2I2XB

Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
b'MLDFTEASLKKVLTRYNVALEKALTPEEAAEELYPKDELIYPIAKAIFEGEEDDVVEGLQAAIEAGKDPIDLIDDALMVGMGVVIRLYDEGVIFLPNVMMSADAMLEGIEYCKENSGATPKTKGTVVCHVAEGDVHDIGKNIVTALLRANGYNVVDLGRDVPAEEVLAAVQKEKPIMLTGTALMTTTMYAFKEVNDMLLENGIKIPFACGGGAVNQDFVSQFALGVYGEEAADAPKIADAIIAGTTDVTELREKFHKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase 1
publication title Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
pubmed doi rcsb
molecule tags Transferase
total genus 79
structure length 258
sequence length 258
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 2i2xB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2i2xB02
1E1CA 2REQB 1XRSB 1Y80A 3KP1A 3BICA 4HH1A 1FMFA 4REQB 5REQA 3IV9A 1I9CA 4Q37A 6REQA 1REQB 3KOZA 3REQA 2XIQA 1CCWA 1CB7A 3KOYA 3IVAA 2YXBA 1K98A 1E1CB 4HEHA 7REQA 2REQA 1K7YA 3KOXA 2I2XB 5REQB 1BE1A 4REQA 6REQB 4HH0A 1ID8A 3REQB 3WHPA 1REQA 3BULA 5C8DA 4R3UC 3KOWA 2XIJA 3EZXA 7REQB 1BMTA 4HH3C 1B1AA 4JGIA
chains in the Genus database with same CATH superfamily
1WPXA 1LNQA 1HE3A 4FFMA 4MW1A 4RKEA 1YE8A 1YUNA 2J32A 3WL4A 1FTGA 1XD2A 1FJHA 5HR5A 1QHHA 4URUR 3GP3A 4I50A 4RDCA 1RYBA 6NULA 3N0WA 2KMLA 4N0QA 4B76A 1GXSA 4RIHA 1D2GA 4NY1A 5J4HA 4QC2A 5IK2A 2BR4A 4E1BA 1IRIA 2O5EA 1EVLA 3WTBA 4HN4B 5JDCA 1I01A 1ZJZA 3ABZA 3TGWA 1CZKA 4BVFA 3TQCA 4Z3DA 1BU8A 1P9OA 4EHNA 1CG6A 4Q4LA 2IY7A 4HQOA 5CAEB 3ZJTA 1WB9A 3NVAA 1DBVO 3SS8A 5EWLA 4DPMA 1YF3A 4P5PA 3H7AA 2FMIA 2AG5A 1TTQB 1LJLA 3W6PA 4DNOA 4EW6A 4O29A 3SYRA 3UGQA 2C42A 5FOVA 1EBUA 4EHAA 3C45A 2OO5C 4AZTA 1YRQA 4M0MA 3EG9A 3JZFA 5F1KA 1VCNA 1U6JA 3RW9A 1FC0A 1X86B 2C57A 3BMCB 2OWDA 1QB7A 1P4GA 1GQSA 4Q05A 5ICSA 3GLIB 2CZQA 2O52A 2ZTSA 3ORHA 1N1MA 1DQRA 5CLLA 