1AA7A

Influenza virus matrix protein crystal structure at ph 4.0
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
158
structure length
158
Chain Sequence
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA VIRUS MATRIX PROTEIN
publication title Structure of a bifunctional membrane-RNA binding protein, influenza virus matrix protein M1.
pubmed doi rcsb
molecule tags Matrix protein
total genus 57
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1aa7A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 1aa7A01
1AA7A 4ITVA 5CQEA 1EA3A 3VDXA 4D9JA 3MD2A 2Z16A 4PUSA 4IQ4A
chains in the Genus database with same CATH superfamily
3CF5F 4A3JJ 3DBRB 4E7JA 3HZJA 2K9QA 1OYYA 2IVMA 4JX4A 2DOAA 2W85A 3LFKA 1OYIA 1M1EB 1K79A 4BYYA 3FBIB 3NQOA 3H9JA 3TO9A 2FNAA 1Y8QB 2OJED 2VQCA 3PM1A 4U7BA 1JXSA 3QYEA 4Y4RA 1UFMA 4B48A 1WWXA 3PQJA 2FMLA 4LLNA 1X2MA 1SVMA 1OYWA 3GCMA 2EFWA 2RKHA 2IPQX 3HRTA 1UJ8A 4IXAA 4AIHA 2A61A 3JRAA 4KNYA 1Z1DA 5CYVA 1MJ9A 4CHUA 4UUSA 2NYXA 1G3YA 4H4KC 3MKLA 2IA0A 5E3OA 1C0WA 4DYCA 5H6QA 2ECCA 1PUFA 2E7WA 3VYUB 4MGRA 3MVPA 3DKXA 3FHNA 2KT0A 2R7RA 3CUQC 5CVRA 1A5JA 4NBQA 5D5WB 3VPRA 1JT6A 4EMSA 1JHHA 3E0JB 2OA4A 3CCYA 1VQOI 5K5RA 2R5ZB 4W97A 2O8KA 2LBFA 3DFGA 2M34A 1BI3A 3VSKA 2HXIA 1X4PA 4DQ2A 4BE0A 4ENJA 4V19K 1XSVA 1ULYA 3ZQ7A 2AQEA 4IHTA 2O3FA 5IP9J 1LNWA 1BI1A 3HGGA 4XSXF 3IWZA 2WWYA 3G73A 2PJRA 4PGGA 1Y39A 1LJ9A 1U5TC 2L9VA 3TOAA 2HYFA 2QVOA 5DV5A 3B6CA 1DP3A 2DYSH 5LGTA 5M3MJ 1I1SA 2GXAA 2R7UA 1GVJA 2MGQA 3WTSC 2HYGD 1J0RA 2YX7A 3SZPA 2VJ5A 3V7SA 1AKHB 5FD6A 1DQUA 3I3LA 1U9NA 4M9SA 1KZHA 2VONA 4HNTA 3LWFA 1D8KA 1U2WA 2DBBA 4YG2F 3ABUA 4KA4A 1MZBA 3G1OA 3F21A 2K4JA 2MH2A 4XN3A 4LB6B 1XCBA 5E3LA 2E1CA 3LOCA 1JKOC 1WKMA 2HFHA 1APLC 3KYCB 3H35A 2MFZA 2E5ZA 2UXXA 4GDFA 5CVIA 3CC2I 4HX8A 1B9MA 2K9SA 3QRFF 3AFHA 2KRCA 3K4LA 3LAJA 2Z5UA 3BDDA 2JA6J 5L3FA 4B3AA 5EG0B 2K86A 2V9PA 3RI4A 1JJ8C 2B63J 1DGRM 2VKDA 3HM5A 2MSYA 2FA5A 3ROUA 3VYTB 3AKZA 3CP8A 1ZRDA 2O61A 3G1MA 1JJ6C 5EDNA 2X1CA 2IXSA 1O7LA 2R0QC 3FXMA 2JA7J 1IRZA 4H0EA 1KU7A 2M8GX 4HW5A 4L9VA 3DWLE 2K9LA 2EFQA 4ON0A 1UZCA 2A6TA 5DEQA 2L4AA 2P4WA 2XHKA 5IYDJ 3DPTA 1IN8A 3BJOA 2VQLA 1Y56A 2WV0A 5FKLA 5TGTA 1ETYA 4B4CA 3OV8A 2V1NA 2JMWA 3CZ6A 1B72A 2STTA 2ICWG 4FXGB 1F43A 1E2XA 5F0FA 1QPIA 4GXOA 1T2KA 2L9RA 2IGKA 1FWZA 1VQ5I 2RREA 1I3QJ 1MMAA 4CCNA 4BJ5C 2GZWA 4N4OB 1JUMA 3FDYA 4CO8A 2YU9J 3SJMA 3BR0A 1P9QC 2I8DA 3JCUC 1ZN2A 3H36A 3HTSB 3OSGA 2W24A 2XDVA 3F72A 3BZKA 4Y15A 2DFIA 5FRNA 3PIOF 2DPDA 2PFBA 6PAXA 3KP7A 2GAUA 2VT2A 1XGOA 1YW9A 1XSXA 3M8JA 2ZNZA 3H3ZA 2DJNA 2OCCH 3QODA 1W36D 2IA1A 3QPHA 4KUMA 1P4WA 4F52A 1U6GA 2HTJA 3BPVA 1ZHFA 2G0EA 2HKOA 3QYBA 2E2IJ 1RI7A 1E3PA 4OMZA 2HDWA 3UKGA 1L0OC 4GRIA 2UUZA 1FP1D 4KN4X 5FFZA 4Z6YA 2ZJRF 3W6VA 1KYWA 3ECHA 3A02A 2E71A 3K4MA 3FF5A 4PUSA 5KAIC 5IY5H 5J1RA 2AXTC 3BR3A 3OIQA 1A04A 4ZTFA 2RVCA 1Z7LA 3OYJA 4NNJA 3UNGC 1XB4A 5K1YA 4BDYA 3K4CA 4FX4A 2XC7A 3MZHA 1MIJA 1NH3A 4CYCB 4IHWA 1VQNI 5F1JA 3IWFA 1P7IA 2IS2A 5FD5A 3ECOA 2VQHA 3E3VA 1U78A 3TDUC 3FBNB 5ICEA 4HDUA 2O8XA 3I58A 2PMHA 2L54A 3NAUA 2D45A 2K5CA 1YIJI 4ZDPA 1IAWA 3BG9A 3DPLC 3RZDJ 1VQ8I 3HGYA 4RS8A 1I6XA 2OTLI 3PNYA 4D0PA 2CQXA 2CQNA 3FK6A 3KP4A 2KIUA 2ZSHB 4E7HA 1FBSA 4HNUA 3ZR8X 4FHTA 3HOYJ 1BBYA 2Z3YA 5A2QZ 1G3SA 2A6EF 2DPUA 1J7KA 2HPIA 3DTEA 4BKXA 1G6NA 1OR7A 3QPTA 4HLXA 1KQ8A 1SD6A 2IBDA 4LFUA 2LF8A 1S72I 3Q9VA 4A3LJ 5F0HA 3O3KA 3M8FA 2V1DA 1ZGWA 2IW5A 4RMNA 4E4HA 1K4SA 2LK2A 1GXPA 3U1DA 4WB2A 4XLAA 2KMUA 3S14J 4G7OF 2LTPA 4Y33A 5FFXA 2FRHA 4B1RA 3VWBA 4AYBN 3AL0B 3ZXSA 4DYRA 3BOQA 2KJBA 3ZGKA 2ZJ2A 4FE4A 3SQNA 2ME6A 3H5RA 2P8TA 3IH3A 3MKYB 2OF7A 3EDPA 4II2A 4AIJA 3IAM2 5F04A 1Z3XA 2LDUA 5E3NA 4I6ZA 1X58A 4IRIA 3CESA 3RKXA 4DBQA 4PJJA 2M7BA 1E0EA 4ENKA 2XV4S 4B09A 2R7VA 2DA4A 2KZVA 5B66C 2NVUB 1TWAJ 5GTIC 3HOUJ 2DA5A 1X4OA 5EF6A 2M4GA 4CYCA 2P81A 5GP9A 1MMNA 3EUAA 3DKWA 4P1WA 3HPHA 4UB6C 2E5NA 3A4CA 3ESWB 4I98B 1RC9A 2HKXA 4C9YA 3Q0VA 2AQFA 4LITA 3VYSB 3HKZA 1PJRA 2F5CA 4LGWA 5IPAA 3CP2A 3PL8A 3HOSA 3JTHA 1YHQI 1XMKA 1YYVA 5DTDA 2X9DA 1T33A 3DF8A 5ILUA 2MA3A 1MMGA 1OCTC 2XASA 2QBYA 3C2GA 2CFOA 3ULQB 1YFHA 1TNTA 4QSHA 5FROA 4FXKB 1UAAA 2A68F 2LKSA 1HSJA 3CJTB 4R8HA 3WTXC 3CC4I 1K6YA 3E5XA 4M73A 5AIQA 3V8KA 5HLGA 1FSHA 1LEAA 2EFPA 2BY3A 3NWTA 1LFPA 4A3MJ 2JPCA 1CGPA 3H5NA 4IRHA 3LSMA 3I56I 1MBFA 1ORKA 3KP3A 1SVLA 1J2XA 1ZGAA 1GDTA 4AU7A 1ITYA 4B8XA 1GUUA 3P9IA 4RA2A 4L9TA 2JQ7A 2X48A 1XGSA 2QGUA 2EIJH 2LREA 5KNLA 2DT6A 1D3YA 3WTWC 4DJAA 4YFKF 1REPC 2ZMEC 2F5DA 3U1KA 3CMYA 4F7ZA 3A2KA 1K78A 1XD7A 1J75A 3S3MA 2XF6A 1IXCA 2DQRA 1XX5A 2ME0A 4XLFA 3TDZC 1ON1A 2K02A 2EZKA 2M4KA 1H8AC 3I59B 2TDXA 2B7EA 3JRGA 2L4MA 3MKZA 3N97A 1FNNA 3GFJA 5EZGA 4A2UA 1OCZH 3O6BB 3LQRA 5B4PB 3GX4X 3E6MA 5J47A 4HLYA 4P9UA 4XONA 2FSWA 3F22A 1T39A 4FX0A 4M71A 1IJWC 2CS3A 4CH7A 2XROA 1B9NA 2X6YA 4OOIA 4KDPA 5AIPA 1XC5A 4ZZDA 1NK3P 2KIFA 2CW8A 3LSKA 3K70D 3KP2A 1PP7U 3OMYA 3HQAA 1HKSA 1VI0A 2P5KA 2DMNA 2KHMA 2LG4A 5K7FA 4II3A 1POGA 3BG6A 4M3BA 1WCMJ 3OYLA 4ENMA 1W36C 5ILSA 1FOXA 3ZOBA 5LGNA 5JLWA 2P7CB 4MNUA 2A5YB 3I0TA 3C7JA 1R6RA 5LHHA 4LLLA 3FK7A 4BHPA 4UHTA 3GXOA 2VOOA 3KIOA 3A1YA 2WAQA 2NRAC 1O4XA 2VT3A 1Z0XA 3C2BA 2LLKA 4BEHB 5D6EA 3D0SA 1XGMA 2VE8A 1RESA 1Z77A 4DOZA 2LFBA 4MQVA 4UVBA 3R60A 1BIBA 3FXKA 4BXUA 1IV6A 1XG1A 4N9IA 3DKYA 1MJBA 3F0CA 3HJEA 2KZGA 4XLNF 2DXIA 4I02A 3D1NI 3E6BA 1R1UA 4Q48A 1F36A 5DM7F 2BBYA 2XKOA 4A3KJ 1OPCA 2EZHA 3LQQA 3EUHC 2LMDA 4W1UA 2CMPA 3TO7A 3DEEA 3SXYA 1A6QA 1VQMI 2RV8A 4MHGA 1VQ7I 2HOSA 4IO9F 4S05A 4UV8A 3GYHX 2KPMA 2E36A 3J7YJ 5LHGA 3J81Z 2MYSA 1EKEA 1YG2A 4ESBA 2CUZA 5JHUA 3ML6A 3M1EA 3HXLA 3TMOA 3MMYB 1STZA 3JSPA 1IC8A 1WFXA 1JHFA 3F8BA 5CPRB 3S15J 3JRIA 4BQNA 2X1EA 2W00A 3HOVJ 2VBYA 1FBUA 3FISA 4KIGA 3BTCA 3ZMDA 4F55A 4BBRJ 2YS9A 4KIBA 2W7NA 1T8IA 2ELKA 5DYMA 4IKFA 1R1TA 2HU9A 1XN7A 3NEUA 3RJPA 2WA0A 5CJ9A 3RPUD 3JAMK 3PSIA 1CQTA 1RKTA 2VUMJ 1B8IB 4BUPA 3GTGJ 4ABZA 4QWQA 4HF1A 1Z91A 4G6TB 4DYQA 2ELJA 1W7PA 5JVTA 3IP4B 4RM2A 2ZB9A 4A0ZA 1G4DA 3E97A 3CUQA 5HNHA 4U0VA 2Y9YA 3HDDA 3H92A 3CMMA 3VFZA 2IRFG 3LSPA 3LFUA 3AG3H 5IT9Z 1ZGJA 3Q3SA 2O5RA 3BPXA 1WJFA 2CV1A 4LD5A 2LSOA 2D1HA 3BR6A 3DTIA 2V26A 4HSRA 5ERIA 5FGMA 3ZMVA 3G71I 3H0GJ 1Z3YA 1CF7A 1YE9A 2XAFA 3EQLF 4L5JA 3V8JA 1BN5A 2DU9A 2KJCA 1D1CA 4ZTJA 1XPXA 5HNFA 3RCOA 2DCEA 2W1OA 3K4BA 2XGEA 1U5TA 4LLGF 1YITI 2CG4A 4IHYA 4NUBA 3H3VK 1EA3A 1IRXA 5BPIA 3TP3A 1R22A 3V7RA 3QP5A 1TL8A 1AU7A 1WI9A 4HG2A 4ITVA 2FD5A 3QU3A 2BHYA 3OL4A 3RQIA 2W48A 4ANJA 1BR1A 3MEXA 4I76A 4UUSB 1QBJA 2E34A 5FKMA 2ZXHA 1MBKA 2EQRA 2LY9A 2TCTA 3LSGA 4ASNA 3OY9A 5H6RA 3HB9A 4WXHA 3L2QA 2EH3A 1YS7A 4HOBA 2XAJA 3S1QJ 5FO5A 2OAZA 2ZC2A 5E8GA 2BVMA 5J4VA 1BOBA 2RQQA 4HPQA 4LK0F 4JP0A 1R5ID 4XN0A 3Q9SA 3ABLH 4DNCA 1RETA 4WF2A 5BNGA 1UG0A 2EWNA 2CU7A 2M1BA 1RUOA 3Q0WA 4XORA 3JREA 2ISYA 2Y69H 2LBFB 1TLHB 1SMTA 4G7HF 2YU3A 3FM5A 2K4BA 2PMZA 4IHSA 3B02A 3MKWB 1WJ5A 1XMAA 1IUYA 2DMQA 1OCCH 2FMYA 4EEFG 2HXOA 4XRSA 1N77A 3S32A 4JBAA 3BROA 2AXLA 4Q47A 1FYMA 1AWCA 3WU1B 3WHBA 2KRFA 4RB2C 4J01A 2A05A 3WODF 1EV7A 1MH3A 4D1QA 3E6CC 1BW6A 1NHAA 3FX3A 3K4KA 3QQAA 4RLQA 1S8NA 3CC7I 2QF7A 3CJNA 1QHHD 3L2RA 3RIRA 5LEJA 5D5VB 4BS9A 3GTMJ 1USSA 4HBLA 3NARA 1ENHA 3S2WA 3CCJI 2K3FA 3KETA 2WTEA 1JUSA 1JI8A 4UU9C 3PFYA 5F6FA 3RSNA 5EEAA 5EJCA 1HDDC 4NQWB 1ZRCA 4P96A 4IRGA 4Y13A 4G8XA 3TBIA 3IUOA 4V2FA 3SEQA 2R7XA 3KEQA 5FKOA 4PJ0C 2NOGA 1MH4A 1PVEA 3BG7A 3KPHA 3WGHA 1HLVA 