1AA7A

Influenza virus matrix protein crystal structure at ph 4.0
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
158
Chain Sequence
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional membrane-RNA binding protein, influenza virus matrix protein M1.
pubmed doi rcsb
molecule tags Matrix protein
molecule keywords INFLUENZA VIRUS MATRIX PROTEIN
total genus 57
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1aa7A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 1aa7A01
4ITVA 4PUSA 5CQEA 1AA7A 4IQ4A 1EA3A 3VDXA 3MD2A 4D9JA 2Z16A
chains in the Genus database with same CATH superfamily
2OTLI 5H2FC 2LKSA 2HYFA 1U5TB 2VKVA 3M1CA 4FQGA 1MDMB 2H09A 4HDUA 2VB6A 2MC3A 3TW6A 1CGPA 4ZZLA 1SVLA 3ELKA 3BWGA 5FLVA 1T95A 1OYIA 2XVCA 2YSRA 2IT0A 2BOLA 2QVOA 1QO0D 4I09A 2KRHA 5B4PB 1J7KA 5HODA 3HYIA 4II3A 1ETQA 3H35A 4M9SA 4DNCA 4RGSA 3QOPA 4BJ5C 1O4XA 1RR7A 3GWZA 1K61A 2DT5A 5DDGA 1I50J 5F04A 3ERED 2DMUA 2FQ4A 4Q5SF 5J1UA 3GTLJ 1L0OC 1H0MA 1NK3P 1PUFA 2E34A 4HPQA 1I6HJ 2VBYA 4GYIA 2JA7J 2G7HA 4FX4A 2VE9A 1YIJI 1F43A 3QODA 3CMMA 2L9VA 2W84A 1TT5B 5BMZA 2A69F 2MABA 3E0JB 1SANA 4LFUA 1OCOH 1ON2A 5J40A 5F6FA 3W3CA 5LFAA 4K2EA 5GP9A 3ZR8X 3AG3H 2F5FA 1DQUA 3KYLA 3KYCB 4EMSA 3O6BB 2V79A 4I7HA 5K5OA 2WAQN 2L4MA 4BQNA 3BR6A 5ICGA 3CC2I 5H20A 4WXDA 4DYRA 3IAS2 2F5CA 1VTNC 1PUFB 4BEHB 3IH4A 1W36D 2EZKA 4IHWA 3RTRA 2E60A 4PJJA 4HLYA 4B48A 1R71A 1FSEA 3H5RA 1M1EB 2JA8J 3G4SI 1HDPA 1MKMA 1YX5A 1STZA 1S8NA 3A1YA 1WSUA 2IS4A 1FOKA 1I6XA 1O57A 3BR1A 4HF2A 2DA1A 4UU9C 5DYMA 1Y1WJ 2XUBA 2HOTA 3H1CA 1N77A 2UUZA 3OYBA 3ZOBA 4FASD 2KPMA 3W6VA 4Y13A 4CCJA 4A6DA 3FKJA 2EPFA 1PP7U 2XPVA 2M0MA 1R5GA 2IS6A 2LDUA 1BBYA 2FX0A 4CYCA 2XGXA 2K4BA 2QQAA 3TOAA 3G2BA 3HRMA 4B44A 1YYVA 4U88A 2L3DA 4E6KG 2WA0A 1EF4A 5E18F 2IAIA 3RKXA 5AONA 2LY1A 4HRIA 3SXYA 2IW5A 1WQ2A 3EUAA 3D0SA 4HF0A 3PNVA 1ZLKA 4FX0A 2VOPA 4DBRA 2EQRA 1Z1DA 3VYRB 3BJOA 4Y15A 1UJ8A 3S16J 1B1BA 3OOUA 5GAEJ 2DPDA 1OKRA 1IDZA 4F52A 3PSIA 3LSKA 2XPWA 2VODA 3CCVI 3M8JA 1JJ6C 4CYCB 2GQQA 1S9HA 5E8GA 2JPBA 3HOXJ 3VSKA 1XD7A 2K9QA 2CUFA 3HGGA 2HVSA 3K9TA 5D8LB 1ZGJA 2KFDA 3HOSA 1FP1D 1XSDA 2ELJA 2K40A 1HSJA 2KRCA 5BPDA 3BTCA 1JXSA 2VXZA 1RKTA 2Q2EB 5FFXA 1AKHB 1P4WA 4JOMA 2VBZA 3FMRA 2FOWA 2FUG2 1T0FC 3T8RA 2VIXA 4WWCA 2JA5J 4E7HA 4ESBA 2VPLA 2XDVA 5TISC 2NXNB 4PJLA 4XMYA 3HL2A 3P9KA 3OOPA 3DEUA 3IRRA 5E79C 3NWSA 5J8CA 3F6OA 5M5XJ 2H1KA 1U8RA 3HRSA 3SZGA 4RA2A 3HKZA 3CUQC 4DOZA 3CMAI 1FNNA 1A5JA 1Y39A 4UVAA 3K4MA 1FBUA 1ZK8A 3OY9A 4AIJA 5K7ZA 1FY7A 1Z9CA 3RKYA 2EJRA 2IEKA 1IW7F 4U0YA 5HS9A 5DUKA 1ONVA 1XS9A 3A02A 3I56I 4LG0B 4QIWN 3IRQA 2CG4A 2NYXA 3LSJA 1WWXA 2RQQA 3HHGA 4R79A 3H36A 3A4CA 2EZHA 3MQ0A 2M0CA 3NEUA 3O2PE 3QPHA 1USSA 2B7EA 5FKKA 3QYEA 1G3SA 2LVSA 2COBA 4CCLA 3TW7A 5D4RA 1Y6IA 3HG9A 4XN3A 1MBFA 1O3RA 1YS6A 1OFCX 2OU2A 3MFKA 2IA0A 3K69A 4ZTFA 1ETKA 2LK2A 4MFDA 4QPOA 2XF5A 5EEAA 1W5CC 2XC7A 1ZR2A 1YI2I 2PG4A 4YG2F 1X4OA 2KDOA 5IYCJ 2W57A 2D2WA 3RDIA 4DGWB 2IS1A 3ZPLA 1O3TA 2DCEA 5DD8A 1OQYA 4KICA 4HWJA 3E97A 4XIDA 3JRIA 2GXGA 4BE0A 4HBLA 2VQCA 1JE8A 2DO7A 2BXZA 2KIFA 3D5SC 1YITI 2D5VA 1R22A 3K1NA 2M34A 3OV8A 4M9ZA 3WTSC 4Y4RA 1XGSA 4KN4X 3HZJA 4OWRB 5J47A 3ONQA 3WGGA 3S8PA 2VI6A 2RNJA 3I9V2 5JLXA 1AKHA 4IRIA 1HW5A 4RM2A 2R7WA 3WE3A 2R7XA 3RQ4A 3E6MA 2VC0A 4UVBA 2Q8KA 1WJEA 4D7NA 2GM4A 2EFQA 2V4JC 3GTPJ 3I64A 4CGZA 3LNQA 1UG0A 2HQ5A 3U1DA 1FOXA 2QGUA 5CPRB 3ECHA 1IGNA 5AIPA 1ZN2A 2DK8A 4FE4A 4ENNA 1TNTA 1OCPA 3FXLA 2LBFB 3W6JB 3TEDA 1H88C 1OCCH 4UB8C 2WY8Q 3S93A 2BV6A 1HKSA 2JRMA 3EUKL 3OMYA 3OYEA 3F22A 2PEXA 3CC7I 2Y75A 3ZGKA 1R4MB 3TMOA 5J1YA 5JPMB 2A5WA 3J80Z 2K4JA 3M9AA 3NWTA 1LB2A 1IAWA 5HNFA 2CQ7A 3KZIC 3E5UA 3RSNA 2ZB9A 2OJED 4KA4A 2Y30A 2QKLB 3N4MA 1VQKI 1ITYA 4AVPA 3CDHA 2GLOA 3U2RA 3K0LA 2XGEA 4BS9A 2QM3A 1IDYA 3K1MA 2V9PA 5LGNA 1MJBA 3E5QA 2FEZA 3JRHA 1XCVA 1O7FA 4C3JJ 2HZTA 4W97A 1KONA 4BHPA 1U5TA 4U7DA 4X6AJ 4RAFA 3GFIA 2VT2A 1IUYA 2HDCA 2CW0F 1UHSA 2X48A 2V6CA 2ZFUA 4LK0F 1TQIA 3Q0VA 2F4MB 2DBBA 3T0YA 2ZC2A 4ZYEA 2W7NA 4BKXA 5FRNA 3GTJJ 5LRRA 3BC8A 3DU5A 4BDYA 2R7UA 2HZDA 5CQEA 4A3GJ 4KUMA 5FLXZ 3VSLA 3WHCA 2VONA 3HRUA 3DBRB 4B3AA 3L2VA 5EEGA 2D45A 3CMYA 2HI3A 2HOSA 2DT7B 3GZNB 5LGUA 2QQBA 3WHBA 2EILH 2JPCA 2V9VA 2M9HA 1USTA 3VYSB 3LA3A 3RYPA 4E7SA 4MEYF 4U0VA 3RI4A 2G9WA 3N97A 4L18B 4D0PA 2E5ZA 3IKVA 3LWFA 3CCYA 1HF0A 4XNFA 2IGMA 1T33A 1UZCA 2WTEA 2LYCA 1SD7A 1V3FA 2DTZA 2NS0A 1D5VA 4DIQA 1WJFA 2XGDA 4RAYA 4WB2A 2VQGA 1OLTA 3QP6A 5A2QK 3HJEA 3ESWB 4PGHA 1XPXA 2IBDA 2PMZN 2JA2A 5AIQA 3ABKH 3HEFA 2VN2A 1JTXA 1QZZA 5LHGA 3A0HC 2K3FA 2JSCA 4MGRA 4JYKA 5CVRA 1D8JA 1VQNI 2VXDA 4HZFA 1D1CA 2JN6A 4A3JJ 1DGWY 2P6TA 5IPAA 2NVTJ 4FHTA 2BEOA 5K5QA 4KMFA 2M1BA 2R7TA 3Q9VA 1BM9A 1KU9A 2YPRA 3OIOA 4B4CA 3DKXA 1NHAA 3FXQA 4E70A 4LIUA 2M4GA 2O8XA 4C3IJ 3QWLA 2OUMA 3HUGA 3LFUA 2LRDA 5C3EJ 2M5WA 2KZVA 4YIFA 1E3OC 2EZLA 5JPNB 2W82A 2AO9A 2V1NA 1BC7C 4EM0B 3U1KA 4OIRF 5D4SA 5F1JA 4PFOA 3WGIA 3Q3SA 5CJ9A 1FMWA 2CQXA 4Y17A 4PJNA 2QCOA 5F08A 3PL8A 3DP7A 4LLNA 2MH9A 2IXSA 3K7AJ 2PQ8A 3TDUC 5IP6A 4P5OA 2CQQA 2RV8A 4HNTA 5IY5H 1YRNA 1ZELA 4XRSA 2KMUA 4BQOA 1YJ9I 2FRHA 2E5NA 3DEWA 3R61A 2F5VA 3R0AA 2VKHA 1G3WA 1FYLA 2ECBA 4BJ6C 3BR0A 5FO5A 3OS1A 5EG0A 4Y33A 2WBMA 4E4HA 3AAFA 2LREA 2VBWA 1Z77A 4PUSA 1IJWC 4MHGA 2DMPA 2XAFA 1FSHA 1QPMA 3OR2C 4EEFG 4WCGA 1TW3A 5FGMA 1DP3A 1I27A 2B9SA 1ORKA 2DT6A 5F0FA 3AL0C 1G59A 4P39A 2KIQA 2V7FA 4BE2A 1Z21A 3GBGA 1RESA 3QYBA 2MC4A 4MFEA 2XIGA 2R92J 5E3OA 1R5HA 3H3UA 2BY0A 2CUZA 2R5YA 1YJNI 2LNBA 1Z7LA 4HA8A 4E7ZA 2H8RA 3QOEA 4UUVA 2MG4A 5L3DA 4L5EA 3S2WA 1TP4A 4DJAA 3H3VK 2ESNA 3HBLA 4M6XA 1I39A 1BI1A 2L9RA 4JX4A 2RVCA 3BP8A 5FJ8J 4M3DA 2HVRA 3KIOA 2DMQA 1MMDA 1N75A 4IHSA 2ADUA 2R7QA 2O9LA 5DD4A 4BU2A 2F5DA 4YEJA 1UCRA 2O61A 2CUEA 5K7HA 3ZN0A 3EUHA 2PI0A 2IS2A 1J9IA 1Z05A 2IJLA 4H0EA 4FT8A 1LFUP 1IN7A 3FXMA 2LP0A 3WU1B 2V6EA 3K1PA 5FKLA 4A3DJ 4RBOA 4UY8I 4IRGA 2VASA 3CD6I 3HSRA 1U9NA 2R4GA 1OCZH 1RI7A 2NOJB 1SFXA 2QQ8A 1LPQA 3W2WA 4B8XA 1D5YA 1DPUA 1CQTA 4HNUA 3FBIB 1IRFA 1T39A 5FRMA 2XSJC 2X6XA 3NAUA 2W1OA 4CCNA 3ZMSA 3CF2A 1WJBA 3REOA 2Z2SB 4IXAA 2MGQA 2R5ZA 4IVNA 1R4NB 1SC7A 2K9LA 4XQFA 3TKYA 3COAC 1CFAA 2LTPA 3ZP5A 2M8EA 3TOBA 1REPC 2EIKH 3TO6A 2KJCA 1FX7A 1R1UA 1O3SA 1YOVB 3BR5A 2Y31A 5ILVA 4D7MA 2A5YB 2RDPA 3AFHA 3UR3C 3S14J 1GT0C 1P92A 1IRZA 2OCCH 1P4AA 2Z99A 2QUFA 3K70C 1ETVA 1ZLJA 1K78B 3GYHX 1XMKA 3EQLF 2B39A 4RM3A 3ECOA 1IXCA 4ITVA 3FXOA 3NARA 3JW4A 5CVVA 3RKWA 3L1PA 1WHUA 3FBNB 1TNSA 1PYVA 1V4RA 2ELHA 4L0YB 5DTDA 5LGTA 3ZN1A 2KP6A 3ZQHA 2P0WA 1FJLA 1DU6A 4AWXB 3DV8A 4LLGF 4XONA 1S6LA 2L9NA 2CS3A 3KP6A 2DA4A 2EV6A 4M3FA 2STTA 4KISA 4ZH4F 3B6AA 4OAZA 3M8FA 4ZTJA 1P6RA 1QHHD 3AL0B 2JA6J 4CUGA 3GFMA 1GUUA 1Y8RB 5IYDJ 4F93B 5LEKA 4M74A 5KVRA 5ICCA 4HV6A 5J4VA 4BY7J 2XRNA 2X6OA 2BHYA 4OMZA 3NQOA 5EGOA 2IRFG 3KZZA 1EV7A 1VQ7I 3P9CA 2ZJQF 5EYRA 4EM1A 2DQLA 3KZYA 5FROA 4EM2A 3OYHA 3GTGJ 3CCSI 3RCOA 1IC8A 4ANJA 2GXAA 3KCCA 1IN8A 2R5YB 4XM3A 4XRFA 1NG6A 5KAIC 4FCYA 2FJ1A 4FTHA 3P5JA 1JJ8C 2HPMA 3EYIA 4CXFA 1FYMA 3OYKA 1O3QA 1UELB 1E2XA 3HB9A 5HVQC 3PM1A 5EZGA 1VF9A 3MVPA 2GAUA 3P7NA 4RLFA 2X6WA 3BT9A 3HUGB 4BACA 4E7JA 5D8KB 2UXNA 3VWBA 1LVKA 2E7WA 3MKWB 3H5AA 2X4HA 2YU3A 5B5EC 3CJQB 3HKZN 4LB6B 2HFHA 2KJBA 1FT9A 2IA1A 2VC1A 4RMNA 1XGOA 2Z5UA 4HNVA 2A3SA 5ICFA 1MSEC 3OWTA 2ID3A 3QU3A 3DTEA 1OISA 1J0RA 4QPQA 1QHGA 1X19A 1P2FA 3L7WA 4ABZA 3LAJA 5FFZA 4MEXF 3G3ZA 4MQ9F 2KHMA 2GOMA 3TO7A 4RB0A 