1YMUA 4CLXA 3VBCA 4J0HA 1Z3CA 2BFEB 4AIRA 1HLPA 4Q1CA 4OHRA 4UD2A 3PXGA 4BVLA 1Z82A 1CQJA 7ABPA 5LMUB 2RGGA 8ABPA 2NVUA 5DXJA 3I45A 1P61B 3VSEA 4BIMA 1K88A 5CIQA 2G5PA 3LXMA 2E5FA 2IEZA 3GBVA 4YMUA 4C0AC 1YE3A 3ZWAA 1G8JA 1L1FA 2BTOA 2WF6A 3NFRA 4MHTA 3WRWA 3NU1A 4H18A 3ZHXA 2BGRA 2JBAB 4I0WB 4BQSA 2H6EA 3G13A 3R3HA 1DEKA 3AJ8A 4RHYA 2VDQB 4QM6A 1ZNXA 2RBEA 1QIEA 1C50A 1SUCA 2TMDA 2VPQA 1G3UA 1VJ1A 1X1QA 1Y1LA 2A57A 2ORED 3G0GA 3Q3IA 3FYCA 4H1HA 1DXYA 4L9WA 3SC3A 2WUVA 1TKRA 4XEHA 2EBFX 4PX2A 1GARA 1HE5A 1Z0UA 2XXJA 4O8CA 4V0LA 5TEVA 4NV0A 4YS6A 3X43A 3D81A 4Z0HO 3W7VA 4Z4QA 3VDXA 1G21A 3OEHA 3DEKA 3I28A 5E2BA 1H65A 2OD7A 1R9GA 3MT0A 2PH3A 5U9CA 3RJTA 2VHYA 3EEFA 5LP6C 1X7ZA 5M29A 3QYPA 3C7CB 3LOQA 1DUVG 2QRVA 2FTKE 3MERA 3SC2B 5JS6A 1I3NA 2C83A 3I64A 4PAMA 4Q3BA 3UJ9A 3KETA 2QLBA 4GXRA 5LWQA 3ORFA 3SKYA 3M2TA 1ISSA 2XUGA 5LOVB 1NXXA 1UKAA 1ZN2A 2CXTA 2FDXA 3KOMA 4Y2RA 4PWZA 3ZWVA 1GAJA 1K1EA 2CC2A 2FWBA 2JATA 2R44A 3EDOA 3TIFA 1BWSA 1SUPA 3EPRA 1XTPA 3PUYA 4RGYA 5D1HA 5TRTA 1LNSA 1T6BY 1AKRA 2HAEA 1RJEA 5EE1A 4KPYA 4O4JF 4RIIA 3UK1A 3B6KA 1WB5A 3HXTA 2Y1CA 3S1AA 2FAXA 1KK3A 4PQRA 4JL6A 4TVBA 3OQHA 2GM5A 2ATCA 2CCJA 2I2AA 3V4FA 2IVZA 4AF8A 1A9TA 2PD3A 4IV5A 2REQB 3HB4X 2QD5A 4DWWA 4G23A 3SVZA 2G4LA 4AC9A 1SVSA 3DFIA 2G9RA 1TMGE 3DZFA 2OQRA 4B3SB 4DB2A 1PF7E 4D9BA 4FFPA 4IIHA 1J8DA 1JG6A 3DA8A 4KMSA 5ECYA 1NP7A 1XUOA 1J2RA 1F6BA 1KTVA 3AR8A 4J0IA 2NUBA 1DEAA 1QWSA 1XZDA 4D9CA 4HLQB 2F1OA 4PHTA 3F2VA 4DWOA 1T2VA 3ICOA 4K26A 3WDSA 1TRKA 3ISVA 3LDGA 1LK5A 4TKLA 1OD6A 4REQA 2FUCA 3R3SA 2CVHA 4A4DA 5KWIA 2WUWE 3IHWA 4N49A 4M8NE 2A0WA 1GZ7A 1SUAA 3VPGA 1YNSA 3U37A 4R01A 4TSRA 1KP2A 1SVWA 2ECOA 3LI2A 3OIVA 3FKSA 1ENPA 4TUYA 1V3QE 5LYJA 1BWQA 3NP9A 1GPNA 1ZIPA 3LH5A 4JQYA 