1FT9A 3PUBA 3MAJA 4P9FA 3CCLI 2HS5A 4P3AA 1BI2A 2XUBA 2JT1A 3LSHA 4C2UA 1E3HA 1RNLA 4NHJA 1QZYA 3B6AA 4IX7A 4GCVA 1YI2I 1HF0A 2M87A 1FZPB 3K70C 3ZQLA 2HWVA 2VODA 4WB3A 4EM0B 3LAPA 3CDHA 3PIPF 1WI3A 1R4MB 5CVUA 2QSFX 4PSXA 5LRRA 2VKHA 5CQGA 2IP2A 3GMEA 3F3XA 1SD7A 2VL8A 1O3RA 3W2VA 4DW6A 2HQ5A 5FB2A 4XLPF 2JRTA 2A07F 4UUVA 1V3FA 3OOUA 3ERMA 2CJJA 3CUOA 4YELA 1B72B 1CFAA 3K0LA 2EIMH 5H2FC 3K1NA 3O8HA 1XTAA 1WJAA 4Q4ZF 4A0YA 4BL0B 2QKMB 5BQTA 1HW2A 4AM3A 3MZ8A 2BHZA 2PBIA 3Q5FA 4O5VA 3L2VA 1HC8A 3PUFA 2E60A 2KDZA 2JVHA 3DP7A 1SAUA 3ZQGA 2F4MB 3A03A 5GPCA 1U0JA 2PMUA 2IA2A 3ABTA 2QQ8A 5DD4A 5J3LA 2H94A 3R0AA 1H9TA 2WAFA 3O2PE 1DP7P 3PQKA 2W84A 1BJZA 1KONA 1YTYA 4HQEA 2FX0A 5GAHJ 3T5XA 4BXFA 1I1GA 4HF0A 4G12A 3NRVA 2Q0OA 1ZTRA 1S7AA 1UMQA 1F9NA 1WQ2A 3PNVA 5FKKA 3TL4X 3CU7A 1LE8A 2HZTA 1SAXA 1JKRC 4DBRA 3OYEA 2HNHA 1DPRA 3QYFA 4NQWA 4C2TA 3CCVI 5E1ZB 3KZYA 1C5AA 3RDIA 2R5YA 3E7LA 4MTEA 2DT5A 2XF7A 1FOKA 2H1KA 2NNNA 1WRJA 1R36A 1FMWA 2LD5A 1IN6A 1JGGA 5LLQA 2L7KA 3KCCA 4U87A 5B1BH 3S1MJ 1WVRA 1YX3A 4G9YA 4QTRA 1I5ZA 4FISA 5BPDA 5JI6A 2DFHA 2NNYA 2MABA 1W5SA 4AIDA 2X51A 2Y75A 4I0AA 3CCMI 2VXZA 4QPOA 3GFIA 3E5UA 1YJWI 2OC6A 4E7KA 4EM1A 2H6CA 3OIOA 1ERDA 4IOAF 3K6GA 4YFNF 5J8CA 2O03A 1DU0A 3PFIA 3GUDA 2RNGA 4EGZA 4LG3A 4XMYA 5B3SH 2ZSIB 1ZH5A 1V5EA 3P9CA 3DBLB 2XAHA 1OCPA 4E6KG 1MNDA 1E3OC 5DUIA 5LD2C 1Y1VJ 3DEWA 2BGCA 2EINH 2XSDC 3HHHA 1MDMB 1HA8A 4E7LA 3HOTA 2CYYA 2WY8Q 2QM3A 4HX4A 1SEUA 2XPUA 1VF9A 3I9V2 2H27A 2OD5A 2R7FA 4ESJA 1BI0A 1LDJA 5EGOA 4IVNA 1MBEA 3E5QA 3LA7A 3RKYA 2Z33A 1OJLA 1BR2A 1OFCX 1FOWA 1MGTA 1TTYA 4XRFA 4ZDOA 1Z9CA 2LNBA 1BW5A 2D2WA 1SMYF 2P7VB 5HLHA 2QQAA 1TT0A 5B1AH 1NK2P 1LKXA 5D5UB 1BIAA 5FLVA 2XGXA 1J59A 1OLTA 4NC8A 2GA1A 1X1AA 1BM9A 4B44A 3ABMH 1Y6IA 4CYDA 2OZ6A 1LDDA 3CCQI 1SC7A 4R1HA 2IAIA 1D0YA 3FIWA 3K69A 4LG0A 1R4NB 1JT0A 3L1PA 5D6FA 1GHCA 2I10A 2LR8A 2PQ8A 3GWZA 3H9GA 3HHGA 1J09A 5D8KB 2G9WA 1BC7C 1W0TA 5K7HA 3W2AA 5HLIA 1PYVA 2PX9A 4PK4A 2P6TA 4X1EA 4FT8A 3IC7A 3J80K 2ZMEA 3KLOA 4YIRX 4Y17A 3W3CA 3WTZA 4YIFA 1QPMA 4I2OA 2KQRA 1GLNA 3JTGA 2KLOA 3BR5A 4A6EA 1U8RA 4PDKA 3PO2J 4BY1J 1HBXG 3F8NA 5LFAA 5JPNB 4FTHA 4XKWA 1VZ0A 2A5WA 1ZELA 3RYPA 4A3IJ 2GM4A 4WX9A 5J8FA 2D5VA 2ZJPF 3BJAA 2JSCA 5JPMB 5F27A 2OV7A 2QBYB 4EJVA 3WU2C 3GFLA 2QUFA 4BQAA 2OQGA 5DCFA 5B5EC 4A12A 1YQAA 3CO7C 2RC4A 5E8IA 4PJLA 4LOCA 4UB8C 2K7LA 1TW3A 3M07A 1MDMA 1TW2A 3MFKA 1P7JA 1S5LC 3WTYC 2L7ZA 4GYGA 1F4KA 4UV9A 4RBOA 3VSLA 4EV0A 3TP0A 2L9NA 3J7AO 2MC3A 1P4XA 1K78B 3K1PA 2O6GE 2Y0SA 2WB1N 4BE2A 1JKPC 4PJNA 3TQNA 3TW7A 1TC3C 5JLXA 3WTUC 2VE9A 2V9VA 2UV1A 4IHXA 2HQRA 1JTYA 2MLKA 3HRMA 4FASD 5TRDA 3S17J 3OS2A 3ZQFA 2K9NA 2VJ4A 4I99C 1S9HA 4CCOA 4HAMA 2XAQA 5L3DA 4XL9A 4M6XA 4OINF 3EUHA 3CLQA 5E3MA 3ZMUA 2R7WA 1KQ0A 4IEJA 5FLXZ 2Q8KA 3CQZJ 3ZN0A 1SD4A 2NVYJ 4DIQA 4OIPF 4KYWA 4XOPA 2QA4I 1B59A 1J5YA 3HYIA 2Z16A 3MD2A 1G59A 4Q5SF 3A01B 4L5EA 2P0WA 3E6DA 2EB7A 5HDGA 4U0YA 4XOTA 3SDGA 5D8LB 3BWGA 1GXQA 1ZRFA 4AVPA 1IN7A 2O9LA 4KICA 1NTCA 2JRMA 3WG7H 2ID3A 3K2ZA 5IOYA 3ZPLA 1QU3A 1MJAA 1H88C 1DGWY 2FE3A 3I55I 4LJZF 2XVCA 2BY0A 4L5IA 2F5FA 2VXDA 1QZZA 4YEJA 1ETWA 3ZQQA 1ZREA 3X2QH 5J1YA 3AG2H 4X0GA 5L3GA 3BTJA 4HA8A 5LHIA 2MC4A 1ETXA 2GLOA 3BY6A 2WV1A 3BC8A 5C4JJ 2HDDA 1TWCJ 4CCJA 1UG2A 2E1MB 4I09A 2EILH 4LMYA 5DS9A 1W0UA 5D4RA 2GXBA 4BBSJ 1LPQA 3BTLA 2E35A 1G8XA 5LGUA 1X3WB 3FMRA 1B1BA 1S7OA 4M72A 2V6EA 3HSRA 3ZRGA 1TQIA 2DYRH 4NB5A 2HQAA 4HV6A 1SFEA 1X1PA 3NWSA 1SD5A 2VC1A 3CJQB 3M3YJ 2A6HF 4G6DA 5FKNA 5IP7J 1T6SA 5KK1A 2M2EA 2Y31A 4BACA 1FYLA 2F4IA 5IYBJ 2F5EA 5ICGA 1D0ZA 1ZARA 2VKVA 4J00A 2RN7A 4BJTA 4BU2A 2X85A 4K2EA 3AAFA 2HOAA 5IOZA 1FIPA 2QQBA 2FBHA 5L3CA 3J7ZI 5GPAA 3GTKJ 3OR1C 1FY7A 3G4SI 1ACIA 3FZVA 2IT0A 1YJNI 3QPLA 4YRVA 2STWA 4D5CA 1YIOA 3HKZN 3JRDA 2FQ4A 1YW8A 4N4NB 4RAFA 1W7PB 2LKXA 9ANTA 2GIVA 4IQ4A 3W6KB 3KYLA 2KISA 1HKQA 3WU0A 3WE3A 4GGGA 3CUQB 4MFEA 3T8TA 5K5QA 3CCSI 4D7MA 3A01A 2CH0A 2CW7A 3TW6A 4AD9A 4A0XA 5K5OA 1ZLJA 1SVOA 2Y30A 5JHFA 1U3EM 2CO5A 3PNTA 3KLSA 4U7DA 2LF7A 2EK5A 5DM6F 1CF7B 1L3LA 4F92B 4RM3A 2PN6A 4HDVA 2WAEA 1BR4A 1MBGA 4RGUA 3FXUA 2UXNA 3GBGA 4BH9A 1U5TB 4FE7A 4XK4A 4UVCA 1XDSA 3JAMZ 5FJ8J 1E17A 5FRMA 4NC6A 4CSWA 4XRSG 3ONQA 2E7XA 2VIXA 5HS7A 1UHWA 2JVGA 1W7PD 1XGNA 2GOMA 5ICCA 2FJ1A 4ZC3A 4ZJZA 3QOEA 1NG6A 2XAGA 4M6YA 2QZ8A 3AG1H 3OS1A 2PEXA 3VB2A 4BAYA 2XB0X 2GIZA 3C18A 1FBQA 2FUG2 2J5PA 4BNCA 1WJEA 2F48A 2ESHA 3CLOA 5J6XA 2K3PA 3OYMA 1H89C 1R1VA 1RR7A 2IGNA 3SFIA 3JRBA 2L2OA 1A6IA 3OYDA 4OIOF 1TWGJ 2J5OA 2MH9A 1FC3A 1R5HA 1R23A 3JRFA 2BZTA 1AHDP 2OUMA 1H9GA 5J40A 2B9SA 2V4JC 3WTVC 2MBFA 1O7FA 2GOXB 2ZXWH 2V9KA 4P5OA 4ZH4F 4IOCF 1SFUA 2HVSA 3SHFA 1YJ9I 4X6AJ 3DXJF 2GA2A 4OWRB 4XLEA 4KFCA 1D1AA 2R92J 2VKEA 3GTPJ 2XB5A 2ZBKA 3IH2A 1G3WA 1MMDA 1W4MA 1IF1A 2K9MA 3COAC 3H5AA 1LFUP 1JGSA 1FTZA 2XIGA 3QWLA 3A0HC 1N78A 1R00A 1P92A 3JSOA 2BVLA 1OCOH 2DA2A 1B4AA 1I6HJ 3KZIC 2WC2A 2KL4A 2CV2A 4RAZA 1IN5A 3D5SC 1W1WE 1F1ZA 2QEXI 4CCMA 2KRHA 2XSJC 4BE1A 3CDLA 4HYEA 3M8EA 5DCMB 4UXNA 2JA8J 4CGZA 3GLLA 3L00A 2VQGA 1FX7A 5C44J 3BT9A 4CXFA 1JE8A 4AC0A 4HNVA 3F6VA 3ZMZA 1WHUA 1BC8C 3G6EI 2F6CA 2DK5A 4I7HA 1WH7A 3GTQJ 1IW7F 2GQQA 4ZDLA 3B73A 3U2RA 1TP4A 2LY2A 2NOJB 3J81K 3FKJA 4C3IJ 3E1SA 1X1BA 1TBXA 1VQKI 3RKQA 2IS4A 3DCFA 3ZMSA 4EM2A 4ETSA 4MFDA 4OAZA 2FOKA 2ISZA 3C2HA 2HOTA 5CVVA 4U88A 4BY7J 4C3JJ 1LUJB 1T95A 1WGXA 3L09A 3DBHB 3AG4H 4PJMA 4B43A 4ZYEA 4G7ZF 3RPUA 4EGYA 2QSGX 4ZZLA 3HEFA 2FBIA 3S3NA 1T98A 4EJUA 2G7UA 2ETHA 2BXYA 4D5FA 2KKOA 3F8CA 3FMSA 5IYCJ 2MG4A 4L9NA 3ZN1A 5F64A 2DN0A 4FCYA 1IDZA 2MW8A 4GYIA 4OIRF 4N9HA 5IP6A 3DU6A 3H3UA 3TO6A 1XSDA 2O0YA 4A5NA 2QSHX 1V5GA 2K27A 3GO5A 1IRFA 2JN6A 1GV5A 4P55A 5IT9K 4E7ZA 2V1XA 3CF2A 3N4MA 2IJLA 5J4YA 4RAYA 2N8GA 4LB5A 1G2HA 1LQ1A 3GZNB 5GAEJ 1VQPI 2VPRA 2CUJA 4E7SA 3LSIA 3HUGA 4IHVA 4I0BA 1IZ1A 4P39A 1X1CA 3ELKA 1LE8B 4XM3A 3O8GA 3KP6A 2V1UA 4CCLA 1PUEE 1ZYRF 4LK1F 5DCMA 1T56A 2PJPA 3J7AY 1GVDA 1VQ6I 3K4NA 2R5YB 2FNPA 2KIMA 3M7GA 1DU6A 1FMVA 1QO0D 4WK8F 2WY7Q 4Y7NJ 4CDGA 1G3TA 4RB1A 2COBA 3RTRA 2CQKA 2MD5A 2QCOA 1UB9A 1H0MA 4M3FA 1FEXA 4BXXJ 4OIQF 1RUNA 1YRNA 3S3OA 2R4GA 4BQOA 2FBKA 2E2HJ 3KEYA 3LSJA 3DEUA 1WJCA 1OCRH 4M6VA 2HI3A 5TJJA 3M4OJ 4M9ZA 1FSEA 2HTSA 2X0LA 3GTJJ 2PMZN 3IKTA 2P6SA 4P3BA 1T0FC 3GW2A 3DLLF 1RIOH 4BDZA 1Y0NA 2HZDA 2OPTA 3HPGA 3JW4A 2JA5J 4RAGA 1B6AA 1QVUA 1FP2A 1ONVA 5DD8A 3OYHA 4QPQA 2M8EA 2JJ7A 4A3FJ 2XRNA 3OOPA 2DJIA 2NS0A 1T38A 3M1CA 3ASNH 4HSTA 3V4GA 4M3DA 4NC7A 4CZCA 2VLAA 1SFOJ 2KFDA 5EGOB 1VQLI 4B3XA 2XKPA 3LA3A 2VJJA 4EQQA 3QOPA 3GTOJ 4PFOA 4IPAA 3OSFA 2RGVA 3BP8A 1MNMC 4I6OA 2RAEA 1PDNC 1HKTA 2JTVA 5F0CA 2Q2EA 4MIMA 1I50J 4B47A 4JOMA 2BW3A 2CSOA 1YO5C 3L7WA 2DMUA 3L2UA 2ZJQF 3IHUA 4JYKA 2CFXA 5EEHA 2JZYA 3GLXA 2PLYA 2DT7B 4HF2A 2E1OA 4Y3OA 4EVIA 3HRSA 1MD0A 3V7CA 1V4RA 3BCBA 3GVAA 2Z9OA 3DLAA 2M7AA 5D4SA 1Z05A 2F4OB 4L0ZB 1OISA 3LMMA 4LG0B 2PI0A 1TWFJ 2XGCA 1U9OA 2E1NA 1D5VA 3TKYA 2AHQA 2RNJA 1SFKA 4EJTA 4V2GA 3ZCOA 2FF4A 5IT3A 2CQ7A 4C2MJ 2XPWA 5K7ZA 2M5WA 2XF5A 3CD6I 3D5RC 2R7TA 2GWRA 2IEKA 1FTTA 1IRGA 1MKMA 2ZMEB 5KVRA 2V7FA 4F3QA 1W5TA 2CWEA 2EV5A 1D0XA 5EEGA 1K7AA 2LC2A 1LDKB 1BJAA 4PCQA 2DLLA 2HPMA 2EV6A 4CUGA 2RQPA 2CQQA 2JUCA 2VBWA 2OCEA 2HDCA 3DPUA 3ZQHA 3S1NJ 1Y1WJ 5E17F 3LSTA 3LNQA 1IUFA 3R4KA 4KMFA 2DTRA 4IZZA 1N75A 2Q1ZB 2ECBA 1MBHA 4XKVA 4CCKA 2Y0MA 5GTHC 2NS7A 3WE2A 4N0BA 4UVAA 5CQEA 5M3FJ 1TT5B 1EJ9A 3KFWX 4I01A 3W2WA 4Z2YA 2M0MA 1QZEA 4XSZF 5F1RA 