1D3YA 2A61A 2BHZA 2L02A 4L9NA 3H3ZA 2MBFA 1EKEA 2F48A 3O8GA 3BCAA 1F36A 4F55A 1WJAA 3N05A 3GMEA 3BG3A 5ERIA 3HOZJ 2LBFA 2FNAA 2PFBA 3BQZA 5HLIA 4IOCF 3HOWJ 1I3AA 2M8GX 1FMVA 3CUQA 4BDZA 2DU9A 3QQAA 1MBKA 3ZMDA 4FETA 4LLLA 2Y0MA 1WJ5A 1QRYA 1FIPA 2X0LA 1VZ0A 4O5VA 5KNLA 5BS6A 4G7HF 3JRBA 2VJ4A 2Z33A 2EFWA 4PK4A 1MGTA 1TQPA 2PBIA 1PDNC 4LITA 1TTYA 3EYYA 5EJCA 2ETHA 2E19A 3SJMA 3FWEA 1LKXA 3L9FA 1K78A 1FP2A 4P55A 4A0ZA 3S17J 5TJJA 1H9GA 2K02A 3CZ6A 2HXIA 4IJAA 4ZC3A 4DBQA 3GZ5A 2LFBA 4B3XA 4D5FA 3CCQI 3R0JA 2Z1DA 1J2XA 4RLQA 2QF7A 1TZLA 2WV0A 3BQYA 4HAMA 3CUQB 5B1BH 2EINH 1FLIA 3OYGA 3DTIA 2X1DA 5DV5A 3DLAA 2A05A 4A3LJ 1JHFA 4XN0A 3WTXC 1Q1HA 4EJVA 1R6RA 4A3EJ 3E7LA 1I1SA 4HOBA 1RIOH 3DWLE 2LKPA 4NUBA 5L3GA 1YG2A 4I76A 3HTSB 4ENMA 2NRAC 2A68F 2Y0SN 2NS8A 4G7ZF 3CP2A 4CCKA 3QYFA 1YW9A 3PJRA 2BXYA 2A07F 2CH0A 4KT5C 4XLPF 1VQOI 1ACIA 2O03A 2PMUA 4C9YA 3VDXA 3V8JA 1BOAA 1JKQC 3DQVC 3PFIA 2XAJA 2M30A 4MNUA 1E3PA 1R00A 1MH3A 2KZGA 4A5MA 4F92B 4PCQA 1BIAA 1JUSA 3JCUC 3JREA 3V8KA 3X2QH 5ED4A 2TCTA 3RIRA 3F23A 2E1MC 1JTYA 3HQAA 1C0WA 3CLOA 4L0ZB 1X3WB 1KJSA 1LVAA 2O3FA 1OR7C 5JHFA 5K1YA 1F4KA 1Z0XA 2W25A 1KU3A 1BI3A 2OCEA 4BY1J 1XTAA 1XSVA 4ENKA 1GV2A 2H27A 4O3MA 5M5WJ 4ENJA 1HCRA 3CC4I 2QQ9A 1EA3A 2B63J 2DLLA 3ZMTA 3QAHA 1XDSA 2Y48A 1GVJA 3LL7A 3JTGA 4I98B 5M3MJ 2CW7A 4MTDA 1SVMA 4HX4A 4BJTA 5BOXA 2OV7A 2FF4A 1ETXA 1B8IB 3VODA 1XGNA 3HOYJ 5CVUA 3HQBA 4S04A 1TBXA 3K4LA 1J59A 3L2RA 2DOAA 2ESHA 1R23A 2M3AA 3LQQA 2CSOA 3V7SA 1XB4A 1P4XA 3L2QA 3AG2H 1K83J 1LNWA 2MH2A 1JUPA 2E7XA 5B3SH 5JVGF 5M3FJ 2E1MB 3SHFA 4ZJZA 1LEBA 2L7MP 4G7OF 1FTTA 2L9SA 3HIFA 4I0BA 3PIOF 1N25A 3CU7A 2O6GE 4HSTA 2V1XA 3DLLF 4EV0A 2RGVA 1SFOJ 1HQCA 3OSGA 1A31A 2F4OB 4LJZF 3WTWC 3B02A 3HPGA 2E2IJ 1MBHA 1X1PA 4Q4ZF 2CWEA 2AQFA 1AHDP 4U0WA 3KP7A 2ID6A 1S7AA 1TT0A 3LA2A 4NDLA 1XMAA 3SQNA 3FXUA 2M87A 4G6DA 2L7FP 3A2KA 2Q2EA 5F0HA 5JR3A 3ASNH 2DTRA 2CV1A 1Y56A 2YX4A 2W48A 2P5KA 3MKYB 3FX3A 3V8LA 5FLXK 3M07A 2GIZA 4C2UA 2VQLA 4HLXA 1FIAA 3J81Z 3WU0A 2YR2A 1K4TA 1TQMA 2EWNA 3K4NA 2XAUA 2TRTA 5GPAA 1Z7UA 2L54A 4YFNF 5FKNA 4XLCA 1W0TA 2E1CA 4KYWA 3F8CA 2R0QC 4OINF 1T2KA 5JFRA 2P4WA 4FXGB 4I01A 2F4IA 4YFXF 2BVLA 3F8FA 4LG0A 3DTKA 3OR1C 3ML6A 3BJ6A 3DEEA 4N4OB 1VQMI 3DFGA 1W4MA 4Y52J 1EH6A 1LFPA 3K2ZA 1GXQA 3H9QA 4FISA 5EZHA 1HLVA 1MMSA 3WODF 1YO5C 3RPUA 1KU7A 2VUMJ 4KITB 2ZXIA 1Y8QB 1VNDA 2HTSA 2R7OA 1K6YA 3S1MJ 5J3LA 1FC3A 4JK1X 3WE2A 1YIOA 1X1BA 1RPWA 4NB5A 1D0XA 4XSXF 3BY6A 5ILSA 2ZNZA 3ASOH 3F9KA 3VPRA 4AIHA 4XRMA 1LFBA 3S3MA 1ZQ3P 4HW5A 2VLAA 4RGUA 3FXKA 2HQAA 3JR9A 4BEHA 5FLMJ 2DFHA 1W0UA 4PSWA 1W7PB 1ZRFA 3HC7A 1FOYA 3WTVC 2KISA 4XL9A 1WI9A 2UXXA 3ABLH 2XB0X 1Z6TA 2QSHX 1OCRH 4G8XA 4V19K 2CQKA 3J80K 4A0YA 5C4JJ 5DM7F 4IZZA 2V9KA 1U8BA 1N78A 2FOKA 4LD5A 4M71A 2ZKZA 1EH8A 3ZMUA 5IT3A 2JQ7A 2VKEA 3I4PA 5E1ZB 4A93J 4DZPA 2I10A 1GXPA 3WG7H 3HTUA 2UZKA 3BR2A 2QZ8A 2N8GA 3DBHB 1B59A 3S1QJ 3E6DA 4B47A 4GGGA 3MZHA 2R93J 2KLOA 1MJ9A 3PSFA 5J8FA 1SEUA 4EVIA 2STWA 3MKLA 2JK3A 2JRTA 1XGMA 1MNDA 2D1VA 4B1RA 4ASNA 2QSGX 4CHUA 1G8XA 1H89C 2HEOA 2QBYA 2MA3A 3A03A 4CA0A 4S05A 1BR2A 1RKWA 5E1XA 3L2UA 3VEPA 2KRFA 3TP0A 3PUFA 1XC5A 3CESA 2DN0A 2JWTA 1E3HA 3WTYC 3RJPA 3I59A 2Y69H 1O7LA 4HEA2 5FB2A 3C2GA 1OMIA 3GUDA 5EGOB 2K85A 2EBIA 4ESJA 1BJZA 1R9TJ 2O5RA 5GTHC 3OYJA 3G1OA 3KX2A 5IT9Z 3DU6A 5LLQA 1YRNB 2V1DA 1X1AA 2TDXA 2Y2ZA 1TWHJ 4AIKA 2DQRA 2OQRA 4F7ZA 3Q0WA 1W36C 1JKRC 1WRJA 4WF2A 3TQNA 4BBRJ 5EG0B 1PVEA 2E71A 3DBLB 1V5EA 4J19A 1TC3C 2XV4S 3WGHA 3ZRGA 1P7JA 4LB5A 1W5SA 2DODA 1X2MA 1POGA 3UKGA 1T0FA 1J5YA 4E7KA 2HDDA 2R7ZJ 3HDDA 2EIJH 4M3BA 3CJTB 1K7AA 3BG9A 4G9YA 5IT9K 1KQ9A 2DPUA 2RQPA 1D0YA 1HW2A 5GPCA 5M5YJ 1MH4A 2FA5A 4DZJA 3V4GA 2FBHA 2AQEA 4XLFA 2KQRA 4N4NB 3RKQA 5HDNA 4Q48A 2LKXA 2W85A 4DYQA 2ZCWA 2VQHA 1T8IA 3MN2A 3B6CA 3HM5A 3GFLA 4YIIA 3HPHA 4A0XA 2FU4A 5D5VB 2CV2A 3HOUJ 1BI2A 2HOEA 3V7RA 4NC7A 1G6NA 1U5TC 3RQIA 5D6EA 4QWQA 3ROUA 4BUPA 3CMEI 1YLFA 1IXRC 3VYTB 5J4YA 3IWFA 3CCLI 5L3FA 2V1UA 3J7AY 1UHMA 2KDZA 3IL2A 2XRLA 1DUXC 2BE5F 4I2OA 4LOCA 2F5EA 1WH7A 2BZTA 2I8DA 5D5WB 5IP7J 4G6TB 1LQ1A 4UUSB 1LEAA 4L5IA 3KLSA 1HW1A 1T98A 4YRVA 4NC8A 2CQNA 1PUEE 1KQ0A 1JT6A 4AYBN 3BR3A 4P1WA 2O0YA 2G7UA 1OJLA 5LEJA 2XF7A 4HQEA 2B0LA 2EA2A 2VT3A 3HRTA 3FM5A 1FPQA 4Z2YA 3JRAA 3HOTA 2ISYA 1ZH5A 5BNGA 1LUJB 4CSWA 1ZKGA 3FM3A 2ZXHA 2VJJA 3VB2A 4V2GA 5D5XB 4ZDLA 1W1WE 3K4KA 1VQ8I 2KIMA 1ZR4A 5J1RA 3GTMJ 3FK6A 3OL4A 3K4BA 3SYTA 2GBYA 2LH9A 3BPXA 5E3MA 1AWCA 2W00A 4X1EA 2Z9OA 4IOAF 4BHCA 5GADJ 2DFIA 2MFZA 3FMSA 3B73A 1BA5A 4ZYHA 2Q1ZB 2EK5A 2CU7A 2LC2A 2X85A 3OYFA 2YU9J 2DI3A 2PX9A 3GFJA 1AU7A 3ISPA 3I71A 3LAPA 2WV1A 3GZ6A 3JSPA 4OMYA 2DOEA 4RAZA 1BJAA 2IVMA 4IQJA 4GXOA 4NNJA 3CCUI 2CYYA 4PGGA 5HNHA 3BDDA 5KK1A 1ZYRF 1W7PA 2HYJA 4OIPF 3C2BA 2RC4A 3IH3A 3K4CA 3LA7A 1WZ2A 1U3EM 3I0TA 1XX5A 2ELKA 5EF6A 1I1GA 3S3OA 3WTTC 5HS8A 1FBSA 1MZBA 1GLNA 2PN6A 5E17F 3FISA 2NNYA 4AU7A 1V54H 1D1BA 1TWCJ 1ZARA 3IWZA 5B1AH 2R7FA 4N9HA 2L7KA 3R4KA 3CP8A 5ILUA 2MYSA 2R7SA 1WH5A 3LSRA 2BBYA 1S29A 3KLOA 3MZ8A 1GDTA 3ZMZA 2ZFWA 3UNGC 2A6HF 2GA1A 5DM6F 3E5XA 2A6EF 1MNMC 2DDAA 2HDWA 2Y9ZA 3HOVJ 1SMTA 4KIFA 3QPTA 1E0EA 1J09A 1ZRDA 3OYMA 2BY3A 2Y0SA 1KA8A 3VFZA 2O7OA 2HWVA 4IHXA 1B9MA 2MLKA 4I6OA 2HYGD 3TGNA 4PJ0C 2EH3A 2K9SA 2LOOA 2HKOA 2DMNA 2GWRA 2QYOA 2VPRA 2XASA 3E6CC 1IN4A 2OF7A 3SZPA 1WGXA 5LHHA 1JI8A 2BVMA 4B09A 3SFZA 1T56A 2FBKA 5E3LA 3HSFA 1LE8B 4YELA 2VOOA 1QBJA 2ZJ2A 3PQJA 4F3QA 2WADA 3KPHA 2XPUA 2GXBA 3LSHA 2HTJA 1AOYA 2LSOA 1WI3A 3QP5A 3ERMA 4ZZDA 1APLC 3BTIA 1GHCA 5FKMA 4J01A 1FYKA 4TV7A 3ABTA 4HX8A 2HS5A 1EJ9A 1IRGA 4WXCA 2QLZA 2XSDC 1B72A 4XLHA 4AVZA 4L9JA 4BH9A 3CJNA 1JGGA 3KE2A 1Q1VA 3LSGA 3J7YJ 2K9NA 1UFMA 2YX7A 2E35A 3BPVA 2ECCA 5DCMA 3MEXA 2K5CA 3F72A 4ZYDA 4WK8F 4LIVA 5F0CA 4RB1A 4ZYAA 3DPTA 3J7AO 1A36A 2MD0A 4FXKB 4RGXA 2P7CB 2BY1A 2CJJA 3S32A 1GV5A 1YTYA 3CUOA 5CQGA 4E7IA 2DYRH 2E2HJ 4LK1F 4R8HA 2HNHA 2GOXB 4OOIA 4XICA 1P9QC 4YFKF 2VJIA 3D5LA 2XAHA 4RB3C 2E36A 2C6YA 3F8NA 5DS9A 2CUJA 5BPIA 3OS0A 3L2CA 1BOBA 3I4NJ 1B9NA 1IUFA 1V5FA 2OQGA 4BQQA 3F8MA 2W4SA 3U21A 4AUXA 5DCMB 2DYSH 4BE1A 4I6ZA 2BY2A 3CO6C 3H9JA 4RS8A 1MSFC 3TBIA 3T8TA 2ISZA 1R58A 4IF4A 1XSXA 1ON1A 3GTOJ 4JQFA 5FKOA 4OAYA 4KIGA 2HR3A 5DUIA 2XF6A 2HXOA 2PJRA 4X0GA 4H4KC 5HLHA 3BTLA 3I58A 3G71I 2H6BA 4W1UA 2M4KA 3PQKA 4GO1A 3FF5A 3BTJA 1ZG5A 4F91B 1ZG3A 4DQ2A 1DGRM 2P81A 2WAFA 4ESFA 3EPZA 1VQ6I 3WTZA 2BYVE 1S7OA 4G12A 3CCRI 1Z91A 3LSPA 2CFOA 1SD4A 4XOTA 5CVJA 4EGYA 3KYDB 4UUTA 1K4SA 5C4XJ 3K2AA 2OC6A 3OIPA 3VOEA 2DA2A 4MLOA 4D1QA 1OYYA 2CMPA 3PO3J 1L3LA 4NQWB 2X6YA 2H8WA 5JVTA 2DOFA 1SAUA 2L5QA 3P9IA 1VI0A 1X4PA 2DA5A 2XROA 4A5NA 1OR7A 2UV1A 1ZAOA 3I5UA 3IUOA 4RGRA 5IOYA 1MW7A 1F1ZA 3BG7A 1HOMA 1R7JA 1SMYF 3G73A 1A04A 4CICA 4UV8A 3SZTA 1H9TA 2OTJI 3BOQA 1KYZA 3KEYA 3LSMA 1IV6A 1E17A 1T38A 4ETSA 3DKWA 1KQ8A 2CW8A 4UB6C 1YW7A 2DW4A 2J5PA 3S2DJ 3F3XA 1ZRCA 3WG9A 5EDNA 3OYNA 9ANTA 2NOGA 2CO5A 1WVRA 4Q47A 1MMGA 1LE8A 1T6SA 3JAMK 4PDKA 1B6AA 2EB7A 5KHDA 3TP3A 2OPTA 4G6QA 3KP2A 1NH3A 4CCMA 3JRGA 1B8IA 5F27A 1VQPI 4CO8A 2Q0OA 1TWAJ 1QVUA 2DA3A 3QPSA 4M72A 3DPUA 5K7FA 1RRJA 1KZHA 1R1TA 2F2EA 1IV8A 1QU3A 3D5RC 2HQRA 1MD0A 4R1HA 3I4MJ 4C3HJ 1YHQI 1GVDA 3ZQCA 3BLYA 1FEXA 4RB2C 3G6EI 5HLGA 4EJTA 4CDGA 3GTQJ 4UNOA 3FK7A 3J81K 4V2FA 3ABMH 4IO9F 3SDGA 2LY9A 2LLKA 2P5VA 3MZYA 2DK5A 2W24A 3F6VA 1FOWA 1G3YA 2DFEA 1BW5A 3J7ZI 2R5ZB 2J5OA 3TDZC 4HF1A 3QU6A 1HSTA 2OZUA 4CH7A 3JSOA 2LF8A 3G1MA 