1YFKA 2GARA 4RA6A 2G6TA 4N0EA 4LNHA 2GZSA 1EUDA 2J7PA 1WQ1R 1LPMA 3VH2A 1EWKA 2X5JO 4UW9A 1E18A 1G6Q1 1JJAA 3ER6A 1WUIS 2VAMA 4ZYZA 1SUBA 4M8LA 1V16B 4KFCA 1E5VA 3AVYA 1NVWQ 3ZX5A 2OGSA 3V2UA 2GCOA 1CP3A 4RZ2A 1CJKC 4LJ5A 2GDJA 3GUZA 2OO5A 1NT4A 4QKQA 3DDSA 3OBIA 1C3OB 3IEVA 5IBQA 1QCZA 3QOFA 1RWMA 3RLFA 4BNNA 1EFCA 5BMVA 4IIGA 4HHEA 4BE4A 3H7IA 3F3SA 2ZETA 2OFFA 2NG1A 2Z1MA 1OOEA 2NX2A 1OKKD 4PCAA 4JKOA 1JKFA 3CQ9A 3OZWA 1RWPA 5H80A 4Y2HA 3OE5A 4KRXA 2LW7A 4AI6A 2YOFA 5HIIA 3A2LA 3KR0A 4JBWA 3W5SA 2QMZA 2XNKA 4UQPA 5EWJB 5KYWB 2BGLA 5EXTA 2R5NA 4G5GA 4F06A 1WUYA 3GEBA 2QTVA 2PL9A 3L6UA 2P2DA 5C4IA 2CDRA 2G80A 3ENZA 3GLHB 4U7TB 2HN9A 5FOQA 2I4IA 3HV0A 1SB8A 2YXDA 3HVUA 3P2IA 2DXIA 1C4XA 2BMWA 2XUQA 5ALGA 3RTDA 4M0KA 4LWZA 1QZXA 4FR5A 2J6CA 1VHDA 5ALLA 2HXSA 4CEJA 3WI7A 1XWWA 2KB0A 5IDYA 2RKBA 5LA6F 3CC8A 2GEVA 5CFOA 1WOMA 4R2WA 1VSUA 3PNOA 5EPUA 1CNMA 3B52X 2ZBFA 4QTTB 4CT0A 1G21E 1T5LA 3CSUA 4LV5B 4DKJA 1OASA 3V4RA 1EE1A 2XZTA 5C8VA 2JGJA 2N0SA 5GOZA 3VPXA 5MGBA 3I5MA 3IX7A 2AXPA 2FN4A 3KV1A 1A2BA 3GBSA 5FYQA 1VL8A 3EQ7A 5LP6A 1KVRA 1F48A 1RCTE 2XQFA 1UDWA 1ZH0A 3SQMA 2Y4OA 4HX9A 3VR5A 3WNBA 1ACLA 4B7ZA 7REQB 1ZUD1 4D0RA 4A8TA 2X40A 4BO5A 3ETLA 1M2GA 2X8WA 3WNDA 2A9RA 3BIOA 3FBTA 3NGMA 4TYWA 5JIBA 4Y0NA 1JZTA 2ZUEA 3P2MA 2ZIVB 1NSTA 3IOEA 2VLIA 4BJ5A 4HF7A 5B1YA 4GYYA 2BPOA 1IEWA 3LVBA 2NGRA 3DLTA 3PQEA 3FJOA 4R6WA 2Q4BA 4HQKA 2IX9A 5AKXA 3OLQA 1D4AA 5JZ9A 4G65A 1I4OA 1A27A 3C8UA 1II8B 3STHA 3I76A 3TVYA 1PGNA 1G7SA 2FKAA 3RAPR 4ZI3A 2J6HA 1MB9A 4X95A 2YYSA 4FFBB 1K7XB 2HT6A 2W70A 3WAKA 2D0IA 3FGNA 3JYNA 1YJBA 1GL7A 3DZHA 3FR8A 2D5LA 1GZUA 3FTNA 4Y8VA 3LUHA 2QRUA 1RP7A 2HPHA 3O2NA 1LLQA 2G17A 2Q46A 4UBMA 4X1YA 2XD9A 4MWSA 2IODA 1SEVA 4F5DA 1E58A 1WUJS 1TZCA 