3KX2A 3S93A 1ZG3A 3T1BA 1S3JA 1X1DA 2V6CA 3J80Z 4KITB 2CV0A 2PG4A 3W6JB 1KYZA 2OBPA 5HDKA 2ELHA 1EF4A 1Q1HA 2VB6A 3H1CA 4C30A 1ZG1A 3F6OA 4WCGA 3U21A 4XKCA 4E7IA 1IO2A 2R5ZA 2L7FP 4M3EA 4EJWA 3VYRB 3HG9A 3VOEA 2DMPA 4ZYAA 3EETA 5HODA 3CO6C 1S6LA 1O3TA 3OYCA 3CCEI 2Z1DA 5L3EA 5HOOA 3IAS2 4MEYF 2JA2A 2QKLB 3PJRA 2IGMA 2W25A 1Q1VA 3RQ4A 5M5WJ 3S8PA 1UELB 1USTA 2EFNA 3OS0A 1IN4A 2HEOA 2L01A 2K85A 4RB3C 2YUSA 2Y9ZA 2H8WA 4NDLA 3HOWJ 2IS1A 3WG9A 1SFXA 3IH4A 1KA8A 4A69C 1W5CC 5EYRA 1AKHA 1Z6RA 3WTTC 4F93B 3I4NJ 2XGDA 2H1LA 3HRUA 2JWTA 5ICFA 2X6WA 1O57A 1D8JA 2NS8A 2HR3A 2R7QA 3K2AA 1KJSA 1XMXA 2GXGA 1LFBA 2Y48A 2I5UA 5E79C 3KZZA 3VODA 1YW7A 1BOAA 2ZKZA 4IL6C 1XS9A 2MD0A 2YPRA 3K7AJ 2L9SA 1JKQC 4DZPA 2WB1A 4AYBA 4D7NA 2DA7A 1R9TJ 1RPWA 4LIUA 2MLGA 3A0BC 4RLFA 1XCVA 1MSEC 1DPUA 4ENNA 4C3HJ 5EG0A 2AS5F 1Z7UA 3MQ0A 1A36A 3SZTA 1F5TA 3FXQA 2FOWA 1ZQ3P 2BE5F 4BHBA 3TOBA 3HBLA 3OYFA 1I3AA 2OU2A 2FQ3A 2ACJA 2NVXJ 2HVRA 4WXDA 2A69F 4CICA 3I64A 1FOYA 2HOEA 2JSPA 2Z2SB 4E70A 3GZ5A 4BGDA 3BCAA 1FIAA 2JUGA 3OWTA 2DMTA 4BJ6C 3N05A 2M45A 4A3BJ 2HYJA 4O6JA 1O3QA 4HQMA 1A35A 1TNSA 4XKBA 3SEZA 3K4JA 3DV8A 1UCRA 2R93J 5E20A 1WH5A 3EUKL 2X4HA 1I39A 1U8BA 2H8RA 2QENA 3WGGA 5JVGF 2EBIA 3L2CA 3R0JA 3FWEA 2A73B 3M9AA 5F08A 3CCRI 1Y8RB 2BY2A 1VNDA 3KP5A 4J19A 3HSFA 2BY1A 2DI3A 4M9XA 5M5YJ 1HOMA 2DOEA 1EH6A 3IV5A 2W4SA 2NXNB 1MSFC 3HOXJ 2CW0F 5LBQA 5HVQC 3LA2A 2DO7A 3Q0UA 3V8LA 3KEOA 2DW4A 4A93J 3P5JA 3V42A 3GEZA 5L3BA 4FETA 2JK3A 4HEA2 2CRGA 1IG7A 1KU3A 3S2HJ 5JFRA 1MBJA 1ON2A 3OIPA 4JX5A 1R71A 4UUTA 2LYCA 3KYDB 5DUKA 5GADJ 4OAYA 5LRSA 3H0DA 4RGRA 3BR2A 3D5LA 1MW7A 3P7NA 3OYGA 3FKIJ 3MWMA 1QHGA 1S7EA 4OU0A 4XLHA 5J1UA 1MMSA 4L9JA 5C4XJ 3FMQA 4AVZA 1JTXA 5A2QK 4A3GJ 3ABKH 4XIDA 3TEDA 2KIQA 5HS8A 1LEBA 3IKVA 2HQNA 2VBXA 5E18F 2DTZA 1X3ZB 2EZLA 5ILVA 4BHCA 3BG3A 2O7OA 1S29A 1RRJA 1UHMA 1RR8C 1HCRA 2R7ZJ 2XAUA 2L5QA 3QU6A 1ZLKA 3I53A 3BLYA 2Y0SN 2WBMA 1VQ9I 4ESFA 3QPSA 1QQIA 2ZO4A 2F2EA 3MZYA 4AWXB 3IRQA 1ZR2A 4RB0A 3CMAI 3L9FA 5KCMA 1A31A 3F8FA 4R79A 4PGHA 1OKRA 3FXOA 2W82A 1QA6A 2ZNYA 3PSFA 1ETQA 1J9IA 4DGWB 4MTDA 1K4TA 4PZJA 5C3EJ 2BOLA 5JR3A 1Z21A 1IDYA 3ISPA 4KN7X 3HTUA 1FLIA 2LRDA 3OR2C 3WHCA 2ADUA 1IXRC 1UHSA 3C3WA 5FLXK 5HS9A 3FXJA 2LKPA 2R7DA 2M3AA 5LEKA 1AA7A 1O3SA 2VN2A 4JX6A 3HSEA 4JQFA 1ETKA 5HLTA 5AONA 2ZXIA 2DOFA 3BZCA 4MEXF 1V5FA 3GF2A 4KJZA 2DDAA 4U0WA 1QRYA 4YFXF 4O3MA 1WSUA 4WXCA 2COMA 3OYBA 4KIFA 1V55H 4XBFA 3JRCA 2NVQJ 2CGPA 3EYYA 1N25A 2VPLA 3HIFA 3FM3A 3HQBA 3I5UA 4TV7A 1K61A 3H9QA 2M0CA 2HVQA 2LP0A 2R7SA 1KGSA 3BG5A 3WGIA 2YR2A 2BYVE 2ESNA 2YSRA 3OYNA 3S2DJ 4PSWA 2L3DA 2QQ9A 4PFPA 1X2NA 3MCZA 1ETVA 2ZXJA 4G94A 1I27A 1P6RA 1T08B 1X19A 3F8MA 2E2JJ 1LB2A 1IGNA 2EJRA 3CJRB 4F91B 1HXDA 5CVJA 2DDBA 2DA1A 2ZFUA 4FQGA 3SFZA 1HDPA 1Y0UA 2UWMA 2RDPA 1K83J 4XNFA 3HL2A 1DDNA 1OR7C 1P2FA 2EFOA 1WJDA 3TGNA 3LSRA 2B39A 1TQPA 2AO9A 2VASA 1ZG5A 1MNEA 3L2WA 2JPBA 2DFEA 1D1BA 2EIKH 2P5VA 4M74A 3JRHA 2VOPA 1D5YA 2NAZA 3I71A 2EA4A 3I4MJ 3KLNA 4ZYGA 2H09A 4Y52J 2LH9A 1IV8A 2QWWA 3OYAA 1GT0C 3I4PA 5DDGA 4UY8I 5HDNA 1ZAOA 1ODDA 2X6XA 4HRIA 4D9JA 5KAFC 3RYRA 3SDBA 4AUXA 2ZFWA 2H6BA 2R3SA 3GZ6A 3QP6A 1HW5A 5E1WA 3R61A 4ZYHA 1K6OA 4XICA 4QLCU 3DQVC 2P5LC 5BMZA 4MQ9F 2QYOA 2KDOA 4S0HB 3U9GA 2UZKA 5BOXA 2R7OA 4KMUX 1GV2A 2EA2A 1QNTA 3SZGA 2OTJI 3P9KA 1R49A 2DAOA 2DA3A 2F5VA 2L7MP 2W57A 2CUEA 1EH8A 2DODA 2VBZA 3K10A 2Y2ZA 5KHDA 3IL2A 1AOYA 5E1XA 2M9HA 2M30A 5D5XB 4BQQA 3GTLJ 2LOOA 4RGXA 2OQRA 4RGSA 2FXAA 3ASOH 1FPQA 4AIKA 3DU5A 2WAQN 3CTAA 1YS6A 3I59A 3HUGB 3RKWA 4LIVA 1LVAA 1RZ4A 3RPQA 1T0FA 1Z67A 3OYIA 2DK8A 1VTNC 4XLCA 4ZYDA 2TRTA 1R5GA 2EZIA 4XRMA 3S1RJ 3FHZA 3S16J 4XQFA 2VC0A 1KQ9A 2L0KA 2LY1A 3PO3J 2IS6A 3G1LA 2L02A 1TWHJ 4G6QA 4L0YB 3FXLA 3HOZJ 4A3CJ 4QIWN 1KU2A 3QAHA 3T8RA 2YX4A 2QLZA 3SYTA 4DZJA 1OMIA 3F9KA 4CZZA 4L18B 2X6OA 3K1MA 5GAGJ 3GFMA 3BTIA 2VI6A 4MLOA 5CKTA 4JK1X 1YRNB 2DQLA 2BV6A 5ED4A 1VQ4I 3BR1A 1IXSB 1ETOA 1EH7A 1XDUA 1JUPA 1QGPA 4CA0A 3CCUI 1ZR4A 3REOA 2XPVA 2VJIA 3ZQCA 2EV0A 2X1DA 3AL0C 2GBYA 3BQZA 3KE2A 4MO7A 1BL0A 1X3UA 4BEHA 4WWCA 1ZK8A 2CUFA 2G7HA 1VFCA 2Z99A 4YIIA 1HW1A 4KT5C 2DA6A 3G3ZA 1LVKA 3UR3C 2D1VA 1FYKA 3JR9A 3EPZA 4IF4A 4EJOA 3CMEI 3MN2A 4GFBA 1R58A 1YOVB 4KISA 1PP8F 3I54A 2KP6A 1QVTA 5BS6A 3K9TA 4KT6A 1R7JA 5TISC 1PUFB 3EYIA 1RKWA 3HC7A 2LVSA 4HWJA 2XRLA 3F23A 3RZOJ 2E19A 3BQYA 3LL7A 3G2BA 3FXRA 2ID6A 5EZHA 4XR6A 2K40A 2FU4A 4IQJA 3C1DA 2FEZA 4GO1A 2Q2EB 2IGOA 4UNOA 4RDUA 1P4AA 2BEOA 3OL3A 2BW3B 3T0YA 4EATA 1NG7A 5M5XJ 1OQYA 1WJBA 2OZUA 4S04A 1YLFA 5CLSA 3VDXA 2PJRB 4HX7A 2NVTJ 5FLMJ 1TQMA 2ZCWA 3ZMTA 3CDIA 3ERED 3OYKA 5H20A 4IJAA 4OMYA 1B8IA 3IRRA 1BA5A 3BZ6A 4HW0A 2B0LA 2WADA 3BJ6A 1KU9A 4A3EJ 3ZQIA 2A3SA 3R6SA 2HGCA 4A3DJ 1V54H 4A6DA 2DFFA 1ZKGA 2EPFA 1Z6TA 3VEPA 4A5MA 2E1MC 4HZFA 2C6YA 1HQCA 2BXZA 1TZLA 1YX5A 3ZP5A 4HV5A 4M3GA 1DUXC 1HSTA 1WZ2A 1FJLA 1SANA 3DTKA 2V79A 1WPKA
chains in the Genus database with same CATH topology
4ZYAA 1WFXA 5CPRB 4E7JA 3OYCA 4BQNA 2X1EA 2Z1DA 2W00A 5HOOA 2DOAA 3IAS2 2JA2A 4F55A 2QKLB 1QU3A 3FBIB 1DGWY 3H9JA 3PJRA 4U7BA 2VQCA 2W7NA 2IGMA 3QYEA 4Y4RA 3RQ4A 4B48A 4IKFA 3S8PA 2HU9A 2VXDA 1UELB 3OS0A 2WA0A 4YEJA 3RPUD 3PSIA 3ZQQA 4X0GA 2MC4A 4BUPA 2IS1A 4G6TB 4H4KC 3BC8A 2ELJA 3IP4B 4RM2A 4F93B 4CCJA 2E1MB 3VYUB 2X6WA 1G8XA 5HNHA 2R7QA 3DKXA 3FHNA 3CMMA 2R7RA 2V6EA 3LFUA 3ZRGA 2O5RA 2MD0A 3E0JB 2HQAA 1WJFA 2L9SA 2CV1A 2WB1A 3NWSA 3DTIA 4HSRA 2LBFA 2V26A 3CJQB 4AYBA 3VSKA 4BE0A 1X4PA 1Z3YA 4LIUA 4BACA 1YE9A 2F4IA 4RLFA 4ZTJA 1D1CA 2AQEA 1D0ZA 5HNFA 3RCOA 2DCEA 2W1OA 3K4BA 4J00A 4BJTA 4NUBA 4BU2A 2PJRA 1EA3A 1IRXA 2X85A 3OYFA 4ITVA 4HG2A 3OR1C 1DP3A 3OL4A 2HVRA 4ANJA 1BR1A 4YRVA 2R7UA 2VJ5A 2JSPA 2Z2SB 2ZXHA 4N4NB 1DQUA 3I3LA 3LSGA 4IQ4A 4BGDA 3BCAA 4HNTA 3OY9A 3L2QA 2JUGA 3OWTA 3KYLA 4BJ6C 3N05A 4XN3A 2BVMA 1BOBA 2RQQA 4HPQA 4XN0A 4XKBA 3SEZA 3K4JA 2CH0A 2CW7A 1UG0A 3H35A 2MFZA 2E5ZA 3EUKL 4XORA 5JHFA 2LBFB 3PNTA 3AFHA 2KRCA 3K4LA 4F92B 4RM3A 2WAEA 1BR4A 2PMZA 3MKWB 1WJ5A 3GBGA 1DGRM 2VKDA 1N77A 3S32A 5FRMA 4CSWA 2W4SA 3ONQA 3VYTB 2VIXA 5HVQC 2JVGA 3AKZA 2GOMA 4J01A 3CP8A 4ZC3A 4ZJZA 2X1CA 3QOEA 1NG6A 2IXSA 3V42A 3OS1A 4FETA 4D1QA 3DWLE 2K9LA 3K4KA 4HEA2 4RLQA 1QHHD 2A6TA 3L2RA 4BS9A 2FUG2 3DPTA 3OIPA 1WJEA 2LYCA 3OYMA 1JI8A 2K3PA 4OAYA 3H0DA 2VQLA 1Y56A 3PFYA 5TGTA 3RSNA 3D5LA 1MW7A 2IGNA 3OYGA 2L2OA 2V1NA 1QHGA 3CZ6A 4NQWB 3OYDA 4XLHA 4FXGB 3TBIA 4AVZA 3IUOA 2OUMA 3SEQA 2R7XA 2V4JC 2IGKA 2RREA 2GOXB 3BG7A 1MMAA 4CCNA 2V9KA 4P5OA 3PUBA 4BJ5C 4N4OB 2HVSA 3FDYA 4C2UA 3LSHA 1P9QC 2I8DA 4IX7A 4OWRB 4XLEA 2XDVA 2XAUA 3K70C 1D1AA 2L5QA 5FRNA 3BLYA 1MMDA 2WBMA 2K9MA 3H5AA 3M8JA 3QODA 4PSXA 1W36D 2VKHA 5CQGA 1N78A 5KCMA 2BVLA 4F52A 2VL8A 3W2VA 2KL4A 3QYBA 2CV2A 4R79A 3D5SC 2W82A 2HDWA 3PSFA 4CCMA 2KRHA 4GRIA 2UUZA 4DGWB 2XSJC 4BE1A 3OOUA 2BOLA 4YELA 3K4MA 4PUSA 1Z21A 4ZTFA 3OIQA 2VQGA 1WJAA 2LRDA 3OR2C 1Z7LA 2QKMB 4BL0B 3OYJA 4NNJA 3UNGC 4BDYA 3L2VA 2F6CA 2M3AA 3K4CA 1AA7A 2XC7A 2E60A 2JVHA 1SAUA 4JQFA 4ZDLA 5HLTA 2LY2A 2ZXIA 2NOJB 1U0JA 2IS2A 1V5FA 3FKJA 4KJZA 2WAFA 3E1SA 1X1BA 2VQHA 1KONA 2IS4A 3OYBA 3FBNB 4BXFA 4OAZA 2K5CA 2VPLA 4ZDPA 3C2HA 3DPLC 3H9QA 3PNVA 1T95A 3TL4X 2HVQA 4DBRA 3PNYA 2R7SA 4PJMA 4B43A 3OYEA 2HNHA 3QYFA 2ZSHB 4E7HA 4HNUA 3OYNA 3ZR8X 4C2TA 4PSWA 4PFPA 3S3NA 2XF7A 1X19A 1FMWA 2L7KA 4U87A 3CJRB 4F91B 2HPIA 2ZFUA 3DTEA 1YX3A 2UWMA 3DU6A 3HL2A 4XNFA 1OR7C 1V5GA 1WJDA 4RMNA 4E4HA 2MABA 4E7ZA 2X51A 3CF2A 2VASA 4XLAA 2KMUA 