2QBYB 3NRVA 1BL0A 1R49A 2ZMEC 2LF7A 1U0JA 4NC6A 2A73B 4A12A 2X1EA 2MD5A 4WB3A 2WC2A 4DW6A 4GCVA 3FKIJ 2HPIA 3FIWA 3FHZA 1HBXG 3GTKJ 2RREA 1Y1VJ 2WB1N 3MWMA 5FD5A 3QRFF 2LG4A 1CF7B 2A6TA 5LHIA 1S72I 2QWWA 2E1OA 4I99C 5J6XA 1U78A 1X1CA 5IP9J 3IC7A 2XKPA 1WCMJ 4BYYA 4A3MJ 4OIQF 1HKQA 4A3IJ 2R3SA 3E6BA 2QSFX 2OBPA 2QENA 4M73A 3OYIA 4KFCA 2JUCA 5HDKA 1JHHA 2DJNA 3LSIA 3EDPA 3A01A 2COMA 3IAM2 5CYVA 2YUSA 2ICWG 4Z6YA 3FHNA 2ME0A 4L9VA 4HSRA 4LGWA 4XR6A 3ZQGA 2FE3A 4EGZA 3R6SA 1HKTA 2PJPA 2ZBKA 1B72B 3GXOA 3OYDA 4WXHA 3S15J 1MNEA 1RUOA 3GW2A 4MQVA 3PNYA 4XORA 1UAAA 2Z16A 5E20A 5KAFC 3WTUC 3E3VA 2P5LC 1Z3XA 2CFXA 3MAJA 5H6QA 4UUSA 2ACJA 4ON0A 3TO9A 2IPQX 2XGCA 1QPIA 1J75A 2DMTA 2KIUA 2BW3A 2VE8A 3DXJF 3K10A 5L3BA 3HGYA 6PAXA 1RZ4A 4IHTA 1KU2A 3SDBA 2OA4A 2P6SA 1XN7A 5L3EA 2ZXWH 3OL3A 1QQIA 2XAQA 4IEJA 3LSTA 1P7IA 4GYGA 1LDKB 1S3JA 4A3KJ 4I02A 4HDVA 2GZWA 3LFKA 2LR8A 2HU9A 2H94A 1MBGA 3C3WA 4A3BJ 3RZDJ 3SEQA 1A35A 1D0ZA 4PZJA 2R7DA 4JX6A 1XCBA 4XKVA 3SEZA 3K70D 1K6OA 4DYCA 2WAQA 3GLXA 1IG7A 1Y0NA 4M3GA 1X1DA 3T1BA 2WWYA 4BGDA 3FDYA 3C1DA 3A0BC 5EEHA 1RC9A 3KEOA 4MTEA 2LY2A 1X2NA 3GEZA 2QEXI 4BXXJ 1F5TA 2NVYJ 4L9TA 1WJDA 4KT6A 1RR8C 1V55H 4I0AA 3CCEI 2RNGA 1WFXA 1OYWA 4QTRA 4XLNF 3BZCA 1SVOA 2F6CA 1ULYA 2EZIA 2GIVA 4AD9A 2ZSHB 2H6CA 4GFBA 3BG5A 5F64A 4KDPA 1MBEA 1NG7A 3AG1H 1WJCA 1X3UA 4CCOA 3ABUA 3EUHC 1JT0A 1ETOA 2HKXA 2CGPA 4AYBA 3IV5A 4XLEA 5JHUA 4JP0A 2ME6A 2IGNA 2M45A 3BROA 4WX9A 3D1NI 3KP3A 3CLQA 4EJUA 2JT1A 1YQAA 2KL4A 3CQZJ 1RNLA 3IKTA 4IHVA 5BQTA 1QZEA 3C18A 3FZVA 1ZG1A 3HXLA 3KP5A 4XKCA 5DCFA 4ZDOA 1IN6A 2AHQA 1WPKA 3I59B 1OPCA 2DA6A 3OS2A 4BXUA 2NVQJ 5B66C 1SD6A 2G0EA 3W2VA 3CDIA 4M3EA 3JAMZ 5LD2C 5IYBJ 3KLNA 2OAZA 3MMYB 2L0KA 4HYEA 4UHTA 4CZCA 1FZPB 2AXLA 1NTCA 4PJMA 4P9FA 2VJ5A 4M9XA 2MSYA 1UG2A 1NK2P 3OYCA 2H1LA 3PO2J 3MD2A 4BBSJ 1IN5A 4BL0B 1U2WA 2WAEA 2X1CA 4BXFA 4P96A 4L5JA 2FQ3A 4A2UA 4E7LA 4NHJA 1DU0A 1IO2A 4J00A 3IP4B 3ZQLA 4C30A 3DCFA 1OCTC 2IP2A 4U87A 1MMAA 2ZJRF 2EA4A 1PJRA 2M7AA 3H0GJ 2EFOA 1VFCA 3CDLA 4XLAA 1G2HA 3OSFA 3S1RJ 2FSWA 4IX7A 4EJOA 1ZTRA 4CZZA 2KKOA 3HHHA 2P8TA 2FBIA 5KCMA 5CLSA 4IRHA 3CCJI 4BQAA 3FXJA 4P3BA 1UMQA 2BW3B 2V26A 4QLCU 1QVTA 1B4AA 1JGSA 3RZOJ 1X58A 2HGCA 1TW2A 3K6GA 2EIMH 3F21A 5HS7A 2AS5F 2HVQA 3BCBA 2NAZA 4BNCA 1QZYA 2IGOA 1DPRA 3T5XA 1RETA 2EFNA 2XKOA 2QA4I 5H6RA 2FNPA 2WY7Q 3CTAA 5JLWA 2XB5A 1IF1A 2Y9YA 2P7VB 3KEQA 1S7EA 2DFFA 1SFKA 3EETA 1KGSA 3A01B 4UV9A 4EQQA 2DA7A 3K4JA 3Q0UA 1BI0A 1BN5A 2L2OA 5DEQA 3ZCOA 2M2EA 4LMYA 4IKFA 2M7BA 2XHKA 1EH7A 1JUMA 3OIQA 3OYLA 2XAGA 4A3FJ 2AXTC 1FTZA 4EJWA 1F9NA 1XG1A 5LRSA 2JZYA 2O8KA 1XDUA 1YS7A 1VQ4I 3DF8A 3TL4X 1ZGAA 2K7LA 4Y3OA 4AIDA 3GX4X 1IXSB 1SFEA 3GF2A 1G3TA 4QSHA 3OYAA 2JJ7A 3C7JA 4PSXA 5F1RA 1Z6RA 3M8EA 3AG4H 3FXRA 1U9OA 2L4AA 1HA8A 3PFYA 5GAGJ 4II2A 4GDFA 3JRCA 1LDDA 2YS9A 4KMUX 4HV5A 4XSZF 5LBQA 1IZ1A 2PMHA 4S0HB 3MKZA 1K79A 2E2JJ 1TLHB 3JRFA 1I3QJ 4P3AA 2RN7A 3W6KB 1IRXA 1Z67A 3O8HA 2K27A 2IA2A 1U6GA 2JSPA 5HDGA 3KETA 2CRGA 4XK4A 4A3CJ 4M6VA 1W7PD 4RDUA 1VQLI 2ZXJA 2JVGA 1MIJA 4KIBA 3WU2C 1ETWA 1YFHA 2GA2A 3RPQA 2NVUB 3ZMVA 3I54A 1YJWI 4NBQA 1BC8C 4YIRX 1BIBA 4N0BA 3CF5F 5K5RA 3BZ6A 1FWZA 2HOAA 3KP4A 2K3PA 2LD5A 4BHBA 4JX5A 3BZKA 4GRIA 4KJZA 3H92A 2ZMEA 1XMXA 2X9DA 2OZ6A 4IL6C 5D6FA 2UWMA 1MMNA 4HX7A 3SFIA 3ZQFA 2D1HA 5IOZA 4HW0A 4O6JA 3RYRA 3I3LA 3DKYA 1ETYA 1TWFJ 2KT0A 4OU0A 1BW6A 2OD5A 4ZYGA 5HLTA 1X3ZB 1ZREA 1FBQA 4MIMA 1ODDA 1BR1A 1A6IA 3H5NA 2BGCA 3GLLA 1I5ZA 1W5TA 4AC0A 1ZGWA 4ZDPA 4XOPA 5JI6A 3CCMI 1C5AA 5GAHJ 4A69C 2L7ZA 1UHWA 5E3NA 3U9GA 4B43A 2FXAA 3H0DA 1CF7A 3S3NA 3HSEA 3BG6A 1YW8A 1A6QA 3PNTA 1ENHA 4LG3A 1MBJA 5A2QZ 2PLYA 4D5CA 4RAGA 3R60A 3QPLA 3FMQA 4BAYA 5L3CA 2FMYA 1R36A 1WKMA 2LMDA 1D8KA 3PIPF 2ZO4A 5HOOA 1TWGJ 2CV0A 1H8AC 3DPLC 3S2HJ 2EV0A 4JBAA 4XKWA 1VQ5I 3C2HA 3I55I 2EFPA 2E1NA 3RPUD 2RAEA 2Z3YA 1S5LC 2R7VA 4UVCA 1LDJA 1R5ID 2NS7A 3PUBA 2HQNA 3E1SA 3M4OJ 2RKHA 5GTIC 4CYDA 5D5UB 5CVIA 2DDBA 1SD5A 3M7GA 3ZQIA 1TL8A 2DXIA 2JVHA 1HC8A 3GO5A 1YX3A 1PP8F 3G1LA 4PFPA 1LJ9A 4EATA 1DP7P 2VBXA 3F8BA 3JRDA 1RUNA 2ZNYA 5E1WA 4AM3A 1HXDA 4IHYA 3ZQQA 3Q9SA 4XKBA 1JKOC 4XRSG 4U7BA 3W2AA 3GCMA 2I5UA 2VKDA 3M1EA 2PMZA 4OIOF 4N9IA 4KNYA 1QNTA 4A6EA 3L00A 3LMMA 3H9GA 4FE7A 4HG2A 5C44J 2MLGA 2R7RA 1QA6A 1VQ9I 2K86A 4NQWA 3VYUB 3LQRA 3MCZA 4C2TA 1SFUA 1ERDA 2VL8A 1R1VA 3ZXSA 5ICEA 2K9MA 1V5GA 1T08B 1UB9A 2L01A 3L2WA 4IPAA 3KFWX 3CO7C 2QKMB 1JKPC 1Y0UA 4HQMA 4C2MJ 2NVXJ 3BJAA 2FD5A 3F0CA 5TRDA 1DDNA 3ULQB 2NNNA 1Z3YA 2FMLA 4Y7NJ 4UXNA 2DJIA 3O3KA 3IHUA 1HDDC 1D1AA 3ZQ7A 1MDMA 4M6YA 3GVAA 2ZSIB 1KYWA 5CKTA 4KN7X 4MO7A 3JTHA 3S1NJ 2JTVA 5TGTA 5E8IA 3Q5FA 2ZJPF 4XBFA 2JMWA 3AKZA 3L09A 1ZHFA 2ZMEB 3M3YJ 1QGPA 1AA7A 4IQ4A 1SAXA 4P9UA 2EV5A 3LOCA 2PJRB 2IGKA 3IH2A 2X51A 4G94A 2DAOA 3I53A 2JUGA 5FD6A 3CJRB 1BR4A 1YE9A 3V7CA 1G4DA 2MW8A 3V42A 4D9JA 2WB1A 1MJAA
chains in the Genus database with same CATH topology
3HC7A 1U0JA 3M1CA 4XL9A 2CUZA 2VB6A 1Z7LA 2X1EA 4E7ZA 3QOEA 4IZZA 2V9KA 1N78A 1T95A 2HPIA 4DJAA 2BOLA 2RREA 2KRHA 2LG4A 2A6TA 4II3A 3H35A 2HVRA 1X1CA 4BJ5C 4B47A 1MMDA 1N75A 3OYIA 2KLOA 3PSFA 2R7QA 3LSIA 4BU2A 4YEJA 3IAM2 3FHNA 1MNDA 4HSRA 1G8XA 4XR6A 4HPQA 4CA0A 2IS2A 1BR2A 3QODA 3L2UA 3CMMA 2V6EA 3CESA 3OYDA 2MABA 3E0JB 2VASA 1MNEA 4HEA2 3C2GA 3PNYA 4XORA 5LFAA 3W3CA 2R4GA 1UAAA 2Z16A 2NOJB 1Z3XA 3ZR8X 3W2WA 1DQUA 4HNUA 2O5RA 3FBIB 3KYLA 3OYJA 2BW3A 3KX2A 3K10A 5FRMA 2XSJC 2X6XA 2W1OA 4CCNA 3DU6A 3CF2A 3SDBA 1X1AA 1WJBA 2Z2SB 4BQNA 3OL3A 2K9LA 1W36C 4XQFA 1LDKB 3IAS2 4BEHB 1W36D 1V5EA 2HU9A 3RTRA 3ZRGA 2E60A 4PJJA 3SEQA 4B48A 1D0ZA 3H5RA 3UR3C 3AFHA 3SEZA 3K70D 4XKVA 1YX5A 2WAQA 3A1YA 2IS4A 4E7KA 1X1DA 3K70C 4BGDA 3FDYA 4RM3A 4ITVA 1N77A 3FBNB 1PYVA 2UUZA 2LY2A 3OYBA 4FASD 1D0YA 2KP6A 2KPMA 4CCJA 2P0WA 3FKJA 2IS6A 2M0MA 2AQEA 4XONA 1WJDA 4XLFA 2L9NA 4KT6A 2KQRA 2CS3A 4N4NB 2RNGA 1WFXA 4KISA 3G2BA 4B44A 4OAZA 4ZTJA 4E6KG 2F6CA 2WA0A 1QHHD 2VQHA 3AL0B 4CUGA 2ZSHB 3HPHA 4F93B 2CV2A 2LY1A 4HRIA 1NG7A 4NC7A 3EUAA 1WJCA 4BUPA 4CCOA 3PNVA 3EUHC 3VYTB 4DBRA 3J7AY 3VYRB 4AYBA 4XLEA 5FROA 2IGNA 3OOUA 3OYHA 2I8DA 3RCOA 4G6TB 4ANJA 2KL4A 4F52A 3PSIA 3LSKA 4XM3A 3HXLA 1NG6A 3M8JA 4XKCA 4YRVA 1S9HA 4NC8A 4ZDOA 2HPMA 3OS2A 3VSKA 3OYKA 4P1WA 3W2VA 2HVSA 1UELB 5HVQC 2XF7A 5LD2C 3HOSA 3HOTA 3MMYB 4CZCA 4RLFA 2ELJA 2X6WA 4CSWA 2KRCA 3HUGB 4PJMA 2ZXHA 4BACA 2VXZA 4E7JA 2VJJA 2Q2EB 2VJ5A 3VWBA 1LVKA 3OYCA 3MKWB 3H5AA 4ZDLA 4JOMA 3K4KA 3MD2A 3CJQB 4BL0B 2FUG2 1T0FC 2VIXA 4RMNA 2WAEA 2X1CA 3K4BA 3OL4A 3SYTA 4BXFA 4E7HA 2LH9A 2VPLA 2XDVA 2W00A 4PJLA 4XMYA 4E7LA 3OWTA 3HL2A 2MFZA 3DTEA 3IP4B 4J00A 2Q1ZB 2LC2A 4C30A 2X85A 3OYFA 3NWSA 4QPQA 1QHGA 1X19A 4U87A 1MMAA 1PJRA 2M7AA 2KHMA 2GOMA 3SZGA 3HKZA 4DOZA 4XLAA 3K4MA 3OY9A 4IX7A 4IQJA 4NNJA 3BCAA 4F55A 1WJAA 3N05A 5KCMA 2LBFA 5HNHA 2BW3B 4R79A 2RQQA 2V26A 3K4CA 1FMVA 3A4CA 3K6GA 4BDZA 3S3OA 2HVQA 4FETA 1WJ5A 3BCBA 1GLNA 1VZ0A 5KNLA 2IGOA 3QYEA 4AU7A 1D1BA 4CCLA 2VJ4A 4PK4A 2L7KA 1Y6IA 3HG9A 3CP8A 2WY7Q 4LITA 2MYSA 4XN3A 2R7SA 4ZTFA 3UNGC 1LKXA 1SFKA 2XF5A 4QPOA 2HDWA 3CZ6A 2XC7A 4ZC3A 4DBQA 4B3XA 1E0EA 1X4OA 1J09A 2KDOA 3OYMA 2Z1DA 4RLQA 1TZLA 2Y0SA 4DGWB 2IS1A 2DCEA 3K4JA 3OYGA 3DTIA 2L2OA 2X1DA 3ZCOA 3DLAA 4XN0A 4BE0A 4IKFA 2M7BA 1R6RA 3OYLA 2VQCA 3OIQA 3DWLE 3D5SC 2LOOA 4NUBA 4Y4RA 3TL4X 4Y3OA 4OWRB 3CP2A 3ONQA 4CCKA 3QYFA 3OYAA 4PSXA 3S8PA 3PJRA 3I9V2 2R7WA 4RM2A 2CH0A 1JI8A 2BVMA 1HA8A 2R7XA 3PFYA 3RQ4A 4II2A 1WJEA 4C9YA 3MKZA 