4PSDA 3TM5A 1OYWA 1U5CA 3BC1A 2PXAA 4ZAYA 1L7RA 4JI6B 4NOJA 5KYKA 1G42A 3EXAA 1A7KA 1H2WA 5EQJB 1E3IA 3HP4A 1QIMA 1ZPDA 1QAOA 2W6OA 3LQ4A 4MINA 1GRCA 4G1VA 5L4LA 4W5NA 1LBQA 1NIJA 1PQYA 1DTSA 1HRKA 5HCNA 2ZB4A 1LBIA 4RV9A 1O97D 3EFHA 1I2BA 1SOVA 2X15A 4LVNA 1GAXA 2N42A 4EQ6B 4HATA 5F2KA 2BMJA 1TKBA 2NSLA 4PC2A 3ZWKA 4EO4A 4HDMB 3B20A 5GIOE 3QKUA 4R2KA 4PC1A 5A04A 4B2LA 5GM1A 2GYWA 2E4XA 3N5CA 3VXKA 1H94A 2ZAGA 3AHCA 4Y2UA 1KIAA 3OO1A 4LF7B 1RJ9A 4KEAA 3QXSA 3ZW7A 1ZM7A 3I52A 2SNIE 3LMKA 4KC0A 1BHJA 3VQTA 1TO6A 3QFRA 3MWGA 4EMBA 3W0LB 2VF5X 3P9XA 4X60A 2H7CA 5JSFA 3BUSA 3LP6A 5FI0B 4K0RA 4CGZA 4CKZA 1VMIA 5JUWA 3MZ0A 1J5PA 1JFVA 3GLVA 4I36A 1O9HA 2Q2WA 2JDID 1SUSA 2VTVA 2WM8A 4ZEVA 2HEIA 5I5EA 4NH4A 4XSVA 3DYIA 3HS3A 3N7UA 3C97A 4ZU3A 2JIQA 3KSRA 3Q1LA 2WFLA 3AVOA 3QX8A 1CVRA 4YRLA 4GHWA 4D5EA 1RCFA 4HPWA 4ETWA 4DCMA 3GFQA 5AM4A 2AC4A 4HJRA 1Z6PA 4E21A 3HYLA 2Q6LA 4KYUA 5T4FA 1JG3A 3F3YA 4I1OA 1MFPA 4UTXA 3OU6A 3LY5A 3WZLA 4BMPB 3FMVA 1IAVA 1Z68A 2JLCA 4BB0A 3H8WA 3IP1A 4Z4CA 4OD0A 2P62A 2ZJ5A 1ZD2P 2VI5A 3GMIA 2WF9A 4CCYB 3BEDA 1WD5A 1EDOA 1BA3A 3EY9A 1LU9A 4JJ8A 4K40A 1JKXA 3D6MA 4LDAA 5AI5A 4DJFC 3VYTB 1CZLA 1C4OA 1T2NA 5KX5B 5IM4F 1GKIA 2AW5A 1E1DA 2M6RA 2FZEA 4XDZA 2XNSA 3KQTA 3EF3A 4V0KA 2R47A 3DXYA 4CXMA 3PTLA 1O6GA 1PLLA 2QRGA 2ZTMA 3U3RA 2IU3A 3U6KA 2LR0A 4G24A 2BFPA 1KP9A 1T4CB 2PVPA 3C87A 3IUYA 4MWEA 4LG1A 5CK4A 3HXOA 1KKUA 1JB9A 2BFNA 4ID3A 3LG2A 3R76A 2ZBRA 1ES9A 2OHJA 2RHOA 2AHRA 4JLSA 4P8RA 4KBGA 4ZCRA 1Y9JA 4LC9A 2BP7A 4MEBA 4OQEA 4PNPA 1NXOA 1T5TA 3N2GB 4DLSA 4ML3A 1NN5A 4KNYA 2B61A 2CXXA 2XUIA 3DC2A 1PNOA 2QN3A 3KB1A 4BO1A 1QH8A 3BXZA 2YRFA 3LV8A 4FKMA 1WWKA 2QHXA 1EX9A 3ELWA 4U00A 3OFSA 5F21A 3EMKA 1FUEA 4JYBA 3IUEA 1NU8A 1K68A 4YFYA 3WGMA 