2VXZA 4QPOA 1MNEA 3L2WA 4Y33A 3VWBA 3AL0B 1D1BA 3ZXSA 2OC6A 2CUJA 4E7KA 3ZGKA 4E7SA 3LSIA 1ERDA 3K6GA 3H5RA 2LH9A 3MKYB 3OYAA 1X1CA 4II2A 3IAM2 1Z3XA 2RNGA 2X6XA 4HRIA 4XM3A 4D9JA 3CESA 4CCLA 3SDBA 4LG3A 4XMYA 4DBQA 2ZSIB 1V5EA 4PJJA 2M7BA 4E6KG 3J7AY 1MNDA 1E0EA 3K4NA 5LD2C 1FMVA 3DQVC 2WY7Q 2R7VA 2KZVA 2KDOA 1HA8A 2R7OA 4E7LA 3HOTA 3SZGA 2WY8Q 3RTRA 1X4OA 2M4GA 3I9V2 2F5VA 1MMNA 3EUAA 5KHDA 3K10A 1BR2A 4P1WA 3HPHA 3S3OA 4ZDOA 2E5NA 3A4CA 2R4GA 4BQOA 4BQQA 4C9YA 2LOOA 2AQFA 3KEYA 1TT0A 1WJCA 3HKZA 1PJRA 4LITA 3VYSB 1LKXA 3CP2A 3DU5A 3PL8A 3HOSA 1OLTA 4NC8A 1X1AA 3HUGB 4LIVA 4B44A 1Y6IA 1MMGA 3OYIA 3C2GA 2CFOA 4XLCA 1D0YA 5FROA 1T0FC 1UAAA 4BDZA 2HZDA 3HPGA 1K6YA 4XQFA 3H9GA 2LY1A 3NWTA 2IS6A 3OYHA 1LFPA 4QPQA 3H5NA 1J09A 3LSMA 2DJIA 3W2AA 4AU7A 1PYVA 4PK4A 3M1CA 3SYTA 4HSTA 3F9KA 4CZCA 4NC7A 2VLAA 2LREA 5KNLA 2DT6A 4B3XA 4MLOA 4DJAA 5CKTA 2VJJA 3W3CA 4PFOA 2KQRA 1GLNA 3A2KA 2KLOA 3S3MA 4CA0A 2XF6A 4XLFA 4B47A 5LFAA 2VJIA 2BW3A 4JOMA 4XKWA 1VZ0A 2X1DA 3AL0C 2M4KA 3L2UA 2A5WA 1ZELA 3MKZA 4BEHA 2DT7B 4Y3OA 5JPMB 2OV7A 3BCBA 3DLAA 1LVKA 3UR3C 2M7AA 3LMMA 4XONA 3EPZA 2CS3A 4CH7A 4KISA 2KP6A 1SFKA 4PJLA 2X6YA 3ZCOA 4KT6A 2CW8A 3HC7A 3LSKA 2XF5A 3K70D 3D5RC 2R7TA 3LL7A 3OMYA 3VSLA 2V7FA 3G2BA 4F3QA 2KHMA 2LG4A 2L9NA 4II3A 1D0XA 3BG6A 4XR6A 3OYLA 1W36C 2LC2A 1LDKB 4IQJA 2HPMA 1R6RA 2Y0SA 2Q2EB 4BE2A 2IGOA 4CUGA 3OL3A 3A1YA 2WAQA 2BW3B 4PJNA 4EATA 1NG7A 1WJBA 4BEHB 3DPUA 2UV1A 3VDXA 2PJRB 4DOZA 3OYKA 4FASD 4IZZA 1N75A 2Q1ZB 4XKVA 4CCKA 3OS2A 2VJ4A 3DKYA 1S9HA 2WADA 4CCOA 5CQEA 2DXIA 4XL9A 2R7WA 3W2WA 2M0MA 3EUHC 3KX2A 3S93A 2CMPA 3DEEA 1X1DA 4DIQA 4KITB 2E1MC 2CV0A 4XOPA 1TZLA 1YX5A 2KPMA 2Z16A 3MD2A 1G59A 2VB6A 2MYSA 2P0WA 2CUZA 4C30A 3U21A 3HXLA 4XKCA 4XOTA 4E7IA 3TMOA 3MMYB 3DTKA 3VYRB 3HG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA7 A;  4ITV A;  5CQE A;  1EA3 A;  3VDX A;  4D9J A;  3MD2 A;  2Z16 A;  4PUS A;  4IQ4 A; 
#chains in the Genus database with same CATH topology
 3CF5 F;  4A3J J;  3DBR B;  4E7J A;  3HZJ A;  2K9Q A;  1OYY A;  2IVM A;  4JX4 A;  2DOA A;  2W85 A;  3LFK A;  1OYI A;  1M1E B;  1K79 A;  4BYY A;  3FBI B;  3NQO A;  3H9J A;  3TO9 A;  2FNA A;  1Y8Q B;  2OJE D;  2VQC A;  3PM1 A;  4U7B A;  1JXS A;  3QYE A;  4Y4R A;  1UFM A;  4B48 A;  1WWX A;  3PQJ A;  2FML A;  4LLN A;  1X2M A;  1SVM A;  1OYW A;  3GCM A;  2EFW A;  2RKH A;  2IPQ X;  3HRT A;  1UJ8 A;  4IXA A;  4AIH A;  2A61 A;  3JRA A;  4KNY A;  1Z1D A;  5CYV A;  1MJ9 A;  4CHU A;  4UUS A;  2NYX A;  1G3Y A;  4H4K C;  3MKL A;  2IA0 A;  5E3O A;  1C0W A;  4DYC A;  5H6Q A;  2ECC A;  1PUF A;  2E7W A;  3VYU B;  4MGR A;  3MVP A;  3DKX A;  3FHN A;  2KT0 A;  2R7R A;  3CUQ C;  5CVR A;  1A5J A;  4NBQ A;  5D5W B;  3VPR A;  1JT6 A;  4EMS A;  1JHH A;  3E0J B;  2OA4 A;  3CCY A;  1VQO I;  5K5R A;  2R5Z B;  4W97 A;  2O8K A;  2LBF A;  3DFG A;  2M34 A;  1BI3 A;  3VSK A;  2HXI A;  1X4P A;  4DQ2 A;  4BE0 A;  4ENJ A;  4V19 K;  1XSV A;  1ULY A;  3ZQ7 A;  2AQE A;  4IHT A;  2O3F A;  5IP9 J;  1LNW A;  1BI1 A;  3HGG A;  4XSX F;  3IWZ A;  2WWY A;  3G73 A;  2PJR A;  4PGG A;  1Y39 A;  1LJ9 A;  1U5T C;  2L9V A;  3TOA A;  2HYF A;  2QVO A;  5DV5 A;  3B6C A;  1DP3 A;  2DYS H;  5LGT A;  5M3M J;  1I1S A;  2GXA A;  2R7U A;  1GVJ A;  2MGQ A;  3WTS C;  2HYG D;  1J0R A;  2YX7 A;  3SZP A;  2VJ5 A;  3V7S A;  1AKH B;  5FD6 A;  1DQU A;  3I3L A;  1U9N A;  4M9S A;  1KZH A;  2VON A;  4HNT A;  3LWF A;  1D8K A;  1U2W A;  2DBB A;  4YG2 F;  3ABU A;  4KA4 A;  1MZB A;  3G1O A;  3F21 A;  2K4J A;  2MH2 A;  4XN3 A;  4LB6 B;  1XCB A;  5E3L A;  2E1C A;  3LOC A;  1JKO C;  1WKM A;  2HFH A;  1APL C;  3KYC B;  3H35 A;  2MFZ A;  2E5Z A;  2UXX A;  4GDF A;  5CVI A;  3CC2 I;  4HX8 A;  1B9M A;  2K9S A;  3QRF F;  3AFH A;  2KRC A;  3K4L A;  3LAJ A;  2Z5U A;  3BDD A;  2JA6 J;  5L3F A;  4B3A A;  5EG0 B;  2K86 A;  2V9P A;  3RI4 A;  1JJ8 C;  2B63 J;  1DGR M;  2VKD A;  3HM5 A;  2MSY A;  2FA5 A;  3ROU A;  3VYT B;  3AKZ A;  3CP8 A;  1ZRD A;  2O61 A;  3G1M A;  1JJ6 C;  5EDN A;  2X1C A;  2IXS A;  1O7L A;  2R0Q C;  3FXM A;  2JA7 J;  1IRZ A;  4H0E A;  1KU7 A;  2M8G X;  4HW5 A;  4L9V A;  3DWL E;  2K9L A;  2EFQ A;  4ON0 A;  1UZC A;  2A6T A;  5DEQ A;  2L4A A;  2P4W A;  2XHK A;  5IYD J;  3DPT A;  1IN8 A;  3BJO A;  2VQL A;  1Y56 A;  2WV0 A;  5FKL A;  5TGT A;  1ETY A;  4B4C A;  3OV8 A;  2V1N A;  2JMW A;  3CZ6 A;  1B72 A;  2STT A;  2ICW G;  4FXG B;  1F43 A;  1E2X A;  5F0F A;  1QPI A;  4GXO A;  1T2K A;  2L9R A;  2IGK A;  1FWZ A;  1VQ5 I;  2RRE A;  1I3Q J;  1MMA A;  4CCN A;  4BJ5 C;  2GZW A;  4N4O B;  1JUM A;  3FDY A;  4CO8 A;  2YU9 J;  3SJM A;  3BR0 A;  1P9Q C;  2I8D A;  3JCU C;  1ZN2 A;  3H36 A;  3HTS B;  3OSG A;  2W24 A;  2XDV A;  3F72 A;  3BZK A;  4Y15 A;  2DFI A;  5FRN A;  3PIO F;  2DPD A;  2PFB A;  6PAX A;  3KP7 A;  2GAU A;  2VT2 A;  1XGO A;  1YW9 A;  1XSX A;  3M8J A;  2ZNZ A;  3H3Z A;  2DJN A;  2OCC H;  3QOD A;  1W36 D;  2IA1 A;  3QPH A;  4KUM A;  1P4W A;  4F52 A;  1U6G A;  2HTJ A;  3BPV A;  1ZHF A;  2G0E A;  2HKO A;  3QYB A;  2E2I J;  1RI7 A;  1E3P A;  4OMZ A;  2HDW A;  3UKG A;  1L0O C;  4GRI A;  2UUZ A;  1FP1 D;  4KN4 X;  5FFZ A;  4Z6Y A;  2ZJR F;  3W6V A;  1KYW A;  3ECH A;  3A02 A;  2E71 A;  3K4M A;  3FF5 A;  4PUS A;  5KAI C;  5IY5 H;  5J1R A;  2AXT C;  3BR3 A;  3OIQ A;  1A04 A;  4ZTF A;  2RVC A;  1Z7L A;  3OYJ A;  4NNJ A;  3UNG C;  1XB4 A;  5K1Y A;  4BDY A;  3K4C A;  4FX4 A;  2XC7 A;  3MZH A;  1MIJ A;  1NH3 A;  4CYC B;  4IHW A;  1VQN I;  5F1J A;  3IWF A;  1P7I A;  2IS2 A;  5FD5 A;  3ECO A;  2VQH A;  3E3V A;  1U78 A;  3TDU C;  3FBN B;  5ICE A;  4HDU A;  2O8X A;  3I58 A;  2PMH A;  2L54 A;  3NAU A;  2D45 A;  2K5C A;  1YIJ I;  4ZDP A;  1IAW A;  3BG9 A;  3DPL C;  3RZD J;  1VQ8 I;  3HGY A;  4RS8 A;  1I6X A;  2OTL I;  3PNY A;  4D0P A;  2CQX A;  2CQN A;  3FK6 A;  3KP4 A;  2KIU A;  2ZSH B;  4E7H A;  1FBS A;  4HNU A;  3ZR8 X;  4FHT A;  3HOY J;  1BBY A;  2Z3Y A;  5A2Q Z;  1G3S A;  2A6E F;  2DPU A;  1J7K A;  2HPI A;  3DTE A;  4BKX A;  1G6N A;  1OR7 A;  3QPT A;  4HLX A;  1KQ8 A;  1SD6 A;  2IBD A;  4LFU A;  2LF8 A;  1S72 I;  3Q9V A;  4A3L J;  5F0H A;  3O3K A;  3M8F A;  2V1D A;  1ZGW A;  2IW5 A;  4RMN A;  4E4H A;  1K4S A;  2LK2 A;  1GXP A;  3U1D A;  4WB2 A;  4XLA A;  2KMU A;  3S14 J;  4G7O F;  2LTP A;  4Y33 A;  5FFX A;  2FRH A;  4B1R A;  3VWB A;  4AYB N;  3AL0 B;  3ZXS A;  4DYR A;  3BOQ A;  2KJB A;  3ZGK A;  2ZJ2 A;  4FE4 A;  3SQN A;  2ME6 A;  3H5R A;  2P8T A;  3IH3 A;  3MKY B;  2OF7 A;  3EDP A;  4II2 A;  4AIJ A;  3IAM 2;  5F04 A;  1Z3X A;  2LDU A;  5E3N A;  4I6Z A;  1X58 A;  4IRI A;  3CES A;  3RKX A;  4DBQ A;  4PJJ A;  2M7B A;  1E0E A;  4ENK A;  2XV4 S;  4B09 A;  2R7V A;  2DA4 A;  2KZV A;  5B66 C;  2NVU B;  1TWA J;  5GTI C;  3HOU J;  2DA5 A;  1X4O A;  5EF6 A;  2M4G A;  4CYC A;  2P81 A;  5GP9 A;  1MMN A;  3EUA A;  3DKW A;  4P1W A;  3HPH A;  4UB6 C;  2E5N A;  3A4C A;  3ESW B;  4I98 B;  1RC9 A;  2HKX A;  4C9Y A;  3Q0V A;  2AQF A;  4LIT A;  3VYS B;  3HKZ A;  1PJR A;  2F5C A;  4LGW A;  5IPA A;  3CP2 A;  3PL8 A;  3HOS A;  3JTH A;  1YHQ I;  1XMK A;  1YYV A;  5DTD A;  2X9D A;  1T33 A;  3DF8 A;  5ILU A;  2MA3 A;  1MMG A;  1OCT C;  2XAS A;  2QBY A;  3C2G A;  2CFO A;  3ULQ B;  1YFH A;  1TNT A;  4QSH A;  5FRO A;  4FXK B;  1UAA A;  2A68 F;  2LKS A;  1HSJ A;  3CJT B;  4R8H A;  3WTX C;  3CC4 I;  1K6Y A;  3E5X A;  4M73 A;  5AIQ A;  3V8K A;  5HLG A;  1FSH A;  1LEA A;  2EFP A;  2BY3 A;  3NWT A;  1LFP