4YELA 3VDXA 3DQVC 2V4JC 4F3QA 2WADA 1UG0A 3LSHA 1IRXA 5CPRB 2JSPA 4F92B 4J01A 2LBFB 2JVGA 2WY8Q 3S93A 3OYEA 3EUKL 3OMYA 3ZGKA 2E1MC 3TMOA 4XLHA 3QYBA 5JPMB 4AVZA 1OR7C 5JHFA 2A5WA 2K3PA 3LSGA 4GRIA 4KJZA 3NWTA 5HNFA 1EA3A 2K5CA 3RSNA 2UWMA 1MMNA 4LIVA 2QKLB 4ZYAA 3LL7A 3DPTA 2CW7A 2MD0A 3DKYA 3I3LA 4BJTA 4BS9A 2OV7A 3S32A 5CQGA 4E7IA 2HNHA 2GOXB 1KONA 3K4LA 5HLTA 1P9QC 2VJIA 3D5LA 3L2RA 2DOAA 1BR1A 2M3AA 3H5NA 2ZFUA 2CUJA 4ZDPA 3OS0A 4XOPA 1BOBA 1V5FA 4BQQA 2W7NA 3L2QA 2W4SA 3U21A 5FRNA 3BC8A 3DU5A 4B43A 3H0DA 4BDYA 4BE1A 3S3NA 2HZDA 3BG6A 5CQEA 3H9JA 2R7UA 3PNTA 4LG3A 3TBIA 3VSLA 2E1MB 4ZJZA 3L2VA 4JQFA 4OAYA 2L9SA 5HOOA 2DT7B 2CV0A 3DPLC 4HSTA 2XF6A 2PJRA 4X0GA 4XKWA 4H4KC 3C2HA 2M4KA 3HPGA 3RPUD 3VYSB 4F91B 1DGRM 2WAFA 4E7SA 3EPZA 2AQFA 2R7VA 3PUBA 2E5ZA 3E1SA 1TT0A 4XNFA 2IGMA 2CFOA 4XOTA 2LYCA 3OIPA 2OC6A 3A2KA 4MLOA 4D1QA 2CMPA 2CV1A 1Y56A 4NQWB 2X6YA 4DIQA 1WJFA 2DXIA 2JVHA 1SAUA 2VQGA 2L5QA 1OLTA 1X4PA 3MKYB 1YX3A 4PFPA 2UV1A 4EATA 2VQLA 4C2UA 3IUOA 2JA2A 1MW7A 3BG7A 3K4NA 2XAUA 3KEYA 3LSMA 3ZQQA 4XKBA 2VXDA 1D1CA 4U7BA 2CW8A 1DGWY 4XLCA 3W2AA 2VKDA 2R7TA 2PMZA 3DKXA 4FXGB 2F4IA 3LMMA 3H9GA 2BVLA 4HG2A 2R7RA 4LIUA 2M4GA 3DTKA 3OYNA 3VYUB 3OR1C 4C2TA 1ERDA 3DEEA 1MMGA 2OUMA 2VL8A 4N4OB 3ZXSA 2K9MA 3LFUA 2LRDA 1V5GA 5KHDA 2KZVA 3L2WA 2W82A 4CCMA 2V1NA 1LFPA 2QKMB 3H9QA 3DPUA 4PFOA 1FMWA 4PJNA 1Z3YA 1QU3A 4KITB 3D5RC 2ZXIA 3PL8A 2IXSA 2DJIA 1D1AA 3BLYA 4P5OA 4HNTA 1ZELA 2R7OA 2ZSIB 2KMUA 4BQOA 1K6YA 5CKTA 2E5NA 2F5VA 5TGTA 2VKHA 1X1BA 4BJ6C 3OS1A 3AKZA 4Y33A 2WBMA 4E4HA 1D0XA 2LREA 4PUSA 1AA7A 4IQ4A 3F9KA 2PJRB 2IGKA 2X51A 3OR2C 1DP3A 3S3MA 4D9JA 2JUGA 2DT6A 3CJRB 2VLAA 1BR4A 1YE9A 4CH7A 1G59A 2HQAA 2V7FA 4BEHA 4BE2A 3AL0C 3V42A 4PSWA 1Z21A 3GBGA 2WB1A 2MC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITV A;  4PUS A;  5CQE A;  1AA7 A;  4IQ4 A;  1EA3 A;  3VDX A;  3MD2 A;  4D9J A;  2Z16 A; 
#chains in the Genus database with same CATH topology
 2OTL I;  5H2F C;  2LKS A;  2HYF A;  1U5T B;  2VKV A;  3M1C A;  4FQG A;  1MDM B;  2H09 A;  4HDU A;  2VB6 A;  2MC3 A;  3TW6 A;  1CGP A;  4ZZL A;  1SVL A;  3ELK A;  3BWG A;  5FLV A;  1T95 A;  1OYI A;  2XVC A;  2YSR A;  2IT0 A;  2BOL A;  2QVO A;  1QO0 D;  4I09 A;  2KRH A;  5B4P B;  1J7K A;  5HOD A;  3HYI A;  4II3 A;  1ETQ A;  3H35 A;  4M9S A;  4DNC A;  4RGS A;  3QOP A;  4BJ5 C;  1O4X A;  1RR7 A;  3GWZ A;  1K61 A;  2DT5 A;  5DDG A;  1I50 J;  5F04 A;  3ERE D;  2DMU A;  2FQ4 A;  4Q5S F;  5J1U A;  3GTL J;  1L0O C;  1H0M A;  1NK3 P;  1PUF A;  2E34 A;  4HPQ A;  1I6H J;  2VBY A;  4GYI A;  2JA7 J;  2G7H A;  4FX4 A;  2VE9 A;  1YIJ I;  1F43 A;  3QOD A;  3CMM A;  2L9V A;  2W84 A;  1TT5 B;  5BMZ A;  2A69 F;  2MAB A;  3E0J B;  1SAN A;  4LFU A;  1OCO H;  1ON2 A;  5J40 A;  5F6F A;  3W3C A;  5LFA A;  4K2E A;  5GP9 A;  3ZR8 X;  3AG3 H;  2F5F A;  1DQU A;  3KYL A;  3KYC B;  4EMS A;  3O6B B;  2V79 A;  4I7H A;  5K5O A;  2WAQ N;  2L4M A;  4BQN A;  3BR6 A;  5ICG A;  3CC2 I;  5H20 A;  4WXD A;  4DYR A;  3IAS 2;  2F5C A;  1VTN C;  1PUF B;  4BEH B;  3IH4 A;  1W36 D;  2EZK A;  4IHW A;  3RTR A;  2E60 A;  4PJJ A;  4HLY A;  4B48 A;  1R71 A;  1FSE A;  3H5R A;  1M1E B;  2JA8 J;  3G4S I;  1HDP A;  1MKM A;  1YX5 A;  1STZ A;  1S8N A;  3A1Y A;  1WSU A;  2IS4 A;  1FOK A;  1I6X A;  1O57 A;  3BR1 A;  4HF2 A;  2DA1 A;  4UU9 C;  5DYM A;  1Y1W J;  2XUB A;  2HOT A;  3H1C A;  1N77 A;  2UUZ A;  3OYB A;  3ZOB A;  4FAS D;  2KPM A;  3W6V A;  4Y13 A;  4CCJ A;  4A6D A;  3FKJ A;  2EPF A;  1PP7 U;  2XPV A;  2M0M A;  1R5G A;  2IS6 A;  2LDU A;  1BBY A;  2FX0 A;  4CYC A;  2XGX A;  2K4B A;  2QQA A;  3TOA A;  3G2B A;  3HRM A;  4B44 A;  1YYV A;  4U88 A;  2L3D A;  4E6K G;  2WA0 A;  1EF4 A;  5E18 F;  2IAI A;  3RKX A;  5AON A;  2LY1 A;  4HRI A;  3SXY A;  2IW5 A;  1WQ2 A;  3EUA A;  3D0S A;  4HF0 A;  3PNV A;  1ZLK A;  4FX0 A;  2VOP A;  4DBR A;  2EQR A;  1Z1D A;  3VYR B;  3BJO A;  4Y15 A;  1UJ8 A;  3S16 J;  1B1B A;  3OOU A;  5GAE J;  2DPD A;  1OKR A;  1IDZ A;  4F52 A;  3PSI A;  3LSK A;  2XPW A;  2VOD A;  3CCV I;  3M8J A;  1JJ6 C;  4CYC B;  2GQQ A;  1S9H A;  5E8G A;  2JPB A;  3HOX J;  3VSK A;  1XD7 A;  2K9Q A;  2CUF A;  3HGG A;  2HVS A;  3K9T A;  5D8L B;  1ZGJ A;  2KFD A;  3HOS A;  1FP1 D;  1XSD A;  2ELJ A;  2K40 A;  1HSJ A;  2KRC A;  5BPD A;  3BTC A;  1JXS A;  2VXZ A;  1RKT A;  2Q2E B;  5FFX A;  1AKH B;  1P4W A;  4JOM A;  2VBZ A;  3FMR A;  2FOW A;  2FUG 2;  1T0F C;  3T8R A;  2VIX A;  4WWC A;  2JA5 J;  4E7H A;  4ESB A;  2VPL A;  2XDV A;  5TIS C;  2NXN B;  4PJL A;  4XMY A;  3HL2 A;  3P9K A;  3OOP A;  3DEU A;  3IRR A;  5E79 C;  3NWS A;  5J8C A;  3F6O A;  5M5X J;  2H1K A;  1U8R A;  3HRS A;  3SZG A;  4RA2 A;  3HKZ A;  3CUQ C;  4DOZ A;  3CMA I;  1FNN A;  1A5J A;  1Y39 A;  4UVA A;  3K4M A;  1FBU A;  1ZK8 A;  3OY9 A;  4AIJ A;  5K7Z A;  1FY7 A;  1Z9C A;  3RKY A;  2EJR A;  2IEK A;  1IW7 F;  4U0Y A;  5HS9 A;  5DUK A;  1ONV A;  1XS9 A;  3A02 A;  3I56 I;  4LG0 B;  4QIW N;  3IRQ A;  2CG4 A;  2NYX A;  3LSJ A;  1WWX A;  2RQQ A;  3HHG A;  4R79 A;  3H36 A;  3A4C A;  2EZH A;  3MQ0 A;  2M0C A;  3NEU A;  3O2P E;  3QPH A;  1USS A;  2B7E A;  5FKK A;  3QYE A;  1G3S A;  2LVS A;  2COB A;  4CCL A;  3TW7 A;  5D4R A;  1Y6I A;  3HG9 A;  4XN3 A;  1MBF A;  1O3R A;  1YS6 A;  1OFC X;  2OU2 A;  3MFK A;  2IA0 A;  3K69 A;  4ZTF A;  1ETK A;  2LK2 A;  4MFD A;  4QPO A;  2XF5 A;  5EEA A;  1W5C C;  2XC7 A;  1ZR2 A;  1YI2 I;  2PG4 A;  4YG2 F;  1X4O A;  2KDO A;  5IYC J;  2W57 A;  2D2W A;  3RDI A;  4DGW B;  2IS1 A;  3ZPL A;  1O3T A;  2DCE A;  5DD8 A;  1OQY A;  4KIC A;  4HWJ A;  3E97 A;  4XID A;  3JRI A;  2GXG A;  4BE0 A;  4HBL A;  2VQC A;  1JE8 A;  2DO7 A;  2BXZ A;  2KIF A;  3D5S C;  1YIT I;  2D5V A;  1R22 A;  3K1N A;  2M34 A;  3OV8 A;  4M9Z A;  3WTS C;  4Y4R A;  1XGS A;  4KN4 X;  3HZJ A;  4OWR B;  5J47 A;  3ONQ A;  3WGG A;  3S8P A;  2VI6 A;  2RNJ A;  3I9V 2;  5JLX A;  1AKH A;  4IRI A;  1HW5 A;  4RM2 A;  2R7W A;  3WE3 A;  2R7X A;  3RQ4 A;  3E6M A;  2VC0 A;  4UVB A;  2Q8K A;  1WJE A;  4D7N A;  2GM4 A;  2EFQ A;  2V4J C;  3GTP J;  3I64 A;  4CGZ A;  3LNQ A;  1UG0 A;  2HQ5 A;  3U1D A;  1FOX A;  2QGU A;  5CPR B;  3ECH A;  1IGN A;  5AIP A;  1ZN2 A;  2DK8 A;  4FE4 A;  4ENN A;  1TNT A;  1OCP A;  3FXL A;  2LBF B;  3W6J B;  3TED A;  1H88 C;  1OCC H;  4UB8 C;  2WY8 Q;  3S93 A;  2BV6 A;  1HKS A;  2JRM A;  3EUK L;  3OMY A;  3OYE A;  3F22 A;  2PEX A;  3CC7 I;  2Y75 A;  3ZGK A;  1R4M B;  3TMO A;  5J1Y A;  5JPM B;  2A5W A;  3J80 Z;  2K4J A;  3M9A A;  3NWT A;  1LB2 A;  1IAW A;  5HNF A;  2CQ7 A;  3KZI C;  3E5U A;  3RSN A;  2ZB9 A;  2OJE D;  4KA4 A;  2Y30 A;  2QKL B;  3N4M A;  1VQK I;  1ITY A;  4AVP A;  3CDH A;  2GLO A;  3U2R A;  3K0L A;  2XGE A;  4BS9 A;  2QM3 A;  1IDY A;  3K1M A;  2V9P A;  5LGN A;  1MJB A;  3E5Q A;  2FEZ A;  3JRH A;  1XCV A;  1O7F A;  4C3J J;  2HZT A;  4W97 A;  1KON A;  4BHP A;  1U5T A;  4U7D A;  4X6A J;  4RAF A;  3GFI A;  2VT2 A;  1IUY A;  2HDC A;  2CW0 F;  1UHS A;  2X48 A;  2V6C A;  2ZFU A;  4LK0 F;  1TQI A;  3Q0V A;  2F4M B;  2DBB A;  3T0Y A;  2ZC2 A;  4ZYE A;  2W7N A;  4BKX A;  5FRN A;  3GTJ J;  5LRR A;  3BC8 A;  3DU5 A;  4BDY A;  2R7U A;  2HZD A;  5CQE A;  4A3G J;  4KUM A;  5FLX Z;  3VSL A;  3WHC A;  2VON A;  3HRU A;  3DBR B;  4B3A A;  3L2V A;  5EEG A;  2D45 A;  3CMY A;  2HI3 A;  2HOS A;  2DT7 B;  3GZN B;  5LGU A;  2QQB A;  3WHB A;  2EIL H;  2JPC A;  2V9V A;  2M9H A;  1UST A;  3VYS B;  3LA3 A;  3RYP A;  4E7S