3TQIA 3VU8A 3LDUA 1T4BA 1KKMA 3QGMA 4BMXA 5CA0F 3OESA 1RXUA 4IOLA 5DMXA 1F2TA 1S8OA 3NT4A 4I5DA 1SOAA 1XN1A 2O57A 3WLEA 1E79D 2HRRA 3BK7A 5E7IA 1VI6A 4INJA 1I3KA 4KQEA 4P7JA 4EG0A 2R8OA 5THQA 1LK7A 5ITWA 2G5GX 2LDXA 4NPCA 3ZJ5A 3AF4A 9ABPA 1IY2A 1N6OA 2J5XA 3W04A 4FUQA 1OH8A 2UXDB 2XT0A 1J1IA 4U7JA 1XZMA 1SR8A 3D6HA 5BPHA 1CEEA 3C6ZA 1U7XA 2K4MA 1XCOA 2OBBA 3A25A 3G5AA 3S7TA 3WKAA 1DC8A 1XF1A 1YQWA 4MR7A 3QMVA 3G8BA 4BNWA 4D42A 4DDVA 2QPOA 3FAKA 1FRFS 5TV2A 1H8HD 4YRKA 3W2IA 4LYHA 4DJ5X 3EZ6A 1NYQA 2QMOA 3SJCA 4TV8F 2IYYA 1TDJA 3DNFA 4IZ6A 3RS2A 4FCVA 5T7BA 3AHDA 1MXHA 2OM2A 5K0GA 1ZK1A 2D7DA 1E7QA 3LGAA 2DUWA 3JTEA 1TNDA 2PT5A 4A2CA 2ZQZA 4CIXA 5B4TA 4M0CA 2GVZC 3PLAE 2OVFA 2G9QA 2A5DA 5ELXA 4UAGA 3B53X 3R6LA 4URYR 2AGVA 2DBQA 2G9NA 2E21A 4C0JA 1YR7A 4NU0A 5AW6A 1WMDA 4O5OA 1WOYA 4H4DA 1THTA 3RUEA 4RDHA 2H1FA 2HUPA 4EH1A 3DD1A 4QOHA 4WT7A 3L0CA 1SCNE 2BMVA 4ZCLA 1QFJA 2CMKA 2WP0A 4L78A 4BOYA 1PGQA 3H11B 3GHYA 4ALMA 1FFYA 2P4EA 4YP9A 1H6DA 1H4VB 1RFLA 1JPUA 2CNWA 3A4IA 1D04A 1U0LA 3BRSA 5HQ3B 4MIEA 3ZDEA 1ICEA 1VIDA 4DCSA 1EGMB 3DKVA 2Q1XA 2OILA 1T6XA 5G0TA 2XNDA 3RYHB 3GFSA 3PB3A 3QYAA 4LUCA 2WWIA 2FEPA 4J7CA 1OYVA 4KQ2A 2CKMA 4HG2A 3B1ZA 1MENA 1C1DB 2V74B 2QZJA 1L9KA 1PK8A 5K45A 4I66A 3SQLA 4MV0A 4I9GA 1RHUA 2XQVA 3EWAA 4LGMA 3PVCA 1BCSA 3DEAA 2IF2A 1EQUA 3DDOA 3L6BA 3L0YA 4G2TA 4IZOA 3T1NA 2J33A 1Y82A 1QZUA 3ZGOA 2JHAA 2J9RA 3OZEA 4DCNA 1GAQA 2OD2A 4JYMA 1GGJA 4RZUA 1B2RA 1Z0AA 1SMKA 1KSGA 4Y6QA 5KSPA 2PO7A 1GQYA 3ZHRA 4JVNA 2CLMB 2GBLA 2GO7A 3GT7A 2J4DA 1JQLB 3LIIA 4RAOA 4TN5A 4E4YA 5KTKA 2P4SA 4RLHA 1I2DA 1EPUA 2IDKA 2WOJA 2FMTA 2YHSA 2DFTA 2WP8J 4HDNB 4MQ6A 1WXGA 4OFZA 4V2UA 1X80B 3C2QA 3FPBA 5AW3A 4P3KA 1J8VA 2PGNA 3BT7A 2I67A 5CT5A 2ZB2A 3VKUA 5I47A 