A;  4A3M J;  2JPC A;  1CGP A;  3H5N A;  4IRH A;  3LSM A;  3I56 I;  1MBF A;  1ORK A;  3KP3 A;  1SVL A;  1J2X A;  1ZGA A;  1GDT A;  4AU7 A;  1ITY A;  4B8X A;  1GUU A;  3P9I A;  4RA2 A;  4L9T A;  2JQ7 A;  2X48 A;  1XGS A;  2QGU A;  2EIJ H;  2LRE A;  5KNL A;  2DT6 A;  1D3Y A;  3WTW C;  4DJA A;  4YFK F;  1REP C;  2ZME C;  2F5D A;  3U1K A;  3CMY A;  4F7Z A;  3A2K A;  1K78 A;  1XD7 A;  1J75 A;  3S3M A;  2XF6 A;  1IXC A;  2DQR A;  1XX5 A;  2ME0 A;  4XLF A;  3TDZ C;  1ON1 A;  2K02 A;  2EZK A;  2M4K A;  1H8A C;  3I59 B;  2TDX A;  2B7E A;  3JRG A;  2L4M A;  3MKZ A;  3N97 A;  1FNN A;  3GFJ A;  5EZG A;  4A2U A;  1OCZ H;  3O6B B;  3LQR A;  5B4P B;  3GX4 X;  3E6M A;  5J47 A;  4HLY A;  4P9U A;  4XON A;  2FSW A;  3F22 A;  1T39 A;  4FX0 A;  4M71 A;  1IJW C;  2CS3 A;  4CH7 A;  2XRO A;  1B9N A;  2X6Y A;  4OOI A;  4KDP A;  5AIP A;  1XC5 A;  4ZZD A;  1NK3 P;  2KIF A;  2CW8 A;  3LSK A;  3K70 D;  3KP2 A;  1PP7 U;  3OMY A;  3HQA A;  1HKS A;  1VI0 A;  2P5K A;  2DMN A;  2KHM A;  2LG4 A;  5K7F A;  4II3 A;  1POG A;  3BG6 A;  4M3B A;  1WCM J;  3OYL A;  4ENM A;  1W36 C;  5ILS A;  1FOX A;  3ZOB A;  5LGN A;  5JLW A;  2P7C B;  4MNU A;  2A5Y B;  3I0T A;  3C7J A;  1R6R A;  5LHH A;  4LLL A;  3FK7 A;  4BHP A;  4UHT A;  3GXO A;  2VOO A;  3KIO A;  3A1Y A;  2WAQ A;  2NRA C;  1O4X A;  2VT3 A;  1Z0X A;  3C2B A;  2LLK A;  4BEH B;  5D6E A;  3D0S A;  1XGM A;  2VE8 A;  1RES A;  1Z77 A;  4DOZ A;  2LFB A;  4MQV A;  4UVB A;  3R60 A;  1BIB A;  3FXK A;  4BXU A;  1IV6 A;  1XG1 A;  4N9I A;  3DKY A;  1MJB A;  3F0C A;  3HJE A;  2KZG A;  4XLN F;  2DXI A;  4I02 A;  3D1N I;  3E6B A;  1R1U A;  4Q48 A;  1F36 A;  5DM7 F;  2BBY A;  2XKO A;  4A3K J;  1OPC A;  2EZH A;  3LQQ A;  3EUH C;  2LMD A;  4W1U A;  2CMP A;  3TO7 A;  3DEE A;  3SXY A;  1A6Q A;  1VQM I;  2RV8 A;  4MHG A;  1VQ7 I;  2HOS A;  4IO9 F;  4S05 A;  4UV8 A;  3GYH X;  2KPM A;  2E36 A;  3J7Y J;  5LHG A;  3J81 Z;  2MYS A;  1EKE A;  1YG2 A;  4ESB A;  2CUZ A;  5JHU A;  3ML6 A;  3M1E A;  3HXL A;  3TMO A;  3MMY B;  1STZ A;  3JSP A;  1IC8 A;  1WFX A;  1JHF A;  3F8B A;  5CPR B;  3S15 J;  3JRI A;  4BQN A;  2X1E A;  2W00 A;  3HOV J;  2VBY A;  1FBU A;  3FIS A;  4KIG A;  3BTC A;  3ZMD A;  4F55 A;  4BBR J;  2YS9 A;  4KIB A;  2W7N A;  1T8I A;  2ELK A;  5DYM A;  4IKF A;  1R1T A;  2HU9 A;  1XN7 A;  3NEU A;  3RJP A;  2WA0 A;  5CJ9 A;  3RPU D;  3JAM K;  3PSI A;  1CQT A;  1RKT A;  2VUM J;  1B8I B;  4BUP A;  3GTG J;  4ABZ A;  4QWQ A;  4HF1 A;  1Z91 A;  4G6T B;  4DYQ A;  2ELJ A;  1W7P A;  5JVT A;  3IP4 B;  4RM2 A;  2ZB9 A;  4A0Z A;  1G4D A;  3E97 A;  3CUQ A;  5HNH A;  4U0V A;  2Y9Y A;  3HDD A;  3H92 A;  3CMM A;  3VFZ A;  2IRF G;  3LSP A;  3LFU A;  3AG3 H;  5IT9 Z;  1ZGJ A;  3Q3S A;  2O5R A;  3BPX A;  1WJF A;  2CV1 A;  4LD5 A;  2LSO A;  2D1H A;  3BR6 A;  3DTI A;  2V26 A;  4HSR A;  5ERI A;  5FGM A;  3ZMV A;  3G71 I;  3H0G J;  1Z3Y A;  1CF7 A;  1YE9 A;  2XAF A;  3EQL F;  4L5J A;  3V8J A;  1BN5 A;  2DU9 A;  2KJC A;  1D1C A;  4ZTJ A;  1XPX A;  5HNF A;  3RCO A;  2DCE A;  2W1O A;  3K4B A;  2XGE A;  1U5T A;  4LLG F;  1YIT I;  2CG4 A;  4IHY A;  4NUB A;  3H3V K;  1EA3 A;  1IRX A;  5BPI A;  3TP3 A;  1R22 A;  3V7R A;  3QP5 A;  1TL8 A;  1AU7 A;  1WI9 A;  4HG2 A;  4ITV A;  2FD5 A;  3QU3 A;  2BHY A;  3OL4 A;  3RQI A;  2W48 A;  4ANJ A;  1BR1 A;  3MEX A;  4I76 A;  4UUS B;  1QBJ A;  2E34 A;  5FKM A;  2ZXH A;  1MBK A;  2EQR A;  2LY9 A;  2TCT A;  3LSG A;  4ASN A;  3OY9 A;  5H6R A;  3HB9 A;  4WXH A;  3L2Q A;  2EH3 A;  1YS7 A;  4HOB A;  2XAJ A;  3S1Q J;  5FO5 A;  2OAZ A;  2ZC2 A;  5E8G A;  2BVM A;  5J4V A;  1BOB A;  2RQQ A;  4HPQ A;  4LK0 F;  4JP0 A;  1R5I D;  4XN0 A;  3Q9S A;  3ABL H;  4DNC A;  1RET A;  4WF2 A;  5BNG A;  1UG0 A;  2EWN A;  2CU7 A;  2M1B A;  1RUO A;  3Q0W A;  4XOR A;  3JRE A;  2ISY A;  2Y69 H;  2LBF B;  1TLH B;  1SMT A;  4G7H F;  2YU3 A;  3FM5 A;  2K4B A;  2PMZ A;  4IHS A;  3B02 A;  3MKW B;  1WJ5 A;  1XMA A;  1IUY A;  2DMQ A;  1OCC H;  2FMY A;  4EEF G;  2HXO A;  4XRS A;  1N77 A;  3S32 A;  4JBA A;  3BRO A;  2AXL A;  4Q47 A;  1FYM A;  1AWC A;  3WU1 B;  3WHB A;  2KRF A;  4RB2 C;  4J01 A;  2A05 A;  3WOD F;  1EV7 A;  1MH3 A;  4D1Q A;  3E6C C;  1BW6 A;  1NHA A;  3FX3 A;  3K4K A;  3QQA A;  4RLQ A;  1S8N A;  3CC7 I;  2QF7 A;  3CJN A;  1QHH D;  3L2R A;  3RIR A;  5LEJ A;  5D5V B;  4BS9 A;  3GTM J;  1USS A;  4HBL A;  3NAR A;  1ENH A;  3S2W A;  3CCJ I;  2K3F A;  3KET A;  2WTE A;  1JUS A;  1JI8 A;  4UU9 C;  3PFY A;  5F6F A;  3RSN A;  5EEA A;  5EJC A;  1HDD C;  4NQW B;  1ZRC A;  4P96 A;  4IRG A;  4Y13 A;  4G8X A;  3TBI A;  3IUO A;  4V2F A;  3SEQ A;  2R7X A;  3KEQ A;  5FKO A;  4PJ0 C;  2NOG A;  1MH4 A;  1PVE A;  3BG7 A;  3KPH A;  3WGH A;  1HLV A;  1FT9 A;  3PUB A;  3MAJ A;  4P9F A;  3CCL I;  2HS5 A;  4P3A A;  1BI2 A;  2XUB A;  2JT1 A;  3LSH A;  4C2U A;  1E3H A;  1RNL A;  4NHJ A;  1QZY A;  3B6A A;  4IX7 A;  4GCV A;  1YI2 I;  1HF0 A;  2M87 A;  1FZP B;  3K70 C;  3ZQL A;  2HWV A;  2VOD A;  4WB3 A;  4EM0 B;  3LAP A;  3CDH A;  3PIP F;  1WI3 A;  1R4M B;  5CVU A;  2QSF X;  4PSX A;  5LRR A;  2VKH A;  5CQG A;  2IP2 A;  3GME A;  3F3X A;  1SD7 A;  2VL8 A;  1O3R A;  3W2V A;  4DW6 A;  2HQ5 A;  5FB2 A;  4XLP F;  2JRT A;  2A07 F;  4UUV A;  1V3F A;  3OOU A;  3ERM A;  2CJJ A;  3CUO A;  4YEL A;  1B72 B;  1CFA A;  3K0L A;  2EIM H;  5H2F C;  3K1N A;  3O8H A;  1XTA A;  1WJA A;  4Q4Z F;  4A0Y A;  4BL0 B;  2QKM B;  5BQT A;  1HW2 A;  4AM3 A;  3MZ8 A;  2BHZ A;  2PBI A;  3Q5F A;  4O5V A;  3L2V A;  1HC8 A;  3PUF A;  2E60 A;  2KDZ A;  2JVH A;  3DP7 A;  1SAU A;  3ZQG A;  2F4M B;  3A03 A;  5GPC A;  1U0J A;  2PMU A;  2IA2 A;  3ABT A;  2QQ8 A;  5DD4 A;  5J3L A;  2H94 A;  3R0A A;  1H9T A;  2WAF A;  3O2P E;  1DP7 P;  3PQK A;  2W84 A;  1BJZ A;  1KON A;  1YTY A;  4HQE A;  2FX0 A;  5GAH J;  3T5X A;  4BXF A;  1I1G A;  4HF0 A;  4G12 A;  3NRV A;  2Q0O A;  1ZTR A;  1S7A A;  1UMQ A;  1F9N A;  1WQ2 A;  3PNV A;  5FKK A;  3TL4 X;  3CU7 A;  1LE8 A;  2HZT A;  1SAX A;  1JKR C;  4DBR A;  3OYE A;  2HNH A;  1DPR A;  3QYF A;  4NQW A;  4C2T A;  3CCV I;  5E1Z B;  3KZY A;  1C5A A;  3RDI A;  2R5Y A;  3E7L A;  4MTE A;  2DT5 A;  2XF7 A;  1FOK A;  2H1K A;  2NNN A;  1WRJ A;  1R36 A;  1FMW A;  2LD5 A;  1IN6 A;  1JGG A;  5LLQ A;  2L7K A;  3KCC A;  4U87 A;  5B1B H;  3S1M J;  1WVR A;  1YX3 A;  4G9Y A;  4QTR A;  1I5Z A;  4FIS A;  5BPD A;  5JI6 A;  2DFH A;  2NNY A;  2MAB A;  1W5S A;  4AID A;  2X51 A;  2Y75 A;  4I0A A;  3CCM I;  2VXZ A;  4QPO A;  3GFI A;  3E5U A;  1YJW I;  2OC6 A;  4E7K A;  4EM1 A;  2H6C A;  3OIO A;  1ERD A;  4IOA F;  3K6G A;  4YFN F;  5J8C A;  2O03 A;  1DU0 A;  3PFI A;  3GUD A;  2RNG A;  4EGZ A;  4LG3 A;  4XMY A;  5B3S H;  2ZSI B;  1ZH5 A;  1V5E A;  3P9C A;  3DBL B;  2XAH A;  1OCP A;  4E6K G;  1MND A;  1E3O C;  5DUI A;  5LD2 C;  1Y1V J;  3DEW A;  2BGC A;  2EIN H;  2XSD C;  3HHH A;  1MDM B;  1HA8 A;  4E7L A;  3HOT A;  2CYY A;  2WY8 Q;  2QM3 A;  4HX4 A;  1SEU A;  2XPU A;  1VF9 A;  3I9V 2;  2H27 A;  2OD5 A;  2R7F A;  4ESJ A;  1BI0 A;  1LDJ A;  5EGO A;  4IVN A;  1MBE A;  3E5Q A;  3LA7 A;  3RKY A;  2Z33 A;  1OJL A;  1BR2 A;  1OFC X;  1FOW A;  1MGT A;  1TTY A;  4XRF A;  4ZDO A;  1Z9C A;  2LNB A;  1BW5 A;  2D2W A;  1SMY F;  2P7V B;  5HLH A;  2QQA A;  1TT0 A;  5B1A H;  1NK2 P;  1LKX A;  5D5U B;  1BIA A;  5FLV A;  2XGX A;  1J59 A;  1OLT A;  4NC8 A;  2GA1 A;  1X1A A;  1BM9 A;  4B44 A;  3ABM H;  1Y6I A;  4CYD A;  2OZ6 A;  1LDD A;  3CCQ I;  1SC7 A;  4R1H A;  