A;  4MEY F;  4U0V A;  3RI4 A;  2G9W A;  3N97 A;  4L18 B;  4D0P A;  2E5Z A;  3IKV A;  3LWF A;  3CCY A;  1HF0 A;  4XNF A;  2IGM A;  1T33 A;  1UZC A;  2WTE A;  2LYC A;  1SD7 A;  1V3F A;  2DTZ A;  2NS0 A;  1D5V A;  4DIQ A;  1WJF A;  2XGD A;  4RAY A;  4WB2 A;  2VQG A;  1OLT A;  3QP6 A;  5A2Q K;  3HJE A;  3ESW B;  4PGH A;  1XPX A;  2IBD A;  2PMZ N;  2JA2 A;  5AIQ A;  3ABK H;  3HEF A;  2VN2 A;  1JTX A;  1QZZ A;  5LHG A;  3A0H C;  2K3F A;  2JSC A;  4MGR A;  4JYK A;  5CVR A;  1D8J A;  1VQN I;  2VXD A;  4HZF A;  1D1C A;  2JN6 A;  4A3J J;  1DGW Y;  2P6T A;  5IPA A;  2NVT J;  4FHT A;  2BEO A;  5K5Q A;  4KMF A;  2M1B A;  2R7T A;  3Q9V A;  1BM9 A;  1KU9 A;  2YPR A;  3OIO A;  4B4C A;  3DKX A;  1NHA A;  3FXQ A;  4E70 A;  4LIU A;  2M4G A;  2O8X A;  4C3I J;  3QWL A;  2OUM A;  3HUG A;  3LFU A;  2LRD A;  5C3E J;  2M5W A;  2KZV A;  4YIF A;  1E3O C;  2EZL A;  5JPN B;  2W82 A;  2AO9 A;  2V1N A;  1BC7 C;  4EM0 B;  3U1K A;  4OIR F;  5D4S A;  5F1J A;  4PFO A;  3WGI A;  3Q3S A;  5CJ9 A;  1FMW A;  2CQX A;  4Y17 A;  4PJN A;  2QCO A;  5F08 A;  3PL8 A;  3DP7 A;  4LLN A;  2MH9 A;  2IXS A;  3K7A J;  2PQ8 A;  3TDU C;  5IP6 A;  4P5O A;  2CQQ A;  2RV8 A;  4HNT A;  5IY5 H;  1YRN A;  1ZEL A;  4XRS A;  2KMU A;  4BQO A;  1YJ9 I;  2FRH A;  2E5N A;  3DEW A;  3R61 A;  2F5V A;  3R0A A;  2VKH A;  1G3W A;  1FYL A;  2ECB A;  4BJ6 C;  3BR0 A;  5FO5 A;  3OS1 A;  5EG0 A;  4Y33 A;  2WBM A;  4E4H A;  3AAF A;  2LRE A;  2VBW A;  1Z77 A;  4PUS A;  1IJW C;  4MHG A;  2DMP A;  2XAF A;  1FSH A;  1QPM A;  3OR2 C;  4EEF G;  4WCG A;  1TW3 A;  5FGM A;  1DP3 A;  1I27 A;  2B9S A;  1ORK A;  2DT6 A;  5F0F A;  3AL0 C;  1G59 A;  4P39 A;  2KIQ A;  2V7F A;  4BE2 A;  1Z21 A;  3GBG A;  1RES A;  3QYB A;  2MC4 A;  4MFE A;  2XIG A;  2R92 J;  5E3O A;  1R5H A;  3H3U A;  2BY0 A;  2CUZ A;  2R5Y A;  1YJN I;  2LNB A;  1Z7L A;  4HA8 A;  4E7Z A;  2H8R A;  3QOE A;  4UUV A;  2MG4 A;  5L3D A;  4L5E A;  3S2W A;  1TP4 A;  4DJA A;  3H3V K;  2ESN A;  3HBL A;  4M6X A;  1I39 A;  1BI1 A;  2L9R A;  4JX4 A;  2RVC A;  3BP8 A;  5FJ8 J;  4M3D A;  2HVR A;  3KIO A;  2DMQ A;  1MMD A;  1N75 A;  4IHS A;  2ADU A;  2R7Q A;  2O9L A;  5DD4 A;  4BU2 A;  2F5D A;  4YEJ A;  1UCR A;  2O61 A;  2CUE A;  5K7H A;  3ZN0 A;  3EUH A;  2PI0 A;  2IS2 A;  1J9I A;  1Z05 A;  2IJL A;  4H0E A;  4FT8 A;  1LFU P;  1IN7 A;  3FXM A;  2LP0 A;  3WU1 B;  2V6E A;  3K1P A;  5FKL A;  4A3D J;  4RBO A;  4UY8 I;  4IRG A;  2VAS A;  3CD6 I;  3HSR A;  1U9N A;  2R4G A;  1OCZ H;  1RI7 A;  2NOJ B;  1SFX A;  2QQ8 A;  1LPQ A;  3W2W A;  4B8X A;  1D5Y A;  1DPU A;  1CQT A;  4HNU A;  3FBI B;  1IRF A;  1T39 A;  5FRM A;  2XSJ C;  2X6X A;  3NAU A;  2W1O A;  4CCN A;  3ZMS A;  3CF2 A;  1WJB A;  3REO A;  2Z2S B;  4IXA A;  2MGQ A;  2R5Z A;  4IVN A;  1R4N B;  1SC7 A;  2K9L A;  4XQF A;  3TKY A;  3COA C;  1CFA A;  2LTP A;  3ZP5 A;  2M8E A;  3TOB A;  1REP C;  2EIK H;  3TO6 A;  2KJC A;  1FX7 A;  1R1U A;  1O3S A;  1YOV B;  3BR5 A;  2Y31 A;  5ILV A;  4D7M A;  2A5Y B;  2RDP A;  3AFH A;  3UR3 C;  3S14 J;  1GT0 C;  1P92 A;  1IRZ A;  2OCC H;  1P4A A;  2Z99 A;  2QUF A;  3K70 C;  1ETV A;  1ZLJ A;  1K78 B;  3GYH X;  1XMK A;  3EQL F;  2B39 A;  4RM3 A;  3ECO A;  1IXC A;  4ITV A;  3FXO A;  3NAR A;  3JW4 A;  5CVV A;  3RKW A;  3L1P A;  1WHU A;  3FBN B;  1TNS A;  1PYV A;  1V4R A;  2ELH A;  4L0Y B;  5DTD A;  5LGT A;  3ZN1 A;  2KP6 A;  3ZQH A;  2P0W A;  1FJL A;  1DU6 A;  4AWX B;  3DV8 A;  4LLG F;  4XON A;  1S6L A;  2L9N A;  2CS3 A;  3KP6 A;  2DA4 A;  2EV6 A;  4M3F A;  2STT A;  4KIS A;  4ZH4 F;  3B6A A;  4OAZ A;  3M8F A;  4ZTJ A;  1P6R A;  1QHH D;  3AL0 B;  2JA6 J;  4CUG A;  3GFM A;  1GUU A;  1Y8R B;  5IYD J;  4F93 B;  5LEK A;  4M74 A;  5KVR A;  5ICC A;  4HV6 A;  5J4V A;  4BY7 J;  2XRN A;  2X6O A;  2BHY A;  4OMZ A;  3NQO A;  5EGO A;  2IRF G;  3KZZ A;  1EV7 A;  1VQ7 I;  3P9C A;  2ZJQ F;  5EYR A;  4EM1 A;  2DQL A;  3KZY A;  5FRO A;  4EM2 A;  3OYH A;  3GTG J;  3CCS I;  3RCO A;  1IC8 A;  4ANJ A;  2GXA A;  3KCC A;  1IN8 A;  2R5Y B;  4XM3 A;  4XRF A;  1NG6 A;  5KAI C;  4FCY A;  2FJ1 A;  4FTH A;  3P5J A;  1JJ8 C;  2HPM A;  3EYI A;  4CXF A;  1FYM A;  3OYK A;  1O3Q A;  1UEL B;  1E2X A;  3HB9 A;  5HVQ C;  3PM1 A;  5EZG A;  1VF9 A;  3MVP A;  2GAU A;  3P7N A;  4RLF A;  2X6W A;  3BT9 A;  3HUG B;  4BAC A;  4E7J A;  5D8K B;  2UXN A;  3VWB A;  1LVK A;  2E7W A;  3MKW B;  3H5A A;  2X4H A;  2YU3 A;  5B5E C;  3CJQ B;  3HKZ N;  4LB6 B;  2HFH A;  2KJB A;  1FT9 A;  2IA1 A;  2VC1 A;  4RMN A;  1XGO A;  2Z5U A;  4HNV A;  2A3S A;  5ICF A;  1MSE C;  3OWT A;  2ID3 A;  3QU3 A;  3DTE A;  1OIS A;  1J0R A;  4QPQ A;  1QHG A;  1X19 A;  1P2F A;  3L7W A;  4ABZ A;  3LAJ A;  5FFZ A;  4MEX F;  3G3Z A;  4MQ9 F;  2KHM A;  2GOM A;  3TO7 A;  4RB0 A;  1D3Y A;  2A61 A;  2BHZ A;  2L02 A;  4L9N A;  3H3Z A;  2MBF A;  1EKE A;  2F48 A;  3O8G A;  3BCA A;  1F36 A;  4F55 A;  1WJA A;  3N05 A;  3GME A;  3BG3 A;  5ERI A;  3HOZ J;  2LBF A;  2FNA A;  2PFB A;  3BQZ A;  5HLI A;  4IOC F;  3HOW J;  1I3A A;  2M8G X;  1FMV A;  3CUQ A;  4BDZ A;  2DU9 A;  3QQA A;  1MBK A;  3ZMD A;  4FET A;  4LLL A;  2Y0M A;  1WJ5 A;  1QRY A;  1FIP A;  2X0L A;  1VZ0 A;  4O5V A;  5KNL A;  5BS6 A;  4G7H F;  3JRB A;  2VJ4 A;  2Z33 A;  2EFW A;  4PK4 A;  1MGT A;  1TQP A;  2PBI A;  1PDN C;  4LIT A;  1TTY A;  3EYY A;  5EJC A;  2ETH A;  2E19 A;  3SJM A;  3FWE A;  1LKX A;  3L9F A;  1K78 A;  1FP2 A;  4P55 A;  4A0Z A;  3S17 J;  5TJJ A;  1H9G A;  2K02 A;  3CZ6 A;  2HXI A;  4IJA A;  4ZC3 A;  4DBQ A;  3GZ5 A;  2LFB A;  4B3X A;  4D5F A;  3CCQ I;  3R0J A;  2Z1D A;  1J2X A;  4RLQ A;  2QF7 A;  1TZL A;  2WV0 A;  3BQY A;  4HAM A;  3CUQ B;  5B1B H;  2EIN H;  1FLI A;  3OYG A;  3DTI A;  2X1D A;  5DV5 A;  3DLA A;  2A05 A;  4A3L J;  1JHF A;  4XN0 A;  3WTX C;  1Q1H A;  4EJV A;  1R6R A;  4A3E J;  3E7L A;  1I1S A;  4HOB A;  1RIO H;  3DWL E;  2LKP A;  4NUB A;  5L3G A;  1YG2 A;  4I76 A;  3HTS B;  4ENM A;  2NRA C;  2A68 F;  2Y0S N;  2NS8 A;  4G7Z F;  3CP2 A;  4CCK A;  3QYF A;  1YW9 A;  3PJR A;  2BXY A;  2A07 F;  2CH0 A;  4KT5 C;  4XLP F;  1VQO I;  1ACI A;  2O03 A;  2PMU A;  4C9Y A;  3VDX A;  3V8J A;  1BOA A;  1JKQ C;  3DQV C;  3PFI A;  2XAJ A;  2M30 A;  4MNU A;  1E3P A;  1R00 A;  1MH3 A;  2KZG A;  4A5M A;  4F92 B;  4PCQ A;  1BIA A;  1JUS A;  3JCU C;  3JRE A;  3V8K A;  3X2Q H;  5ED4 A;  2TCT A;  3RIR A;  3F23 A;  2E1M C;  1JTY A;  3HQA A;  1C0W A;  3CLO A;  4L0Z B;  1X3W B;  1KJS A;  1LVA A;  2O3F A;  1OR7 C;  5JHF A;  5K1Y A;  1F4K A;  1Z0X A;  2W25 A;  1KU3 A;  1BI3 A;  2OCE A;  4BY1 J;  1XTA A;  1XSV A;  4ENK A;  1GV2 A;  2H27 A;  4O3M A;  5M5W J;  4ENJ A;  1HCR A;  3CC4 I;  2QQ9 A;  1EA3 A;  2B63 J;  2DLL A;  3ZMT A;  3QAH A;  1XDS A;  2Y48 A;  1GVJ A;  3LL7 A;  3JTG A;  4I98 B;  5M3M J;  2CW7 A;  4MTD A;  1SVM A;  4HX4 A;  4BJT A;  5BOX A;  2OV7 A;  2FF4 A;  1ETX A;  1B8I B;  3VOD A;  1XGN A;  3HOY J;  5CVU A;  3HQB A;  4S04 A;  1TBX A;  3K4L A;  1J59 A;  3L2R A;  2DOA A;  2ESH A;  1R23 A;  2M3A A;  3LQQ A;  2CSO A;  3V7S A;  1XB4 A;  1P4X A;  3L2Q A;  3AG2 H;  1K83 J;  1LNW A;  2MH2 A;  1JUP A;  2E7X A;  5B3S H;  5JVG F;  5M3F J;  2E1M B;  3SHF A;  4ZJZ A;  1LEB A;  2L7M P;  4G7O F;  1FTT A;  2L9S A;  3HIF A;  4I0B A;  3PIO F;  1N25 A;  3CU7 A;  2O6G E;  4HST A;  2V1X A;  3DLL F;  4EV0 A;  2RGV A;  1SFO J;  1HQC A;  3OSG A;  1A31 A;  2F4O B;  4LJZ F;  3WTW C;  3B02 A;  3HPG A;  2E2I J;  1MBH A;  1X1P A;  4Q4Z F;  2CWE A;  2AQF A;  1AHD