The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
98
|
structure length |
91
|
Chain Sequence |
EVDQQILLQQLKSDYRQILLSYFTTDLKEKIDKFINAVFCANIPVPEIIEIHMELIDEFSKQLRLGDLMDYRLTLIDILAHLCEAYRGAIF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Anabaena circadian clock proteins KaiA and KaiB reveal a potential common binding site to their partner KaiC
pubmed doi rcsb |
molecule tags |
Gene regulation
|
source organism |
Nostoc sp.
|
molecule keywords |
circadian oscillation regulator
|
total genus |
36
|
structure length |
91
|
sequence length |
98
|
ec nomenclature | |
pdb deposition date | 2003-10-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07688 | KaiA | KaiA C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | KaiA/RbsU domain |
#chains in the Genus database with same CATH superfamily 1R5Q A; 1SUY A; 1V2Z A; 1W53 A; 2J6Y A; 2J70 A; 5C5E A; 4G86 A; 1Q6A A; 1Q6B A; 1R8J A; 2J6Z A; 1SV1 A; #chains in the Genus database with same CATH topology 1R5Q A; 1W53 A; 2J70 A; 1UZ3 A; 1Q6A A; 1SLY A; 1Q6B A; 3L9T A; 3BJD A; 3EZX A; 3H20 A; 3IV9 A; 4X8Q A; 3WHP A; 1SUY A; 1BMT A; 1K7Y A; 1UTU A; 2PBI A; 4G86 A; 5C8D A; 1R8J A; 4JGI A; 3IVA A; 1K98 A; 1QSA A; 1V2Z A; 2J6Y A; 5C5E A; 3M1M A; 3BUL A; 1SV1 A; 2J6Z A; 4HH3 C; 2I2X B; 4M0M A; 1QTE A; 4HEH A; 2FMM E; #chains in the Genus database with same CATH homology 1R5Q A; 1SUY A; 1V2Z A; 1W53 A; 2J6Y A; 2J70 A; 5C5E A; 4G86 A; 1Q6A A; 1Q6B A; 1R8J A; 2J6Z A; 1SV1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...