2IAI A;  1D0Y A;  3FIW A;  3K69 A;  4LG0 A;  1R4N B;  1JT0 A;  3L1P A;  5D6F A;  1GHC A;  2I10 A;  2LR8 A;  2PQ8 A;  3GWZ A;  3H9G A;  3HHG A;  1J09 A;  5D8K B;  2G9W A;  1BC7 C;  1W0T A;  5K7H A;  3W2A A;  5HLI A;  1PYV A;  2PX9 A;  4PK4 A;  2P6T A;  4X1E A;  4FT8 A;  3IC7 A;  3J80 K;  2ZME A;  3KLO A;  4YIR X;  4Y17 A;  3W3C A;  3WTZ A;  4YIF A;  1QPM A;  4I2O A;  2KQR A;  1GLN A;  3JTG A;  2KLO A;  3BR5 A;  4A6E A;  1U8R A;  4PDK A;  3PO2 J;  4BY1 J;  1HBX G;  3F8N A;  5LFA A;  5JPN B;  4FTH A;  4XKW A;  1VZ0 A;  2A5W A;  1ZEL A;  3RYP A;  4A3I J;  2GM4 A;  4WX9 A;  5J8F A;  2D5V A;  2ZJP F;  3BJA A;  2JSC A;  5JPM B;  5F27 A;  2OV7 A;  2QBY B;  4EJV A;  3WU2 C;  3GFL A;  2QUF A;  4BQA A;  2OQG A;  5DCF A;  5B5E C;  4A12 A;  1YQA A;  3CO7 C;  2RC4 A;  5E8I A;  4PJL A;  4LOC A;  4UB8 C;  2K7L A;  1TW3 A;  3M07 A;  1MDM A;  1TW2 A;  3MFK A;  1P7J A;  1S5L C;  3WTY C;  2L7Z A;  4GYG A;  1F4K A;  4UV9 A;  4RBO A;  3VSL A;  4EV0 A;  3TP0 A;  2L9N A;  3J7A O;  2MC3 A;  1P4X A;  1K78 B;  3K1P A;  2O6G E;  2Y0S A;  2WB1 N;  4BE2 A;  1JKP C;  4PJN A;  3TQN A;  3TW7 A;  1TC3 C;  5JLX A;  3WTU C;  2VE9 A;  2V9V A;  2UV1 A;  4IHX A;  2HQR A;  1JTY A;  2MLK A;  3HRM A;  4FAS D;  5TRD A;  3S17 J;  3OS2 A;  3ZQF A;  2K9N A;  2VJ4 A;  4I99 C;  1S9H A;  4CCO A;  4HAM A;  2XAQ A;  5L3D A;  4XL9 A;  4M6X A;  4OIN F;  3EUH A;  3CLQ A;  5E3M A;  3ZMU A;  2R7W A;  1KQ0 A;  4IEJ A;  5FLX Z;  2Q8K A;  3CQZ J;  3ZN0 A;  1SD4 A;  2NVY J;  4DIQ A;  4OIP F;  4KYW A;  4XOP A;  2QA4 I;  1B59 A;  1J5Y A;  3HYI A;  2Z16 A;  3MD2 A;  1G59 A;  4Q5S F;  3A01 B;  4L5E A;  2P0W A;  3E6D A;  2EB7 A;  5HDG A;  4U0Y A;  4XOT A;  3SDG A;  5D8L B;  3BWG A;  1GXQ A;  1ZRF A;  4AVP A;  1IN7 A;  2O9L A;  4KIC A;  1NTC A;  2JRM A;  3WG7 H;  2ID3 A;  3K2Z A;  5IOY A;  3ZPL A;  1QU3 A;  1MJA A;  1H88 C;  1DGW Y;  2FE3 A;  3I55 I;  4LJZ F;  2XVC A;  2BY0 A;  4L5I A;  2F5F A;  2VXD A;  1QZZ A;  4YEJ A;  1ETW A;  3ZQQ A;  1ZRE A;  3X2Q H;  5J1Y A;  3AG2 H;  4X0G A;  5L3G A;  3BTJ A;  4HA8 A;  5LHI A;  2MC4 A;  1ETX A;  2GLO A;  3BY6 A;  2WV1 A;  3BC8 A;  5C4J J;  2HDD A;  1TWC J;  4CCJ A;  1UG2 A;  2E1M B;  4I09 A;  2EIL H;  4LMY A;  5DS9 A;  1W0U A;  5D4R A;  2GXB A;  4BBS J;  1LPQ A;  3BTL A;  2E35 A;  1G8X A;  5LGU A;  1X3W B;  3FMR A;  1B1B A;  1S7O A;  4M72 A;  2V6E A;  3HSR A;  3ZRG A;  1TQI A;  2DYR H;  4NB5 A;  2HQA A;  4HV6 A;  1SFE A;  1X1P A;  3NWS A;  1SD5 A;  2VC1 A;  3CJQ B;  3M3Y J;  2A6H F;  4G6D A;  5FKN A;  5IP7 J;  1T6S A;  5KK1 A;  2M2E A;  2Y31 A;  4BAC A;  1FYL A;  2F4I A;  5IYB J;  2F5E A;  5ICG A;  1D0Z A;  1ZAR A;  2VKV A;  4J00 A;  2RN7 A;  4BJT A;  4BU2 A;  2X85 A;  4K2E A;  3AAF A;  2HOA A;  5IOZ A;  1FIP A;  2QQB A;  2FBH A;  5L3C A;  3J7Z I;  5GPA A;  3GTK J;  3OR1 C;  1FY7 A;  3G4S I;  1ACI A;  3FZV A;  2IT0 A;  1YJN I;  3QPL A;  4YRV A;  2STW A;  4D5C A;  1YIO A;  3HKZ N;  3JRD A;  2FQ4 A;  1YW8 A;  4N4N B;  4RAF A;  1W7P B;  2LKX A;  9ANT A;  2GIV A;  4IQ4 A;  3W6K B;  3KYL A;  2KIS A;  1HKQ A;  3WU0 A;  3WE3 A;  4GGG A;  3CUQ B;  4MFE A;  3T8T A;  5K5Q A;  3CCS I;  4D7M A;  3A01 A;  2CH0 A;  2CW7 A;  3TW6 A;  4AD9 A;  4A0X A;  5K5O A;  1ZLJ A;  1SVO A;  2Y30 A;  5JHF A;  1U3E M;  2CO5 A;  3PNT A;  3KLS A;  4U7D A;  2LF7 A;  2EK5 A;  5DM6 F;  1CF7 B;  1L3L A;  4F92 B;  4RM3 A;  2PN6 A;  4HDV A;  2WAE A;  1BR4 A;  1MBG A;  4RGU A;  3FXU A;  2UXN A;  3GBG A;  4BH9 A;  1U5T B;  4FE7 A;  4XK4 A;  4UVC A;  1XDS A;  3JAM Z;  5FJ8 J;  1E17 A;  5FRM A;  4NC6 A;  4CSW A;  4XRS G;  3ONQ A;  2E7X A;  2VIX A;  5HS7 A;  1UHW A;  2JVG A;  1W7P D;  1XGN A;  2GOM A;  5ICC A;  2FJ1 A;  4ZC3 A;  4ZJZ A;  3QOE A;  1NG6 A;  2XAG A;  4M6Y A;  2QZ8 A;  3AG1 H;  3OS1 A;  2PEX A;  3VB2 A;  4BAY A;  2XB0 X;  2GIZ A;  3C18 A;  1FBQ A;  2FUG 2;  2J5P A;  4BNC A;  1WJE A;  2F48 A;  2ESH A;  3CLO A;  5J6X A;  2K3P A;  3OYM A;  1H89 C;  1R1V A;  1RR7 A;  2IGN A;  3SFI A;  3JRB A;  2L2O A;  1A6I A;  3OYD A;  4OIO F;  1TWG J;  2J5O A;  2MH9 A;  1FC3 A;  1R5H A;  1R23 A;  3JRF A;  2BZT A;  1AHD P;  2OUM A;  1H9G A;  5J40 A;  2B9S A;  2V4J C;  3WTV C;  2MBF A;  1O7F A;  2GOX B;  2ZXW H;  2V9K A;  4P5O A;  4ZH4 F;  4IOC F;  1SFU A;  2HVS A;  3SHF A;  1YJ9 I;  4X6A J;  3DXJ F;  2GA2 A;  4OWR B;  4XLE A;  4KFC A;  1D1A A;  2R92 J;  2VKE A;  3GTP J;  2XB5 A;  2ZBK A;  3IH2 A;  1G3W A;  1MMD A;  1W4M A;  1IF1 A;  2K9M A;  3COA C;  3H5A A;  1LFU P;  1JGS A;  1FTZ A;  2XIG A;  3QWL A;  3A0H C;  1N78 A;  1R00 A;  1P92 A;  3JSO A;  2BVL A;  1OCO H;  2DA2 A;  1B4A A;  1I6H J;  3KZI C;  2WC2 A;  2KL4 A;  2CV2 A;  4RAZ A;  1IN5 A;  3D5S C;  1W1W E;  1F1Z A;  2QEX I;  4CCM A;  2KRH A;  2XSJ C;  4BE1 A;  3CDL A;  4HYE A;  3M8E A;  5DCM B;  4UXN A;  2JA8 J;  4CGZ A;  3GLL A;  3L00 A;  2VQG A;  1FX7 A;  5C44 J;  3BT9 A;  4CXF A;  1JE8 A;  4AC0 A;  4HNV A;  3F6V A;  3ZMZ A;  1WHU A;  1BC8 C;  3G6E I;  2F6C A;  2DK5 A;  4I7H A;  1WH7 A;  3GTQ J;  1IW7 F;  2GQQ A;  4ZDL A;  3B73 A;  3U2R A;  1TP4 A;  2LY2 A;  2NOJ B;  3J81 K;  3FKJ A;  4C3I J;  3E1S A;  1X1B A;  1TBX A;  1VQK I;  3RKQ A;  2IS4 A;  3DCF A;  3ZMS A;  4EM2 A;  4ETS A;  4MFD A;  4OAZ A;  2FOK A;  2ISZ A;  3C2H A;  2HOT A;  5CVV A;  4U88 A;  4BY7 J;  4C3J J;  1LUJ B;  1T95 A;  1WGX A;  3L09 A;  3DBH B;  3AG4 H;  4PJM A;  4B43 A;  4ZYE A;  4G7Z F;  3RPU A;  4EGY A;  2QSG X;  4ZZL A;  3HEF A;  2FBI A;  3S3N A;  1T98 A;  4EJU A;  2G7U A;  2ETH A;  2BXY A;  4D5F A;  2KKO A;  3F8C A;  3FMS A;  5IYC J;  2MG4 A;  4L9N A;  3ZN1 A;  5F64 A;  2DN0 A;  4FCY A;  1IDZ A;  2MW8 A;  4GYI A;  4OIR F;  4N9H A;  5IP6 A;  3DU6 A;  3H3U A;  3TO6 A;  1XSD A;  2O0Y A;  4A5N A;  2QSH X;  1V5G A;  2K27 A;  3GO5 A;  1IRF A;  2JN6 A;  1GV5 A;  4P55 A;  5IT9 K;  4E7Z A;  2V1X A;  3CF2 A;  3N4M A;  2IJL A;  5J4Y A;  4RAY A;  2N8G A;  4LB5 A;  1G2H A;  1LQ1 A;  3GZN B;  5GAE J;  1VQP I;  2VPR A;  2CUJ A;  4E7S A;  3LSI A;  3HUG A;  4IHV A;  4I0B A;  1IZ1 A;  4P39 A;  1X1C A;  3ELK A;  1LE8 B;  4XM3 A;  3O8G A;  3KP6 A;  2V1U A;  4CCL A;  1PUE E;  1ZYR F;  4LK1 F;  5DCM A;  1T56 A;  2PJP A;  3J7A Y;  1GVD A;  1VQ6 I;  3K4N A;  2R5Y B;  2FNP A;  2KIM A;  3M7G A;  1DU6 A;  1FMV A;  1QO0 D;  4WK8 F;  2WY7 Q;  4Y7N J;  4CDG A;  1G3T A;  4RB1 A;  2COB A;  3RTR A;  2CQK A;  2MD5 A;  2QCO A;  1UB9 A;  1H0M A;  4M3F A;  1FEX A;  4BXX J;  4OIQ F;  1RUN A;  1YRN A;  3S3O A;  2R4G A;  4BQO A;  2FBK A;  2E2H J;  3KEY A;  3LSJ A;  3DEU A;  1WJC A;  1OCR H;  4M6V A;  2HI3 A;  5TJJ A;  3M4O J;  4M9Z A;  1FSE A;  2HTS A;  2X0L A;  3GTJ J;  2PMZ N;  3IKT A;  2P6S A;  4P3B A;  1T0F C;  3GW2 A;  3DLL F;  1RIO H;  4BDZ A;  1Y0N A;  2HZD A;  2OPT A;  3HPG A;  3JW4 A;  2JA5 J;  4RAG A;  1B6A A;  1QVU A;  1FP2 A;  1ONV A;  5DD8 A;  3OYH A;  4QPQ A;  2M8E A;  2JJ7 A;  4A3F J;  2XRN A;  3OOP A;  2DJI A;  2NS0 A;  1T38 A;  3M1C A;  3ASN H;  4HST A;  3V4G A;  4M3D A;  4NC7 A;  4CZC A;  2VLA A;  1SFO J;  2KFD A;  5EGO B;  1VQL I;  4B3X A;  2XKP A;  3LA3 A;  2VJJ A;  4EQQ A;  3QOP A;  3GTO J;  4PFO A;  4IPA A;  3OSF A;  2RGV A;  3BP8 A;  1MNM C;  4I6O A;  2RAE A;  1PDN C;  1HKT A;  2JTV A;  5F0C A;  2Q2E A;  4MIM A;  1I50 J;  4B47 A;  4JOM A;  2BW3 A;  2CSO A;  1YO5 C;  3L7W A;  2DMU A;  3L2U A;  2ZJQ F;  3IHU A;  4JYK A;  2CFX A;  5EEH A;  2JZY A;  3GLX A;  2PLY A;  2DT7 B;  4HF2 A;  2E1O A;  4Y3O A;  4EVI A;  3HRS