P;  4U0W A;  3KP7 A;  2ID6 A;  1S7A A;  1TT0 A;  3LA2 A;  4NDL A;  1XMA A;  3SQN A;  3FXU A;  2M87 A;  4G6D A;  2L7F P;  3A2K A;  2Q2E A;  5F0H A;  5JR3 A;  3ASN H;  2DTR A;  2CV1 A;  1Y56 A;  2YX4 A;  2W48 A;  2P5K A;  3MKY B;  3FX3 A;  3V8L A;  5FLX K;  3M07 A;  2GIZ A;  4C2U A;  2VQL A;  4HLX A;  1FIA A;  3J81 Z;  3WU0 A;  2YR2 A;  1K4T A;  1TQM A;  2EWN A;  3K4N A;  2XAU A;  2TRT A;  5GPA A;  1Z7U A;  2L54 A;  4YFN F;  5FKN A;  4XLC A;  1W0T A;  2E1C A;  4KYW A;  3F8C A;  2R0Q C;  4OIN F;  1T2K A;  5JFR A;  2P4W A;  4FXG B;  4I01 A;  2F4I A;  4YFX F;  2BVL A;  3F8F A;  4LG0 A;  3DTK A;  3OR1 C;  3ML6 A;  3BJ6 A;  3DEE A;  4N4O B;  1VQM I;  3DFG A;  1W4M A;  4Y52 J;  1EH6 A;  1LFP A;  3K2Z A;  1GXQ A;  3H9Q A;  4FIS A;  5EZH A;  1HLV A;  1MMS A;  3WOD F;  1YO5 C;  3RPU A;  1KU7 A;  2VUM J;  4KIT B;  2ZXI A;  1Y8Q B;  1VND A;  2HTS A;  2R7O A;  1K6Y A;  3S1M J;  5J3L A;  1FC3 A;  4JK1 X;  3WE2 A;  1YIO A;  1X1B A;  1RPW A;  4NB5 A;  1D0X A;  4XSX F;  3BY6 A;  5ILS A;  2ZNZ A;  3ASO H;  3F9K A;  3VPR A;  4AIH A;  4XRM A;  1LFB A;  3S3M A;  1ZQ3 P;  4HW5 A;  2VLA A;  4RGU A;  3FXK A;  2HQA A;  3JR9 A;  4BEH A;  5FLM J;  2DFH A;  1W0U A;  4PSW A;  1W7P B;  1ZRF A;  3HC7 A;  1FOY A;  3WTV C;  2KIS A;  4XL9 A;  1WI9 A;  2UXX A;  3ABL H;  2XB0 X;  1Z6T A;  2QSH X;  1OCR H;  4G8X A;  4V19 K;  2CQK A;  3J80 K;  4A0Y A;  5C4J J;  5DM7 F;  4IZZ A;  2V9K A;  1U8B A;  1N78 A;  2FOK A;  4LD5 A;  4M71 A;  2ZKZ A;  1EH8 A;  3ZMU A;  5IT3 A;  2JQ7 A;  2VKE A;  3I4P A;  5E1Z B;  4A93 J;  4DZP A;  2I10 A;  1GXP A;  3WG7 H;  3HTU A;  2UZK A;  3BR2 A;  2QZ8 A;  2N8G A;  3DBH B;  1B59 A;  3S1Q J;  3E6D A;  4B47 A;  4GGG A;  3MZH A;  2R93 J;  2KLO A;  1MJ9 A;  3PSF A;  5J8F A;  1SEU A;  4EVI A;  2STW A;  3MKL A;  2JK3 A;  2JRT A;  1XGM A;  1MND A;  2D1V A;  4B1R A;  4ASN A;  2QSG X;  4CHU A;  1G8X A;  1H89 C;  2HEO A;  2QBY A;  2MA3 A;  3A03 A;  4CA0 A;  4S05 A;  1BR2 A;  1RKW A;  5E1X A;  3L2U A;  3VEP A;  2KRF A;  3TP0 A;  3PUF A;  1XC5 A;  3CES A;  2DN0 A;  2JWT A;  1E3H A;  3WTY C;  3RJP A;  3I59 A;  2Y69 H;  1O7L A;  4HEA 2;  5FB2 A;  3C2G A;  1OMI A;  3GUD A;  5EGO B;  2K85 A;  2EBI A;  4ESJ A;  1BJZ A;  1R9T J;  2O5R A;  5GTH C;  3OYJ A;  3G1O A;  3KX2 A;  5IT9 Z;  3DU6 A;  5LLQ A;  1YRN B;  2V1D A;  1X1A A;  2TDX A;  2Y2Z A;  1TWH J;  4AIK A;  2DQR A;  2OQR A;  4F7Z A;  3Q0W A;  1W36 C;  1JKR C;  1WRJ A;  4WF2 A;  3TQN A;  4BBR J;  5EG0 B;  1PVE A;  2E71 A;  3DBL B;  1V5E A;  4J19 A;  1TC3 C;  2XV4 S;  3WGH A;  3ZRG A;  1P7J A;  4LB5 A;  1W5S A;  2DOD A;  1X2M A;  1POG A;  3UKG A;  1T0F A;  1J5Y A;  4E7K A;  2HDD A;  2R7Z J;  3HDD A;  2EIJ H;  4M3B A;  3CJT B;  1K7A A;  3BG9 A;  4G9Y A;  5IT9 K;  1KQ9 A;  2DPU A;  2RQP A;  1D0Y A;  1HW2 A;  5GPC A;  5M5Y J;  1MH4 A;  2FA5 A;  4DZJ A;  3V4G A;  2FBH A;  2AQE A;  4XLF A;  2KQR A;  4N4N B;  3RKQ A;  5HDN A;  4Q48 A;  2LKX A;  2W85 A;  4DYQ A;  2ZCW A;  2VQH A;  1T8I A;  3MN2 A;  3B6C A;  3HM5 A;  3GFL A;  4YII A;  3HPH A;  4A0X A;  2FU4 A;  5D5V B;  2CV2 A;  3HOU J;  1BI2 A;  2HOE A;  3V7R A;  4NC7 A;  1G6N A;  1U5T C;  3RQI A;  5D6E A;  4QWQ A;  3ROU A;  4BUP A;  3CME I;  1YLF A;  1IXR C;  3VYT B;  5J4Y A;  3IWF A;  3CCL I;  5L3F A;  2V1U A;  3J7A Y;  1UHM A;  2KDZ A;  3IL2 A;  2XRL A;  1DUX C;  2BE5 F;  4I2O A;  4LOC A;  2F5E A;  1WH7 A;  2BZT A;  2I8D A;  5D5W B;  5IP7 J;  4G6T B;  1LQ1 A;  4UUS B;  1LEA A;  4L5I A;  3KLS A;  1HW1 A;  1T98 A;  4YRV A;  4NC8 A;  2CQN A;  1PUE E;  1KQ0 A;  1JT6 A;  4AYB N;  3BR3 A;  4P1W A;  2O0Y A;  2G7U A;  1OJL A;  5LEJ A;  2XF7 A;  4HQE A;  2B0L A;  2EA2 A;  2VT3 A;  3HRT A;  3FM5 A;  1FPQ A;  4Z2Y A;  3JRA A;  3HOT A;  2ISY A;  1ZH5 A;  5BNG A;  1LUJ B;  4CSW A;  1ZKG A;  3FM3 A;  2ZXH A;  2VJJ A;  3VB2 A;  4V2G A;  5D5X B;  4ZDL A;  1W1W E;  3K4K A;  1VQ8 I;  2KIM A;  1ZR4 A;  5J1R A;  3GTM J;  3FK6 A;  3OL4 A;  3K4B A;  3SYT A;  2GBY A;  2LH9 A;  3BPX A;  5E3M A;  1AWC A;  2W00 A;  4X1E A;  2Z9O A;  4IOA F;  4BHC A;  5GAD J;  2DFI A;  2MFZ A;  3FMS A;  3B73 A;  1BA5 A;  4ZYH A;  2Q1Z B;  2EK5 A;  2CU7 A;  2LC2 A;  2X85 A;  3OYF A;  2YU9 J;  2DI3 A;  2PX9 A;  3GFJ A;  1AU7 A;  3ISP A;  3I71 A;  3LAP A;  2WV1 A;  3GZ6 A;  3JSP A;  4OMY A;  2DOE A;  4RAZ A;  1BJA A;  2IVM A;  4IQJ A;  4GXO A;  4NNJ A;  3CCU I;  2CYY A;  4PGG A;  5HNH A;  3BDD A;  5KK1 A;  1ZYR F;  1W7P A;  2HYJ A;  4OIP F;  3C2B A;  2RC4 A;  3IH3 A;  3K4C A;  3LA7 A;  1WZ2 A;  1U3E M;  3I0T A;  1XX5 A;  2ELK A;  5EF6 A;  1I1G A;  3S3O A;  3WTT C;  5HS8 A;  1FBS A;  1MZB A;  1GLN A;  2PN6 A;  5E17 F;  3FIS A;  2NNY A;  4AU7 A;  1V54 H;  1D1B A;  1TWC J;  1ZAR A;  3IWZ A;  5B1A H;  2R7F A;  4N9H A;  2L7K A;  3R4K A;  3CP8 A;  5ILU A;  2MYS A;  2R7S A;  1WH5 A;  3LSR A;  2BBY A;  1S29 A;  3KLO A;  3MZ8 A;  1GDT A;  3ZMZ A;  2ZFW A;  3UNG C;  2A6H F;  2GA1 A;  5DM6 F;  3E5X A;  2A6E F;  1MNM C;  2DDA A;  2HDW A;  2Y9Z A;  3HOV J;  1SMT A;  4KIF A;  3QPT A;  1E0E A;  1J09 A;  1ZRD A;  3OYM A;  2BY3 A;  2Y0S A;  1KA8 A;  3VFZ A;  2O7O A;  2HWV A;  4IHX A;  1B9M A;  2MLK A;  4I6O A;  2HYG D;  3TGN A;  4PJ0 C;  2EH3 A;  2K9S A;  2LOO A;  2HKO A;  2DMN A;  2GWR A;  2QYO A;  2VPR A;  2XAS A;  3E6C C;  1IN4 A;  2OF7 A;  3SZP A;  1WGX A;  5LHH A;  1JI8 A;  2BVM A;  4B09 A;  3SFZ A;  1T56 A;  2FBK A;  5E3L A;  3HSF A;  1LE8 B;  4YEL A;  2VOO A;  1QBJ A;  2ZJ2 A;  3PQJ A;  4F3Q A;  2WAD A;  3KPH A;  2XPU A;  2GXB A;  3LSH A;  2HTJ A;  1AOY A;  2LSO A;  1WI3 A;  3QP5 A;  3ERM A;  4ZZD A;  1APL C;  3BTI A;  1GHC A;  5FKM A;  4J01 A;  1FYK A;  4TV7 A;  3ABT A;  4HX8 A;  2HS5 A;  1EJ9 A;  1IRG A;  4WXC A;  2QLZ A;  2XSD C;  1B72 A;  4XLH A;  4AVZ A;  4L9J A;  4BH9 A;  3CJN A;  1JGG A;  3KE2 A;  1Q1V A;  3LSG A;  3J7Y J;  2K9N A;  1UFM A;  2YX7 A;  2E35 A;  3BPV A;  2ECC A;  5DCM A;  3MEX A;  2K5C A;  3F72 A;  4ZYD A;  4WK8 F;  4LIV A;  5F0C A;  4RB1 A;  4ZYA A;  3DPT A;  3J7A O;  1A36 A;  2MD0 A;  4FXK B;  4RGX A;  2P7C B;  2BY1 A;  2CJJ A;  3S32 A;  1GV5 A;  1YTY A;  3CUO A;  5CQG A;  4E7I A;  2DYR H;  2E2H J;  4LK1 F;  4R8H A;  2HNH A;  2GOX B;  4OOI A;  4XIC A;  1P9Q C;  4YFK F;  2VJI A;  3D5L A;  2XAH A;  4RB3 C;  2E36 A;  2C6Y A;  3F8N A;  5DS9 A;  2CUJ A;  5BPI A;  3OS0 A;  3L2C A;  1BOB A;  3I4N J;  1B9N A;  1IUF A;  1V5F A;  2OQG A;  4BQQ A;  3F8M A;  2W4S A;  3U21 A;  4AUX A;  5DCM B;  2DYS H;  4BE1 A;  4I6Z A;  2BY2 A;  3CO6 C;  3H9J A;  4RS8 A;  1MSF C;  3TBI A;  3T8T A;  2ISZ A;  1R58 A;  4IF4 A;  1XSX A;  1ON1 A;  3GTO J;  4JQF A;  5FKO A;  4OAY A;  4KIG A;  2HR3 A;  5DUI A;  2XF6 A;  2HXO A;  2PJR A;  4X0G A;  4H4K C;  5HLH A;  3BTL A;  3I58 A;  3G71 I;  2H6B A;  4W1U A;  2M4K A;  3PQK A;  4GO1 A;  3FF5 A;  3BTJ A;  1ZG5 A;  4F91 B;  1ZG3 A;  4DQ2 A;  1DGR M;  2P81 A;  2WAF A;  4ESF A;  3EPZ A;  1VQ6 I;  3WTZ A;  2BYV E;  1S7O A;  4G12 A;  3CCR I;  1Z91 A;  3LSP A;  2CFO A;  1SD4 A;  4XOT A;  5CVJ A;  4EGY A;  3KYD B;  4UUT A;  1K4S A;  5C4X J;  3K2A A;  2OC6 A;  3OIP A;  3VOE A;  2DA2 A;  4MLO A;  4D1Q A;  1OYY A;  2CMP A;  3PO3 J;  1L3L A;  4NQW B;  2X6Y A;  2H8W A;  5JVT A;  2DOF A;  1SAU A;  2L5Q A;  3P9I A;  1VI0 A;  1X4P A;  2DA5 A;  2XRO A;  4A5N A;  1OR7 A;  2UV1 A;  1ZAO A;  3I5U A;  3IUO A;  4RGR A;  5IOY A;  1MW7 A;  1F1Z A;  3BG7 A;  1HOM A;  1R7J A;  1SMY F;  3G73 A;  1A04 A;  4CIC A;  4UV8 A;  3SZT