  2XF6 A;  1D1A A;  1WJD A;  3BG7 A;  4BEH A;  4XOP A;  1Z7L A;  2Z2S B;  4ZDL A;  2WY7 Q;  3OR1 C;  3VYU B;  3BCB A;  4P1W A;  2CW7 A;  2LY1 A;  2VAS A;  2KPM A;  2R7S A;  4IQ4 A;  2W4S A;  2E60 A;  4DBQ A;  2HQA A;  2HPI A;  2WAQ A;  2VJJ A;  3G2B A;  3OR2 C;  2F5V A;  4E7L A;  3ZQQ A;  3LSI A;  3E0J B;  3DU6 A;  4ZDO A;  3OS0 A;  4ZDP A;  2WA0 A;  4C2T A;  3PSF A;  4DJA A;  2I8D A;  3L2V A;  4QPO A;  2A6T A;  4FET A;  2VQL A;  2X51 A;  4AVZ A;  2Q2E B;  4CZC A;  1D0Y A;  2VLA A;  2BOL A;  4PUS A;  4HG2 A;  3VYR B;  3F9K A;  3EPZ A;  5JHF A;  2VB6 A;  3OMY A;  1DGR M;  2IS4 A;  4E6K G;  4MLO A;  1N75 A;  2LYC A;  5LD2 C;  1YX5 A;  2CV1 A;  4CCO A;  2E5N A;  3CJR B;  4HST A;  4XLF A;  3FBN B;  3LSM A;  4CA0 A;  3PNY A;  4KIT B;  3A2K A;  3D5L A;  2PMZ A;  3V42 A;  3LFU A;  5CQE A;  5JPM B;  1MMA A;  4PJM A;  1WJA A;  3SYT A;  1VZ0 A;  4HNT A;  1T95 A;  3TBI A;  2DXI A;  2R7X A;  4BEH B;  5HLT A;  2ZXH A;  4CUG A;  3LSG A;  3HUG B;  4XN0 A;  3HPG A;  3FKJ A;  2XSJ C;  1X1B A;  1SFK A;  4BE1 A;  4XKW A;  4XON A;  2E1M B;  2E5Z A;  5HNH A;  2V4J C;  4E7H A;  2R7U A;  1WJF A;  1V5E A;  3H9Q A;  2V1N A;  3HXL A;  2HVR A;  2WBM A;  2UUZ A;  2L5Q A;  4R79 A;  3L2W A;  2IS1 A;  2QKM B;  4B48 A;  3U21 A;  2CV0 A;  2E1M C;  2MFZ A;  2HPM A;  3IUO A;  3OYD A;  3DPU A;  2P0W A;  2JVG A;  3CZ6 A;  4LIV A;  2L7K A;  2X85 A;  2X6Y A;  3D5R C;  4CSW A;  4NQW B;  4BJ6 C;  4YEL A;  2L9N A;  3HOS A;  2M3A A;  3A1Y A;  1MND A;  3RQ4 A;  2VKH A;  4F52 A;  1ZEL A;  2IXS A;  3OY9 A;  2M7A A;  4BAC A;  3DKY A;  4B43 A;  4AYB A;  4PJJ A;  2LBF A;  1LKX A;  4YEJ A;  3PFY A;  4ANJ A;  2L2O A;  4N4O B;  3HC7 A;  2XF7 A;  4OAY A;  4ZYA A;  3RTR A;  4BGD A;  1NG6 A;  3OYJ A;  3IAM 2;  2DCE A;  1UAA A;  1DQU A;  3VYS B;  4XR6 A;  3VSK A;  3K4N A;  1FMV A;  2OUM A;  2MYS A;  3TL4 X;  2DOA A;  4E7K A;  1D1B A;  2F4I A;  3N05 A;  2MD0 A;  2W00 A;  1GLN A;  3PUB A;  2JVH A;  3H5A A;  4F93 B;  3VDX A;  2OC6 A;  4PFP A;  4DIQ A;  1X1A A;  4CCJ A;  1Y6I A;  3S3M A;  3DPL C;  4CH7 A;  2F6C A;  2KL4 A;  3OYB A;  3K10 A;  3K4M A;  4F55 A;  1TT0 A;  2WY8 Q;  4X0G A;  1MMN A;  3PL8 A;  3LSH A;  3S8P A;  2W82 A;  