A;  1MD0 A;  3V7C A;  1V4R A;  3BCB A;  3GVA A;  2Z9O A;  3DLA A;  2M7A A;  5D4S A;  1Z05 A;  2F4O B;  4L0Z B;  1OIS A;  3LMM A;  4LG0 B;  2PI0 A;  1TWF J;  2XGC A;  1U9O A;  2E1N A;  1D5V A;  3TKY A;  2AHQ A;  2RNJ A;  1SFK A;  4EJT A;  4V2G A;  3ZCO A;  2FF4 A;  5IT3 A;  2CQ7 A;  4C2M J;  2XPW A;  5K7Z A;  2M5W A;  2XF5 A;  3CD6 I;  3D5R C;  2R7T A;  2GWR A;  2IEK A;  1FTT A;  1IRG A;  1MKM A;  2ZME B;  5KVR A;  2V7F A;  4F3Q A;  1W5T A;  2CWE A;  2EV5 A;  1D0X A;  5EEG A;  1K7A A;  2LC2 A;  1LDK B;  1BJA A;  4PCQ A;  2DLL A;  2HPM A;  2EV6 A;  4CUG A;  2RQP A;  2CQQ A;  2JUC A;  2VBW A;  2OCE A;  2HDC A;  3DPU A;  3ZQH A;  3S1N J;  1Y1W J;  5E17 F;  3LST A;  3LNQ A;  1IUF A;  3R4K A;  4KMF A;  2DTR A;  4IZZ A;  1N75 A;  2Q1Z B;  2ECB A;  1MBH A;  4XKV A;  4CCK A;  2Y0M A;  5GTH C;  2NS7 A;  3WE2 A;  4N0B A;  4UVA A;  5CQE A;  5M3F J;  1TT5 B;  1EJ9 A;  3KFW X;  4I01 A;  3W2W A;  4Z2Y A;  2M0M A;  1QZE A;  4XSZ F;  5F1R A;  3KX2 A;  3S93 A;  1ZG3 A;  3T1B A;  1S3J A;  1X1D A;  2V6C A;  3J80 Z;  4KIT B;  2CV0 A;  2PG4 A;  3W6J B;  1KYZ A;  2OBP A;  5HDK A;  2ELH A;  1EF4 A;  1Q1H A;  2VB6 A;  3H1C A;  4C30 A;  1ZG1 A;  3F6O A;  4WCG A;  3U21 A;  4XKC A;  4E7I A;  1IO2 A;  2R5Z A;  2L7F P;  4M3E A;  4EJW A;  3VYR B;  3HG9 A;  3VOE A;  2DMP A;  4ZYA A;  3EET A;  5HOD A;  3CO6 C;  1S6L A;  1O3T A;  3OYC A;  3CCE I;  2Z1D A;  5L3E A;  5HOO A;  3IAS 2;  4MEY F;  2JA2 A;  2QKL B;  3PJR A;  2IGM A;  2W25 A;  1Q1V A;  3RQ4 A;  5M5W J;  3S8P A;  1UEL B;  1UST A;  2EFN A;  3OS0 A;  1IN4 A;  2HEO A;  2L01 A;  2K85 A;  4RB3 C;  2YUS A;  2Y9Z A;  2H8W A;  4NDL A;  3HOW J;  2IS1 A;  3WG9 A;  1SFX A;  3IH4 A;  1KA8 A;  4A69 C;  1W5C C;  5EYR A;  1AKH A;  1Z6R A;  3WTT C;  4F93 B;  3I4N J;  2XGD A;  2H1L A;  3HRU A;  2JWT A;  5ICF A;  2X6W A;  1O57 A;  1D8J A;  2NS8 A;  2HR3 A;  2R7Q A;  3K2A A;  1KJS A;  1XMX A;  2GXG A;  1LFB A;  2Y48 A;  2I5U A;  5E79 C;  3KZZ A;  3VOD A;  1YW7 A;  1BOA A;  2ZKZ A;  4IL6 C;  1XS9 A;  2MD0 A;  2YPR A;  3K7A J;  2L9S A;  1JKQ C;  4DZP A;  2WB1 A;  4AYB A;  4D7N A;  2DA7 A;  1R9T J;  1RPW A;  4LIU A;  2MLG A;  3A0B C;  4RLF A;  1XCV A;  1MSE C;  1DPU A;  4ENN A;  4C3H J;  5EG0 A;  2AS5 F;  1Z7U A;  3MQ0 A;  1A36 A;  3SZT A;  1F5T A;  3FXQ A;  2FOW A;  1ZQ3 P;  2BE5 F;  4BHB A;  3TOB A;  3HBL A;  3OYF A;  1I3A A;  2OU2 A;  2FQ3 A;  2ACJ A;  2NVX J;  2HVR A;  4WXD A;  2A69 F;  4CIC A;  3I64 A;  1FOY A;  2HOE A;  2JSP A;  2Z2S B;  4E70 A;  3GZ5 A;  4BGD A;  3BCA A;  1FIA A;  2JUG A;  3OWT A;  2DMT A;  4BJ6 C;  3N05 A;  2M45 A;  4A3B J;  2HYJ A;  4O6J A;  1O3Q A;  4HQM A;  1A35 A;  1TNS A;  4XKB A;  3SEZ A;  3K4J A;  3DV8 A;  1UCR A;  2R93 J;  5E20 A;  1WH5 A;  3EUK L;  2X4H A;  1I39 A;  1U8B A;  2H8R A;  2QEN A;  3WGG A;  5JVG F;  2EBI A;  3L2C A;  3R0J A;  3FWE A;  2A73 B;  3M9A A;  5F08 A;  3CCR I;  1Y8R B;  2BY2 A;  1VND A;  3KP5 A;  4J19 A;  3HSF A;  2BY1 A;  2DI3 A;  4M9X A;  5M5Y J;  1HOM A;  2DOE A;  1EH6 A;  3IV5 A;  2W4S A;  2NXN B;  1MSF C;  3HOX J;  2CW0 F;  5LBQ A;  5HVQ C;  3LA2 A;  2DO7 A;  3Q0U A;  3V8L A;  3KEO A;  2DW4 A;  4A93 J;  3P5J A;  3V42 A;  3GEZ A;  5L3B A;  4FET A;  2JK3 A;  4HEA 2;  2CRG A;  1IG7 A;  1KU3 A;  3S2H J;  5JFR A;  1MBJ A;  1ON2 A;  3OIP A;  4JX5 A;  1R71 A;  4UUT A;  2LYC A;  3KYD B;  5DUK A;  5GAD J;  4OAY A;  5LRS A;  3H0D A;  4RGR A;  3BR2 A;  3D5L A;  1MW7 A;  3P7N A;  3OYG A;  3FKI J;  3MWM A;  1QHG A;  1S7E A;  4OU0 A;  4XLH A;  5J1U A;  1MMS A;  4L9J A;  5C4X J;  3FMQ A;  4AVZ A;  1JTX A;  5A2Q K;  4A3G J;  3ABK H;  4XID A;  3TED A;  2KIQ A;  5HS8 A;  1LEB A;  3IKV A;  2HQN A;  2VBX A;  5E18 F;  2DTZ A;  1X3Z B;  2EZL A;  5ILV A;  4BHC A;  3BG3 A;  2O7O A;  1S29 A;  1RRJ A;  1UHM A;  1RR8 C;  1HCR A;  2R7Z J;  2XAU A;  2L5Q A;  3QU6 A;  1ZLK A;  3I53 A;  3BLY A;  2Y0S N;  2WBM A;  1VQ9 I;  4ESF A;  3QPS A;  1QQI A;  2ZO4 A;  2F2E A;  3MZY A;  4AWX B;  3IRQ A;  1ZR2 A;  4RB0 A;  3CMA I;  3L9F A;  5KCM A;  1A31 A;  3F8F A;  4R79 A;  4PGH A;  1OKR A;  3FXO A;  2W82 A;  1QA6 A;  2ZNY A;  3PSF A;  1ETQ A;  1J9I A;  4DGW B;  4MTD A;  1K4T A;  4PZJ A;  5C3E J;  2BOL A;  5JR3 A;  1Z21 A;  1IDY A;  3ISP A;  4KN7 X;  3HTU A;  1FLI A;  2LRD A;  3OR2 C;  3WHC A;  2ADU A;  1IXR C;  1UHS A;  3C3W A;  5FLX K;  5HS9 A;  3FXJ A;  2LKP A;  2R7D A;  2M3A A;  5LEK A;  1AA7 A;  1O3S A;  2VN2 A;  4JX6 A;  3HSE A;  4JQF A;  1ETK A;  5HLT A;  5AON A;  2ZXI A;  2DOF A;  3BZC A;  4MEX F;  1V5F A;  3GF2 A;  4KJZ A;  2DDA A;  4U0W A;  1QRY A;  4YFX F;  4O3M A;  1WSU A;  4WXC A;  2COM A;  3OYB A;  4KIF A;  1V55 H;  4XBF A;  3JRC A;  2NVQ J;  2CGP A;  3EYY A;  1N25 A;  2VPL A;  3HIF A;  3FM3 A;  3HQB A;  3I5U A;  4TV7 A;  1K61 A;  3H9Q A;  2M0C A;  2HVQ A;  2LP0 A;  2R7S A;  1KGS A;  3BG5 A;  3WGI A;  2YR2 A;  2BYV E;  2ESN A;  2YSR A;  3OYN A;  3S2D J;  4PSW A;  2L3D A;  2QQ9 A;  4PFP A;  1X2N A;  3MCZ A;  1ETV A;  2ZXJ A;  4G94 A;  1I27 A;  1P6R A;  1T08 B;  1X19 A;  3F8M A;  2E2J J;  1LB2 A;  1IGN A;  2EJR A;  3CJR B;  4F91 B;  1HXD A;  5CVJ A;  2DDB A;  2DA1 A;  2ZFU A;  4FQG A;  3SFZ A;  1HDP A;  1Y0U A;  2UWM A;  2RDP A;  1K83 J;  4XNF A;  3HL2 A;  1DDN A;  1OR7 C;  1P2F A;  2EFO A;  1WJD A;  3TGN A;  3LSR A;  2B39 A;  1TQP A;  2AO9 A;  2VAS A;  1ZG5 A;  1MNE A;  3L2W A;  2JPB A;  2DFE A;  1D1B A;  2EIK H;  2P5V A;  4M74 A;  3JRH A;  2VOP A;  1D5Y A;  2NAZ A;  3I71 A;  2EA4 A;  3I4M J;  3KLN A;  4ZYG A;  2H09 A;  4Y52 J;  2LH9 A;  1IV8 A;  2QWW A;  3OYA A;  1GT0 C;  3I4P A;  5DDG A;  4UY8 I;  5HDN A;  1ZAO A;  1ODD A;  2X6X A;  4HRI A;  4D9J A;  5KAF C;  3RYR A;  3SDB A;  4AUX A;  2ZFW A;  2H6B A;  2R3S A;  3GZ6 A;  3QP6 A;  1HW5 A;  5E1W A;  3R61 A;  4ZYH A;  1K6O A;  4XIC A;  4QLC U;  3DQV C;  2P5L C;  5BMZ A;  4MQ9 F;  2QYO A;  2KDO A;  4S0H B;  3U9G A;  2UZK A;  5BOX A;  2R7O A;  4KMU X;  1GV2 A;  2EA2 A;  1QNT A;  3SZG A;  2OTJ I;  3P9K A;  1R49 A;  2DAO A;  2DA3 A;  2F5V A;  2L7M P;  2W57 A;  2CUE A;  1EH8 A;  2DOD A;  2VBZ A;  3K10 A;  2Y2Z A;  5KHD A;  3IL2 A;  1AOY A;  5E1X A;  2M9H A;  2M30 A;  5D5X B;  4BQQ A;  3GTL J;  2LOO A;  4RGX A;  2OQR A;  4RGS A;  2FXA A;  3ASO H;  1FPQ A;  4AIK A;  3DU5 A;  2WAQ N;  3CTA A;  1YS6 A;  3I59 A;  3HUG B;  3RKW A;  4LIV A;  1LVA A;  1RZ4 A;  3RPQ A;  1T0F A;  1Z67 A;  3OYI A;  2DK8 A;  1VTN C;  4XLC A;  4ZYD A;  2TRT A;  1R5G A;  2EZI A;  4XRM A;  3S1R J;  3FHZ A;  3S16 J;  4XQF A;  2VC0 A;  1KQ9 A;  2L0K A;  2LY1 A;  3PO3 J;  2IS6 A;  3G1L A;  2L02 A;  1TWH J;  4G6Q A;  4L0Y B;  3FXL A;  3HOZ J;  4A3C J;  4QIW N;  1KU2 A;  3QAH A;  3T8R A;  2YX4 A;  2QLZ A;  3SYT A;  4DZJ A;  1OMI A;  3F9K A;  4CZZ A;  4L18 B;  2X6O A;  3K1M A;  5GAG J;  3GFM A;  3BTI A;  2VI6 A;  4MLO A;  5CKT A;  4JK1 X;  1YRN B;  2DQL A;  2BV6 A;  5ED4 A;  1VQ4 I;  3BR1 A;  1IXS B;  1ETO A;  1EH7 A;  1XDU A;  1JUP A;  1QGP A;  4CA0 A;  3CCU I;  1ZR4 A;  3REO A;  2XPV A;  2VJI A;  3ZQC A;  2EV0 A;  2X1D A;  3AL0 C;  2GBY A;  3BQZ A;  3KE2 A;  4MO7 A;  1BL0 A;  1X3U A;  4BEH A;  4WWC A;  1ZK8 A;  2CUF A;  2G7H A;  1VFC A;  2Z99 A;  4YII A;  1HW1 A;  4KT5 C;  2DA6 A;  3G3Z A;  1LVK A;  3UR3 C;  2D1V A;  1FYK A;  3JR9 A;  3EPZ A;  4IF4 A;  4EJO A;  3CME I;  3MN2 A;  4GFB A;  1R58 A;  1YOV B;  4KIS A;  1PP8 F;  3I54 A;  2KP6 A;  1QVT A;  5BS6 A;  3K9T A;  4KT6 A;  1R7J A;  5TIS C;  1PUF B;  3EYI A;  1RKW A;  3HC7 A;  2LVS A;  4HWJ A;  2XRL A;  3F23 A;  3RZO J;  2E19 A;  3BQY A;  3LL7 A;  3G2B A;  3FXR A;  2ID6 A;  5EZH A;  4XR6 A;  2K40 A;  2FU4 A;  4IQJ A;  3C1D A;  2FEZ A;  4GO1 A;  2Q2E B;  2IGO A;  4UNO A;  4RDU A;  1P4A A;  2BEO A;  3OL3 A;  2BW3 B;  3T0Y A;  4EAT A;  1NG7 A;  5M5X J;  1OQY A;  1WJB A;  2OZU A;  4S04 A;  1YLF A;  5CLS A;  3VDX A;  2PJR B;  4HX7 A;  2NVT J;  5FLM J;  1TQM A;  2ZCW A;  3ZMT A;  3CDI A;  3ERE D;  3OYK A;  5H20 A;  4IJA A;  4OMY A;  1B8I A;  3IRR A;  1BA5 A;  3BZ6 A;  4HW0 A;  2B0L A;  2WAD A;  3BJ6 A;  1KU9 A;  4A3E J;  3ZQI A;  2A3S A;  3R6S A;  2HGC A;  4A3D J;  1V54 H;  4A6D A;  2DFF A;  1ZKG A;  2EPF A;  1Z6T A;  3VEP A;  4A5M A;  2E1M C;  4HZF A;  2C6Y A;  1HQC A;  2BXZ A;  1TZL A;  1YX5 A;  3ZP5 A;  4HV5 A;  4M3G A;  1DUX C;  1HST A;  1WZ2 A;  1FJL A;  1SAN A;  3DTK A;  2V79 A;  1WPK A; 