A;  1H9T A;  2OTJ I;  3BOQ A;  1KYZ A;  3KEY A;  3LSM A;  1IV6 A;  1E17 A;  1T38 A;  4ETS A;  3DKW A;  1KQ8 A;  2CW8 A;  4UB6 C;  1YW7 A;  2DW4 A;  2J5P A;  3S2D J;  3F3X A;  1ZRC A;  3WG9 A;  5EDN A;  3OYN A;  9ANT A;  2NOG A;  2CO5 A;  1WVR A;  4Q47 A;  1MMG A;  1LE8 A;  1T6S A;  3JAM K;  4PDK A;  1B6A A;  2EB7 A;  5KHD A;  3TP3 A;  2OPT A;  4G6Q A;  3KP2 A;  1NH3 A;  4CCM A;  3JRG A;  1B8I A;  5F27 A;  1VQP I;  4CO8 A;  2Q0O A;  1TWA J;  1QVU A;  2DA3 A;  3QPS A;  4M72 A;  3DPU A;  5K7F A;  1RRJ A;  1KZH A;  1R1T A;  2F2E A;  1IV8 A;  1QU3 A;  3D5R C;  2HQR A;  1MD0 A;  4R1H A;  3I4M J;  4C3H J;  1YHQ I;  1GVD A;  3ZQC A;  3BLY A;  1FEX A;  4RB2 C;  3G6E I;  5HLG A;  4EJT A;  4CDG A;  3GTQ J;  4UNO A;  3FK7 A;  3J81 K;  4V2F A;  3ABM H;  4IO9 F;  3SDG A;  2LY9 A;  2LLK A;  2P5V A;  3MZY A;  2DK5 A;  2W24 A;  3F6V A;  1FOW A;  1G3Y A;  2DFE A;  1BW5 A;  3J7Z I;  2R5Z B;  2J5O A;  3TDZ C;  4HF1 A;  3QU6 A;  1HST A;  2OZU A;  4CH7 A;  3JSO A;  2LF8 A;  3G1M A;  2QBY B;  3NRV A;  1BL0 A;  1R49 A;  2ZME C;  2LF7 A;  1U0J A;  4NC6 A;  2A73 B;  4A12 A;  2X1E A;  2MD5 A;  4WB3 A;  2WC2 A;  4DW6 A;  4GCV A;  3FKI J;  2HPI A;  3FIW A;  3FHZ A;  1HBX G;  3GTK J;  2RRE A;  1Y1V J;  2WB1 N;  3MWM A;  5FD5 A;  3QRF F;  2LG4 A;  1CF7 B;  2A6T A;  5LHI A;  1S72 I;  2QWW A;  2E1O A;  4I99 C;  5J6X A;  1U78 A;  1X1C A;  5IP9 J;  3IC7 A;  2XKP A;  1WCM J;  4BYY A;  4A3M J;  4OIQ F;  1HKQ A;  4A3I J;  2R3S A;  3E6B A;  2QSF X;  2OBP A;  2QEN A;  4M73 A;  3OYI A;  4KFC A;  2JUC A;  5HDK A;  1JHH A;  2DJN A;  3LSI A;  3EDP A;  3A01 A;  2COM A;  3IAM 2;  5CYV A;  2YUS A;  2ICW G;  4Z6Y A;  3FHN A;  2ME0 A;  4L9V A;  4HSR A;  4LGW A;  4XR6 A;  3ZQG A;  2FE3 A;  4EGZ A;  3R6S A;  1HKT A;  2PJP A;  2ZBK A;  1B72 B;  3GXO A;  3OYD A;  4WXH A;  3S15 J;  1MNE A;  1RUO A;  3GW2 A;  4MQV A;  3PNY A;  4XOR A;  1UAA A;  2Z16 A;  5E20 A;  5KAF C;  3WTU C;  3E3V A;  2P5L C;  1Z3X A;  2CFX A;  3MAJ A;  5H6Q A;  4UUS A;  2ACJ A;  4ON0 A;  3TO9 A;  2IPQ X;  2XGC A;  1QPI A;  1J75 A;  2DMT A;  2KIU A;  2BW3 A;  2VE8 A;  3DXJ F;  3K10 A;  5L3B A;  3HGY A;  6PAX A;  1RZ4 A;  4IHT A;  1KU2 A;  3SDB A;  2OA4 A;  2P6S A;  1XN7 A;  5L3E A;  2ZXW H;  3OL3 A;  1QQI A;  2XAQ A;  4IEJ A;  3LST A;  1P7I A;  4GYG A;  1LDK B;  1S3J A;  4A3K J;  4I02 A;  4HDV A;  2GZW A;  3LFK A;  2LR8 A;  2HU9 A;  2H94 A;  1MBG A;  3C3W A;  4A3B J;  3RZD J;  3SEQ A;  1A35 A;  1D0Z A;  4PZJ A;  2R7D A;  4JX6 A;  1XCB A;  4XKV A;  3SEZ A;  3K70 D;  1K6O A;  4DYC A;  2WAQ A;  3GLX A;  1IG7 A;  1Y0N A;  4M3G A;  1X1D A;  3T1B A;  2WWY A;  4BGD A;  3FDY A;  3C1D A;  3A0B C;  5EEH A;  1RC9 A;  3KEO A;  4MTE A;  2LY2 A;  1X2N A;  3GEZ A;  2QEX I;  4BXX J;  1F5T A;  2NVY J;  4L9T A;  1WJD A;  4KT6 A;  1RR8 C;  1V55 H;  4I0A A;  3CCE I;  2RNG A;  1WFX A;  1OYW A;  4QTR A;  4XLN F;  3BZC A;  1SVO A;  2F6C A;  1ULY A;  2EZI A;  2GIV A;  4AD9 A;  2ZSH B;  2H6C A;  4GFB A;  3BG5 A;  5F64 A;  4KDP A;  1MBE A;  1NG7 A;  3AG1 H;  1WJC A;  1X3U A;  4CCO A;  3ABU A;  3EUH C;  1JT0 A;  1ETO A;  2HKX A;  2CGP A;  4AYB A;  3IV5 A;  4XLE A;  5JHU A;  4JP0 A;  2ME6 A;  2IGN A;  2M45 A;  3BRO A;  4WX9 A;  3D1N I;  3KP3 A;  3CLQ A;  4EJU A;  2JT1 A;  1YQA A;  2KL4 A;  3CQZ J;  1RNL A;  3IKT A;  4IHV A;  5BQT A;  1QZE A;  3C18 A;  3FZV A;  1ZG1 A;  3HXL A;  3KP5 A;  4XKC A;  5DCF A;  4ZDO A;  1IN6 A;  2AHQ A;  1WPK A;  3I59 B;  1OPC A;  2DA6 A;  3OS2 A;  4BXU A;  2NVQ J;  5B66 C;  1SD6 A;  2G0E A;  3W2V A;  3CDI A;  4M3E A;  3JAM Z;  5LD2 C;  5IYB J;  3KLN A;  2OAZ A;  3MMY B;  2L0K A;  4HYE A;  4UHT A;  4CZC A;  1FZP B;  2AXL A;  1NTC A;  4PJM A;  4P9F A;  2VJ5 A;  4M9X A;  2MSY A;  1UG2 A;  1NK2 P;  3OYC A;  2H1L A;  3PO2 J;  3MD2 A;  4BBS J;  1IN5 A;  4BL0 B;  1U2W A;  2WAE A;  2X1C A;  4BXF A;  4P96 A;  4L5J A;  2FQ3 A;  4A2U A;  4E7L A;  4NHJ A;  1DU0 A;  1IO2 A;  4J00 A;  3IP4 B;  3ZQL A;  4C30 A;  3DCF A;  1OCT C;  2IP2 A;  4U87 A;  1MMA A;  2ZJR F;  2EA4 A;  1PJR A;  2M7A A;  3H0G J;  2EFO A;  1VFC A;  3CDL A;  4XLA A;  1G2H A;  3OSF A;  3S1R J;  2FSW A;  4IX7 A;  4EJO A;  1ZTR A;  4CZZ A;  2KKO A;  3HHH A;  2P8T A;  2FBI A;  5KCM A;  5CLS A;  4IRH A;  3CCJ I;  4BQA A;  3FXJ A;  4P3B A;  1UMQ A;  2BW3 B;  2V26 A;  4QLC U;  1QVT A;  1B4A A;  1JGS A;  3RZO J;  1X58 A;  2HGC A;  1TW2 A;  3K6G A;  2EIM H;  3F21 A;  5HS7 A;  2AS5 F;  2HVQ A;  3BCB A;  2NAZ A;  4BNC A;  1QZY A;  2IGO A;  1DPR A;  3T5X A;  1RET A;  2EFN A;  2XKO A;  2QA4 I;  5H6R A;  2FNP A;  2WY7 Q;  3CTA A;  5JLW A;  2XB5 A;  1IF1 A;  2Y9Y A;  2P7V B;  3KEQ A;  1S7E A;  2DFF A;  1SFK A;  3EET A;  1KGS A;  3A01 B;  4UV9 A;  4EQQ A;  2DA7 A;  3K4J A;  3Q0U A;  1BI0 A;  1BN5 A;  2L2O A;  5DEQ A;  3ZCO A;  2M2E A;  4LMY A;  4IKF A;  2M7B A;  2XHK A;  1EH7 A;  1JUM A;  3OIQ A;  3OYL A;  2XAG A;  4A3F J;  2AXT C;  1FTZ A;  4EJW A;  1F9N A;  1XG1 A;  5LRS A;  2JZY A;  2O8K A;  1XDU A;  1YS7 A;  1VQ4 I;  3DF8 A;  3TL4 X;  1ZGA A;  2K7L A;  4Y3O A;  4AID A;  3GX4 X;  1IXS B;  1SFE A;  3GF2 A;  1G3T A;  4QSH A;  3OYA A;  2JJ7 A;  3C7J A;  4PSX A;  5F1R A;  1Z6R A;  3M8E A;  3AG4 H;  3FXR A;  1U9O A;  2L4A A;  1HA8 A;  3PFY A;  5GAG J;  4II2 A;  4GDF A;  3JRC A;  1LDD A;  2YS9 A;  4KMU X;  4HV5 A;  4XSZ F;  5LBQ A;  1IZ1 A;  2PMH A;  4S0H B;  3MKZ A;  1K79 A;  2E2J J;  1TLH B;  3JRF A;  1I3Q J;  4P3A A;  2RN7 A;  3W6K B;  1IRX A;  1Z67 A;  3O8H A;  2K27 A;  2IA2 A;  1U6G A;  2JSP A;  5HDG A;  3KET A;  2CRG A;  4XK4 A;  4A3C J;  4M6V A;  1W7P D;  4RDU A;  1VQL I;  2ZXJ A;  2JVG A;  1MIJ A;  4KIB A;  3WU2 C;  1ETW A;  1YFH A;  2GA2 A;  3RPQ A;  2NVU B;  3ZMV A;  3I54 A;  1YJW I;  4NBQ A;  1BC8 C;  4YIR X;  1BIB A;  4N0B A;  3CF5 F;  5K5R A;  3BZ6 A;  1FWZ A;  2HOA A;  3KP4 A;  2K3P A;  2LD5 A;  4BHB A;  4JX5 A;  3BZK A;  4GRI A;  4KJZ A;  3H92 A;  2ZME A;  1XMX A;  2X9D A;  2OZ6 A;  4IL6 C;  5D6F A;  2UWM A;  1MMN A;  4HX7 A;  3SFI A;  3ZQF A;  2D1H A;  5IOZ A;  4HW0 A;  4O6J A;  3RYR A;  3I3L A;  3DKY A;  1ETY A;  1TWF J;  2KT0 A;  4OU0 A;  1BW6 A;  2OD5 A;  4ZYG A;  5HLT A;  1X3Z B;  1ZRE A;  1FBQ A;  4MIM A;  1ODD A;  1BR1 A;  1A6I A;  3H5N A;  2BGC A;  3GLL A;  1I5Z A;  1W5T A;  4AC0 A;  1ZGW A;  4ZDP A;  4XOP A;  5JI6 A;  3CCM I;  1C5A A;  5GAH J;  4A69 C;  2L7Z A;  1UHW A;  5E3N A;  3U9G A;  4B43 A;  2FXA A;  3H0D A;  1CF7 A;  3S3N A;  3HSE A;  3BG6 A;  1YW8 A;  1A6Q A;  3PNT A;  1ENH A;  4LG3 A;  1MBJ A;  5A2Q Z;  2PLY A;  4D5C A;  4RAG A;  3R60 A;  3QPL A;  3FMQ A;  4BAY A;  5L3C A;  2FMY A;  1R36 A;  1WKM A;  2LMD A;  1D8K A;  3PIP F;  2ZO4 A;  5HOO A;  1TWG J;  2CV0 A;  1H8A C;  3DPL C;  3S2H J;  2EV0 A;  4JBA A;  4XKW A;  1VQ5 I;  3C2H A;  3I55 I;  2EFP A;  2E1N A;  3RPU D;  2RAE A;  2Z3Y A;  1S5L C;  2R7V A;  4UVC A;  1LDJ A;  1R5I D;  2NS7 A;  3PUB A;  2HQN A;  3E1S A;  3M4O J;  2RKH A;  5GTI C;  4CYD A;  5D5U B;  5CVI A;  2DDB A;  1SD5 A;  3M7G A;  3ZQI A;  1TL8 A;  2DXI A;  2JVH A;  1HC8 A;  3GO5 A;  1YX3 A;  1PP8 F;  3G1L A;  4PFP A;  1LJ9 A;  4EAT A;  1DP7 P;  2VBX A;  3F8B A;  3JRD A;  1RUN A;  2ZNY A;  5E1W A;  4AM3 A;  1HXD A;  4IHY A;  3ZQQ A;  3Q9S A;  4XKB A;  1JKO C;  4XRS G;  4U7B A;  3W2A A;  3GCM A;  2I5U A;  2VKD A;  3M1E A;  2PMZ A;  4OIO F;  4N9I A;  4KNY A;  1QNT A;  4A6E A;  3L00 A;  3LMM A;  3H9G A;  4FE7 A;  4HG2 A;  5C44 J;  2MLG A;  2R7R A;  1QA6 A;  1VQ9 I;  2K86 A;  4NQW A;  3VYU B;  3LQR A;  3MCZ A;  4C2T A;  1SFU A;  1ERD A;  2VL8 A;  1R1V A;  3ZXS A;  5ICE A;  2K9M A;  1V5G A;  1T08 B;  1UB9 A;  2L01 A;  3L2W A;  4IPA A;  3KFW X;  3CO7 C;  2QKM B;  1JKP C;  1Y0U A;  4HQM A;  4C2M J;  2NVX J;  3BJA A;  2FD5 A;  3F0C A;  5TRD A;  1DDN A;  3ULQ B;  2NNN A;  1Z3Y A;  2FML A;  4Y7N J;  4UXN A;  2DJI A;  3O3K A;  3IHU A;  1HDD C;  1D1A A;  3ZQ7 A;  1MDM A;  4M6Y A;  3GVA A;  2ZSI B;  1KYW A;  5CKT A;  4KN7 X;  4MO7 A;  3JTH A;  3S1N J;  2JTV A;  5TGT A;  5E8I A;  3Q5F A;  2ZJP F;  4XBF A;  2JMW A;  3AKZ A;  3L09 A;  1ZHF A;  2ZME B;  3M3Y J;  1QGP A;  1AA7 A;  4IQ4 A;  1SAX A;  4P9U A;  2EV5 A;  3LOC A;  2PJR B;  2IGK A;  3IH2 A;  2X51 A;  4G94 A;  2DAO A;  3I53 A;  2JUG A;  5FD6 A;  3CJR B;  1BR4 A;  1YE9 A;  3V7C A;  1G4D A;  2MW8 A;  3V42 A;  4D9J A;  2WB1 A;  1MJA A; 