2WAD A;  2BW3 A;  4BU2 A;  3SEQ A;  3A4C A;  2JSP A;  4DOZ A;  2PJR A;  1LFP A;  4LIT A;  3OIQ A;  3OYA A;  2KQR A;  2KMU A;  2BVL A;  3K4L A;  3M1C A;  3PSI A;  1AA7 A;  2HVQ A;  1EA3 A;  4CCM A;  3OL3 A;  5KCM A;  2Z1D A;  2CS3 A;  1WJE A;  3CF2 A;  4XOT A;  4XKB A;  5LFA A;  4BDZ A;  1G59 A;  3SZG A;  3BCA A;  2LRD A;  4E7J A;  4JQF A;  3ZXS A;  3HL2 A;  3LMM A;  1U0J A;  1X1D A;  4P5O A;  4CCK A;  1D0Z A;  3BG6 A;  2GOX B;  3HKZ A;  1X4P A;  3VWB A;  2Q1Z B;  2IGK A;  3DTI A;  2R4G A;  2VXD A;  5FRO A;  2DJI A;  4BJT A;  3OYG A;  4LIU A;  4BDY A;  4E7S A;  2W7N A;  3ONQ A;  1FMW A;  1QHH D;  2VXZ A;  1P9Q C;  3PJR A;  3K4C A;  4XMY A;  4J00 A;  4ZJZ A;  4ZTF A;  2VPL A;  3CES A;  4XM3 A;  2CH0 A;  4D9J A;  1KON A;  1MMD A;  2ZSH B;  4AU7 A;  1V5G A;  1S9H A;  5TGT A;  3H0D A;  4KJZ A;  3K4K A;  2ZFU A;  4XKC A;  2K3P A;  2UWM A;  2LG4 A;  1SAU A;  2LH9 A;  3OL4 A;  2RRE A;  4F3Q A;  4HRI A;  2VKD A;  2KRC A;  2V6E A;  1Z3X A;  2A5W A;  3QOD A;  2GOM A;  4ITV A;  2V9K A;  2BVM A;  3I9V 2;  4KT6 A;  3DWL E;  3RSN A;  4B44 A;  2PJR B;  2IGM A;  3OYF A;  2JA2 A;  3KYL A;  2MAB A;  1QHG A;  3HG9 A;  3BLY A;  3S3O A;  4KIS A;  4RMN A;  1Z3Y A;  3W2W A;  3EUK L;  3FHN A;  4BJ5 C;  2CV2 A;  3L2U A;  3GBG A;  4IX7 A;  2HU9 A;  2X6W A;  3BC8 A;  4N4N B;  4RM3 A;  4BS9 A;  5FRM A;  4NNJ A;  1DP3 A;  2LY2 A;  4B47 A;  1G8X A;  2R7Q A;  2OV7 A;  4XNF A;  4IQJ A;  3KEY A;  4OAZ A;  1IRX A;  2VJI A;  4RLQ A;  4IKF A;  4G6T B;  3IP4 B;  1WJB A;  4Y33 A;  3H9G A;  4E7Z A;  1YE9 A;  3H5N A;  2W1O A;  5HOO A;  4D1Q A;  3ZCO A;  2K9M A;  1V5F A;  3MKW B;  3OYL A;  4HEA 2;  1MNE A;  3M8J A;  2X1D A;  2RNG A;  3RPU D;  2LOO A;  4U7B A;  4II3 A;  3W3C A;  3PNT A;  3OYN A;  3L2Q A;  3MKY B;  2CUJ A;  3QYF A;  3VYT B;  3OYE A;  4C2U A;  3LSK A;  4PJN A;  2VQH A;  5HVQ C;  3DQV C;  1UEL B;  2LRE A;  1X4O A;  3E1S A;  3W2A A;  3DKX A;  1QU3 A;  2VL8 A;  4XOR A;  2XF5 A;  5FRN A;  5CQG A;  4ZC3 A;  4HPQ A;  4BQN A;  3K70 D;  4U87 A;  2VJ4 A;  4PJL A;  3D5S C;  3W2V A;  3H5R A;  1R6R A;  4Y4R A;  2DT6 A;  2M0M A;  3H9J A;  1N78 A;  4RLF A;  4EAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...