#chains in the Genus database with same CATH homology
 4ZYA A;  1WFX A;  5CPR B;  4E7J A;  3OYC A;  4BQN A;  2X1E A;  2Z1D A;  2W00 A;  5HOO A;  2DOA A;  3IAS 2;  2JA2 A;  4F55 A;  2QKL B;  1QU3 A;  3FBI B;  1DGW Y;  3H9J A;  3PJR A;  4U7B A;  2VQC A;  2W7N A;  2IGM A;  3QYE A;  4Y4R A;  3RQ4 A;  4B48 A;  4IKF A;  3S8P A;  2HU9 A;  2VXD A;  1UEL B;  3OS0 A;  2WA0 A;  4YEJ A;  3RPU D;  3PSI A;  3ZQQ A;  4X0G A;  2MC4 A;  4BUP A;  2IS1 A;  4G6T B;  4H4K C;  3BC8 A;  2ELJ A;  3IP4 B;  4RM2 A;  4F93 B;  4CCJ A;  2E1M B;  3VYU B;  2X6W A;  1G8X A;  5HNH A;  2R7Q A;  3DKX A;  3FHN A;  3CMM A;  2R7R A;  2V6E A;  3LFU A;  3ZRG A;  2O5R A;  2MD0 A;  3E0J B;  2HQA A;  1WJF A;  2L9S A;  2CV1 A;  2WB1 A;  3NWS A;  3DTI A;  4HSR A;  2LBF A;  2V26 A;  3CJQ B;  4AYB A;  3VSK A;  4BE0 A;  1X4P A;  1Z3Y A;  4LIU A;  4BAC A;  1YE9 A;  2F4I A;  4RLF A;  4ZTJ A;  1D1C A;  2AQE A;  1D0Z A;  5HNF A;  3RCO A;  2DCE A;  2W1O A;  3K4B A;  4J00 A;  4BJT A;  4NUB A;  4BU2 A;  2PJR A;  1EA3 A;  1IRX A;  2X85 A;  3OYF A;  4ITV A;  4HG2 A;  3OR1 C;  1DP3 A;  3OL4 A;  2HVR A;  4ANJ A;  1BR1 A;  4YRV A;  2R7U A;  2VJ5 A;  2JSP A;  2Z2S B;  2ZXH A;  4N4N B;  1DQU A;  3I3L A;  3LSG A;  4IQ4 A;  4BGD A;  3BCA A;  4HNT A;  3OY9 A;  3L2Q A;  2JUG A;  3OWT A;  3KYL A;  4BJ6 C;  3N05 A;  4XN3 A;  2BVM A;  1BOB A;  2RQQ A;  4HPQ A;  4XN0 A;  4XKB A;  3SEZ A;  3K4J A;  2CH0 A;  2CW7 A;  1UG0 A;  3H35 A;  2MFZ A;  2E5Z A;  3EUK L;  4XOR A;  5JHF A;  2LBF B;  3PNT A;  3AFH A;  2KRC A;  3K4L A;  4F92 B;  4RM3 A;  2WAE A;  1BR4 A;  2PMZ A;  3MKW B;  1WJ5 A;  3GBG A;  1DGR M;  2VKD A;  1N77 A;  3S32 A;  5FRM A;  4CSW A;  2W4S A;  3ONQ A;  3VYT B;  2VIX A;  5HVQ C;  2JVG A;  3AKZ A;  2GOM A;  4J01 A;  3CP8 A;  4ZC3 A;  4ZJZ A;  2X1C A;  3QOE A;  1NG6 A;  2IXS A;  3V42 A;  3OS1 A;  4FET A;  4D1Q A;  3DWL E;  2K9L A;  3K4K A;  4HEA 2;  4RLQ A;  1QHH D;  2A6T A;  3L2R A;  4BS9 A;  2FUG 2;  3DPT A;  3OIP A;  1WJE A;  2LYC A;  3OYM A;  1JI8 A;  2K3P A;  4OAY A;  3H0D A;  2VQL A;  1Y56 A;  3PFY A;  5TGT A;  3RSN A;  3D5L A;  1MW7 A;  2IGN A;  3OYG A;  2L2O A;  2V1N A;  1QHG A;  3CZ6 A;  4NQW B;  3OYD A;  4XLH A;  4FXG B;  3TBI A;  4AVZ A;  3IUO A;  2OUM A;  3SEQ A;  2R7X A;  2V4J C;  2IGK A;  2RRE A;  2GOX B;  3BG7 A;  1MMA A;  4CCN A;  2V9K A;  4P5O A;  3PUB A;  4BJ5 C;  4N4O B;  2HVS A;  3FDY A;  4C2U A;  3LSH A;  1P9Q C;  2I8D A;  4IX7 A;  4OWR B;  4XLE A;  2XDV A;  2XAU A;  3K70 C;  1D1A A;  2L5Q A;  5FRN A;  3BLY A;  1MMD A;  2WBM A;  2K9M A;  3H5A A;  3M8J A;  3QOD A;  4PSX A;  1W36 D;  2VKH A;  5CQG A;  1N78 A;  5KCM A;  2BVL A;  4F52 A;  2VL8 A;  3W2V A;  2KL4 A;  3QYB A;  2CV2 A;  4R79 A;  3D5S C;  2W82 A;  2HDW A;  3PSF A;  4CCM A;  2KRH A;  4GRI A;  2UUZ A;  4DGW B;  2XSJ C;  4BE1 A;  3OOU A;  2BOL A;  4YEL A;  3K4M A;  4PUS A;  1Z21 A;  4ZTF A;  3OIQ A;  2VQG A;  1WJA A;  2LRD A;  3OR2 C;  1Z7L A;  2QKM B;  4BL0 B;  3OYJ A;  4NNJ A;  3UNG C;  4BDY A;  3L2V A;  2F6C A;  2M3A A;  3K4C A;  1AA7 A;  2XC7 A;  2E60 A;  2JVH A;  1SAU A;  4JQF A;  4ZDL A;  5HLT A;  2LY2 A;  2ZXI A;  2NOJ B;  1U0J A;  2IS2 A;  1V5F A;  3FKJ A;  4KJZ A;  2WAF A;  3E1S A;  1X1B A;  2VQH A;  1KON A;  2IS4 A;  3OYB A;  3FBN B;  4BXF A;  4OAZ A;  2K5C A;  2VPL A;  4ZDP A;  3C2H A;  3DPL C;  3H9Q A;  3PNV A;  1T95 A;  3TL4 X;  2HVQ A;  4DBR A;  3PNY A;  2R7S A;  4PJM A;  4B43 A;  3OYE A;  2HNH A;  3QYF A;  2ZSH B;  4E7H A;  4HNU A;  3OYN A;  3ZR8 X;  4C2T A;  4PSW A;  4PFP A;  3S3N A;  2XF7 A;  1X19 A;  1FMW A;  2L7K A;  4U87 A;  3CJR B;  4F91 B;  2HPI A;  2ZFU A;  3DTE A;  1YX3 A;  2UWM A;  3DU6 A;  3HL2 A;  4XNF A;  1OR7 C;  1V5G A;  1WJD A;  4RMN A;  4E4H A;  2MAB A;  4E7Z A;  2X51 A;  3CF2 A;  2VAS A;  4XLA A;  2KMU A;  2VXZ A;  4QPO A;  1MNE A;  3L2W A;  4Y33 A;  3VWB A;  3AL0 B;  1D1B A;  3ZXS A;  2OC6 A;  2CUJ A;  4E7K A;  3ZGK A;  4E7S A;  3LSI A;  1ERD A;  3K6G A;  3H5R A;  2LH9 A;  3MKY B;  3OYA A;  1X1C A;  4II2 A;  3IAM 2;  1Z3X A;  2RNG A;  2X6X A;  4HRI A;  4XM3 A;  4D9J A;  3CES A;  4CCL A;  3SDB A;  4LG3 A;  4XMY A;  4DBQ A;  2ZSI B;  1V5E A;  4PJJ A;  2M7B A;  4E6K G;  3J7A Y;  1MND A;  1E0E A;  3K4N A;  5LD2 C;  1FMV A;  3DQV C;  2WY7 Q;  2R7V A;  2KZV A;  2KDO A;  1HA8 A;  2R7O A;  4E7L A;  3HOT A;  3SZG A;  2WY8 Q;  3RTR A;  1X4O A;  2M4G A;  3I9V 2;  2F5V A;  1MMN A;  3EUA A;  5KHD A;  3K10 A;  1BR2 A;  4P1W A;  3HPH A;  3S3O A;  4ZDO A;  2E5N A;  3A4C A;  2R4G A;  4BQO A;  4BQQ A;  4C9Y A;  2LOO A;  2AQF A;  3KEY A;  1TT0 A;  1WJC A;  3HKZ A;  1PJR A;  4LIT A;  3VYS B;  1LKX A;  3CP2 A;  3DU5 A;  3PL8 A;  3HOS A;  1OLT A;  4NC8 A;  1X1A A;  3HUG B;  4LIV A;  4B44 A;  1Y6I A;  1MMG A;  3OYI A;  3C2G A;  2CFO A;  4XLC A;  1D0Y A;  5FRO A;  1T0F C;  1UAA A;  4BDZ A;  2HZD A;  3HPG A;  1K6Y A;  4XQF A;  3H9G A;  2LY1 A;  3NWT A;  2IS6 A;  3OYH A;  1LFP A;  4QPQ A;  3H5N A;  1J09 A;  3LSM A;  2DJI A;  3W2A A;  4AU7 A;  1PYV A;  4PK4 A;  3M1C A;  3SYT A;  4HST A;  3F9K A;  4CZC A;  4NC7 A;  2VLA A;  2LRE A;  5KNL A;  2DT6 A;  4B3X A;  4MLO A;  4DJA A;  5CKT A;  2VJJ A;  3W3C A;  4PFO A;  2KQR A;  1GLN A;  3A2K A;  2KLO A;  3S3M A;  4CA0 A;  2XF6 A;  4XLF A;  4B47 A;  5LFA A;  2VJI A;  2BW3 A;  4JOM A;  4XKW A;  1VZ0 A;  2X1D A;  3AL0 C;  2M4K A;  3L2U A;  2A5W A;  1ZEL A;  3MKZ A;  4BEH A;  2DT7 B;  4Y3O A;  5JPM B;  2OV7 A;  3BCB A;  3DLA A;  1LVK A;  3UR3 C;  2M7A A;  3LMM A;  4XON A;  3EPZ A;  2CS3 A;  4CH7 A;  4KIS A;  2KP6 A;  1SFK A;  4PJL A;  2X6Y A;  3ZCO A;  4KT6 A;  2CW8 A;  3HC7 A;  3LSK A;  2XF5 A;  3K70 D;  3D5R C;  2R7T A;  3LL7 A;  3OMY A;  3VSL A;  2V7F A;  3G2B A;  4F3Q A;  2KHM A;  2LG4 A;  2L9N A;  4II3 A;  1D0X A;  3BG6 A;  4XR6 A;  3OYL A;  1W36 C;  2LC2 A;  1LDK B;  4IQJ A;  2HPM A;  1R6R A;  2Y0S A;  2Q2E B;  4BE2 A;  2IGO A;  4CUG A;  3OL3 A;  3A1Y A;  2WAQ A;  2BW3 B;  4PJN A;  4EAT A;  1NG7 A;  1WJB A;  4BEH B;  3DPU A;  2UV1 A;  3VDX A;  2PJR B;  4DOZ A;  3OYK A;  4FAS D;  4IZZ A;  1N75 A;  2Q1Z B;  4XKV A;  4CCK A;  3OS2 A;  2VJ4 A;  3DKY A;  1S9H A;  2WAD A;  4CCO A;  5CQE A;  2DXI A;  4XL9 A;  2R7W A;  3W2W A;  2M0M A;  3EUH C;  3KX2 A;  3S93 A;  2CMP A;  3DEE A;  1X1D A;  4DIQ A;  4KIT B;  2E1M C;  2CV0 A;  4XOP A;  1TZL A;  1YX5 A;  2KPM A;  2Z16 A;  3MD2 A;  1G59 A;  2VB6 A;  2MYS A;  2P0W A;  2CUZ A;  4C30 A;  3U21 A;  3HXL A;  4XKC A;  4XOT A;  4E7I A;  3TMO A;  3MMY B;  3DTK A;  3VYR B;  3HG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...