#chains in the Genus database with same CATH homology
 3HC7 A;  1U0J A;  3M1C A;  4XL9 A;  2CUZ A;  2VB6 A;  1Z7L A;  2X1E A;  4E7Z A;  3QOE A;  4IZZ A;  2V9K A;  1N78 A;  1T95 A;  2HPI A;  4DJA A;  2BOL A;  2RRE A;  2KRH A;  2LG4 A;  2A6T A;  4II3 A;  3H35 A;  2HVR A;  1X1C A;  4BJ5 C;  4B47 A;  1MMD A;  1N75 A;  3OYI A;  2KLO A;  3PSF A;  2R7Q A;  3LSI A;  4BU2 A;  4YEJ A;  3IAM 2;  3FHN A;  1MND A;  4HSR A;  1G8X A;  4XR6 A;  4HPQ A;  4CA0 A;  2IS2 A;  1BR2 A;  3QOD A;  3L2U A;  3CMM A;  2V6E A;  3CES A;  3OYD A;  2MAB A;  3E0J B;  2VAS A;  1MNE A;  4HEA 2;  3C2G A;  3PNY A;  4XOR A;  5LFA A;  3W3C A;  2R4G A;  1UAA A;  2Z16 A;  2NOJ B;  1Z3X A;  3ZR8 X;  3W2W A;  1DQU A;  4HNU A;  2O5R A;  3FBI B;  3KYL A;  3OYJ A;  2BW3 A;  3KX2 A;  3K10 A;  5FRM A;  2XSJ C;  2X6X A;  2W1O A;  4CCN A;  3DU6 A;  3CF2 A;  3SDB A;  1X1A A;  1WJB A;  2Z2S B;  4BQN A;  3OL3 A;  2K9L A;  1W36 C;  4XQF A;  1LDK B;  3IAS 2;  4BEH B;  1W36 D;  1V5E A;  2HU9 A;  3RTR A;  3ZRG A;  2E60 A;  4PJJ A;  3SEQ A;  4B48 A;  1D0Z A;  3H5R A;  3UR3 C;  3AFH A;  3SEZ A;  3K70 D;  4XKV A;  1YX5 A;  2WAQ A;  3A1Y A;  2IS4 A;  4E7K A;  1X1D A;  3K70 C;  4BGD A;  3FDY A;  4RM3 A;  4ITV A;  1N77 A;  3FBN B;  1PYV A;  2UUZ A;  2LY2 A;  3OYB A;  4FAS D;  1D0Y A;  2KP6 A;  2KPM A;  4CCJ A;  2P0W A;  3FKJ A;  2IS6 A;  2M0M A;  2AQE A;  4XON A;  1WJD A;  4XLF A;  2L9N A;  4KT6 A;  2KQR A;  2CS3 A;  4N4N B;  2RNG A;  1WFX A;  4KIS A;  3G2B A;  4B44 A;  4OAZ A;  4ZTJ A;  4E6K G;  2F6C A;  2WA0 A;  1QHH D;  2VQH A;  3AL0 B;  4CUG A;  2ZSH B;  3HPH A;  4F93 B;  2CV2 A;  2LY1 A;  4HRI A;  1NG7 A;  4NC7 A;  3EUA A;  1WJC A;  4BUP A;  4CCO A;  3PNV A;  3EUH C;  3VYT B;  4DBR A;  3J7A Y;  3VYR B;  4AYB A;  4XLE A;  5FRO A;  2IGN A;  3OOU A;  3OYH A;  2I8D A;  3RCO A;  4G6T B;  4ANJ A;  2KL4 A;  4F52 A;  3PSI A;  3LSK A;  4XM3 A;  3HXL A;  1NG6 A;  3M8J A;  4XKC A;  4YRV A;  1S9H A;  4NC8 A;  4ZDO A;  2HPM A;  3OS2 A;  3VSK A;  3OYK A;  4P1W A;  3W2V A;  2HVS A;  1UEL B;  5HVQ C;  2XF7 A;  5LD2 C;  3HOS A;  3HOT A;  3MMY B;  4CZC A;  4RLF A;  2ELJ A;  2X6W A;  4CSW A;  2KRC A;  3HUG B;  4PJM A;  2ZXH A;  4BAC A;  2VXZ A;  4E7J A;  2VJJ A;  2Q2E B;  2VJ5 A;  3VWB A;  1LVK A;  3OYC A;  3MKW B;  3H5A A;  4ZDL A;  4JOM A;  3K4K A;  3MD2 A;  3CJQ B;  4BL0 B;  2FUG 2;  1T0F C;  2VIX A;  4RMN A;  2WAE A;  2X1C A;  3K4B A;  3OL4 A;  3SYT A;  4BXF A;  4E7H A;  2LH9 A;  2VPL A;  2XDV A;  2W00 A;  4PJL A;  4XMY A;  4E7L A;  3OWT A;  3HL2 A;  2MFZ A;  3DTE A;  3IP4 B;  4J00 A;  2Q1Z B;  2LC2 A;  4C30 A;  2X85 A;  3OYF A;  3NWS A;  4QPQ A;  1QHG A;  1X19 A;  4U87 A;  1MMA A;  1PJR A;  2M7A A;  2KHM A;  2GOM A;  3SZG A;  3HKZ A;  4DOZ A;  4XLA A;  3K4M A;  3OY9 A;  4IX7 A;  4IQJ A;  4NNJ A;  3BCA A;  4F55 A;  1WJA A;  3N05 A;  5KCM A;  2LBF A;  5HNH A;  2BW3 B;  4R79 A;  2RQQ A;  2V26 A;  3K4C A;  1FMV A;  3A4C A;  3K6G A;  4BDZ A;  3S3O A;  2HVQ A;  4FET A;  1WJ5 A;  3BCB A;  1GLN A;  1VZ0 A;  5KNL A;  2IGO A;  3QYE A;  4AU7 A;  1D1B A;  4CCL A;  2VJ4 A;  4PK4 A;  2L7K A;  1Y6I A;  3HG9 A;  3CP8 A;  2WY7 Q;  4LIT A;  2MYS A;  4XN3 A;  2R7S A;  4ZTF A;  3UNG C;  1LKX A;  1SFK A;  2XF5 A;  4QPO A;  2HDW A;  3CZ6 A;  2XC7 A;  4ZC3 A;  4DBQ A;  4B3X A;  1E0E A;  1X4O A;  1J09 A;  2KDO A;  3OYM A;  2Z1D A;  4RLQ A;  1TZL A;  2Y0S A;  4DGW B;  2IS1 A;  2DCE A;  3K4J A;  3OYG A;  3DTI A;  2L2O A;  2X1D A;  3ZCO A;  3DLA A;  4XN0 A;  4BE0 A;  4IKF A;  2M7B A;  1R6R A;  3OYL A;  2VQC A;  3OIQ A;  3DWL E;  3D5S C;  2LOO A;  4NUB A;  4Y4R A;  3TL4 X;  4Y3O A;  4OWR B;  3CP2 A;  3ONQ A;  4CCK A;  3QYF A;  3OYA A;  4PSX A;  3S8P A;  3PJR A;  3I9V 2;  2R7W A;  4RM2 A;  2CH0 A;  1JI8 A;  2BVM A;  1HA8 A;  2R7X A;  3PFY A;  3RQ4 A;  4II2 A;  1WJE A;  4C9Y A;  3MKZ A;  4YEL A;  3VDX A;  3DQV C;  2V4J C;  4F3Q A;  2WAD A;  1UG0 A;  3LSH A;  1IRX A;  5CPR B;  2JSP A;  4F92 B;  4J01 A;  2LBF B;  2JVG A;  2WY8 Q;  3S93 A;  3OYE A;  3EUK L;  3OMY A;  3ZGK A;  2E1M C;  3TMO A;  4XLH A;  3QYB A;  5JPM B;  4AVZ A;  1OR7 C;  5JHF A;  2A5W A;  2K3P A;  3LSG A;  4GRI A;  4KJZ A;  3NWT A;  5HNF A;  1EA3 A;  2K5C A;  3RSN A;  2UWM A;  1MMN A;  4LIV A;  2QKL B;  4ZYA A;  3LL7 A;  3DPT A;  2CW7 A;  2MD0 A;  3DKY A;  3I3L A;  4BJT A;  4BS9 A;  2OV7 A;  3S32 A;  5CQG A;  4E7I A;  2HNH A;  2GOX B;  1KON A;  3K4L A;  5HLT A;  1P9Q C;  2VJI A;  3D5L A;  3L2R A;  2DOA A;  1BR1 A;  2M3A A;  3H5N A;  2ZFU A;  2CUJ A;  4ZDP A;  3OS0 A;  4XOP A;  1BOB A;  1V5F A;  4BQQ A;  2W7N A;  3L2Q A;  2W4S A;  3U21 A;  5FRN A;  3BC8 A;  3DU5 A;  4B43 A;  3H0D A;  4BDY A;  4BE1 A;  3S3N A;  2HZD A;  3BG6 A;  5CQE A;  3H9J A;  2R7U A;  3PNT A;  4LG3 A;  3TBI A;  3VSL A;  2E1M B;  4ZJZ A;  3L2V A;  4JQF A;  4OAY A;  2L9S A;  5HOO A;  2DT7 B;  2CV0 A;  3DPL C;  4HST A;  2XF6 A;  2PJR A;  4X0G A;  4XKW A;  4H4K C;  3C2H A;  2M4K A;  3HPG A;  3RPU D;  3VYS B;  4F91 B;  1DGR M;  2WAF A;  4E7S A;  3EPZ A;  2AQF A;  2R7V A;  3PUB A;  2E5Z A;  3E1S A;  1TT0 A;  4XNF A;  2IGM A;  2CFO A;  4XOT A;  2LYC A;  3OIP A;  2OC6 A;  3A2K A;  4MLO A;  4D1Q A;  2CMP A;  2CV1 A;  1Y56 A;  4NQW B;  2X6Y A;  4DIQ A;  1WJF A;  2DXI A;  2JVH A;  1SAU A;  2VQG A;  2L5Q A;  1OLT A;  1X4P A;  3MKY B;  1YX3 A;  4PFP A;  2UV1 A;  4EAT A;  2VQL A;  4C2U A;  3IUO A;  2JA2 A;  1MW7 A;  3BG7 A;  3K4N A;  2XAU A;  3KEY A;  3LSM A;  3ZQQ A;  4XKB A;  2VXD A;  1D1C A;  4U7B A;  2CW8 A;  1DGW Y;  4XLC A;  3W2A A;  2VKD A;  2R7T A;  2PMZ A;  3DKX A;  4FXG B;  2F4I A;  3LMM A;  3H9G A;  2BVL A;  4HG2 A;  2R7R A;  4LIU A;  2M4G A;  3DTK A;  3OYN A;  3VYU B;  3OR1 C;  4C2T A;  1ERD A;  3DEE A;  1MMG A;  2OUM A;  2VL8 A;  4N4O B;  3ZXS A;  2K9M A;  3LFU A;  2LRD A;  1V5G A;  5KHD A;  2KZV A;  3L2W A;  2W82 A;  4CCM A;  2V1N A;  1LFP A;  2QKM B;  3H9Q A;  3DPU A;  4PFO A;  1FMW A;  4PJN A;  1Z3Y A;  1QU3 A;  4KIT B;  3D5R C;  2ZXI A;  3PL8 A;  2IXS A;  2DJI A;  1D1A A;  3BLY A;  4P5O A;  4HNT A;  1ZEL A;  2R7O A;  2ZSI B;  2KMU A;  4BQO A;  1K6Y A;  5CKT A;  2E5N A;  2F5V A;  5TGT A;  2VKH A;  1X1B A;  4BJ6 C;  3OS1 A;  3AKZ A;  4Y33 A;  2WBM A;  4E4H A;  1D0X A;  2LRE A;  4PUS A;  1AA7 A;  4IQ4 A;  3F9K A;  2PJR B;  2IGK A;  2X51 A;  3OR2 C;  1DP3 A;  3S3M A;  4D9J A;  2JUG A;  2DT6 A;  3CJR B;  2VLA A;  1BR4 A;  1YE9 A;  4CH7 A;  1G59 A;  2HQA A;  2V7F A;  4BEH A;  4BE2 A;  3AL0 C;  3V42 A;  4PSW A;  1Z21 A;  3GBG A;  2WB1 A;  2MC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...