1VE1A 2ZRJA 2XOEA 2XTZA 3UFXA 1F5NA 1K7FB 4PC7A 2EJVA 2GJSA 2XDQA 1HG0A 1ZGGA 2P6PA 5B3KA 4YT2A 2NO9A 1BROA 4MUYA 5I9SA 2CNDA 1UPFA 2P9BA 4PLCA 4F46A 4GRIA 1SVKA 1FYEA 3JARA 4PAWA 5FV7A 3WHPA 3PQDA 4G56A 1MLDA 1RHMA 5DV9A 1MH1A 3X1WA 4B6RA 4F7WA 4JSRA 4J43A 3G0OA 4LJYA 4PYLA 1RRPA 3AVVA 3ZZ1A 5AW7A 1TU0A 1NMZA 3QI7A 1XAGA 5K3AA 1PWHA 5KJ6A 4OJTA 1SVLA 4MWCA 2Q3HA 3AZOA 3FPEA 1ATZA 4LC1A 2XVYA 1RQ2A 4M9SA 4ZYYA 5LJIA 2FP3A 1LF0A 1GN8A 1N6NA 1Y7PA 2HMYB 2ZXEA 3I8SA 3LK7A 5K0LA 4B47A 3KS9A 4BPRA 5BR8B 2QZ4A 3OIGA 4HLDA 4BIIA 5C2JB 2W2VA 8MHTA 2ZTLA 2ALJA 3B9PA 3TJRA 1GZ5A 4WIAA 4PW0A 4E5SA 5P8WA 1ZK2A 1VIVA 4FLFA 4XWKA 1RT9A 3I58A 1SFRA 1RPZA 1VLQA 4LRYA 5ADUS 5HX7A 1ZIYA 1G8SA 2VO1A 2RJNA 4H1UA 3W9BA 3PQ3A 1NG1A 2EBUA 3FVQA 1LVGA 4MYTA 5EHNA 4K28A 4MEAA 3VPHA 3QPVA 4HAYA 4LHSA 4B1FA 3ABRB 4B73A 1YWGO 2Q6TA 2AZ4A 3CNLA 3EXG2 3G88A 2E48A 3OO0A 4HS4A 5AHKA 4Z9AA 1T6YA 1QH1B 3BB4A 2QZPA 5K3BA 3WGIA 4L8VA 1BH6A 1YC2A 1AK9A 3CWQA 4RADA 3ZDDA 2A1UA 3HB7A 4PS1A 4BNLA 3CLRC 2BEVB 5JADA 3GJSA 3IBSA 1GSAA 1ZNQO 4QNRA 2IHKA 2BE9A 2VQFB 1CYEA 3F46A 2ZWIA 4GU5A 1NRIA 5AKGA 5EFOA 5L3QB 1ITZA 1JAZA 2ERCA 1IATA 1ISFA 1U7ZA 3OE4A 4P82A 4D4KA 3VBEA 2E4WA 5MFPA 1ZD5A 5I7UA 1AK1A 3FDIA 4URXR 2Z56A 4RL6A 2YWEA 2C4MA 3UQZA 4EPVA 4YMTA 3WIUA 2I3AA 4AWXA 2OAP1 4BMNA 1SKQA 2GA8A 5HDBB 3ZD8A 3EZLA 5J58A 2H54A 2GR9A 2WIJA 5G0UA 5HJEA 4WOPA 3WGLA 4A73A 4QT0A 1E2UA 4ZCSA 3GPLA 3E3OA 4N6OA 2YMLA 1JDUA 1US8B 4PVCA 1ZNZA 2PN1A 1QONA 5DNDA 3G02A 3TIVA 1EIWA 4HMQA 4OBEA 3PKZA 3WADA 3MTIA 1Z88A 3ZWYA 5DLPA 4D96A 1JZSA 1HBJA 1UXGA 3B70A 3UIEA 4QZVA 1NY5A 1Z25A 1AMUA 3ZCXA 3HMQA 2J9ZB 3HCAA 1MD9A 4IBOA 2FEOA 2VDWA 3G89A 4XD7A 1ZMXA 3O73A 3IALA 4BEBA 2F3QA 3L8MA 1G3MA 4G8BA 2QTAA 2VA8A 4FI3C 4IH9A 2XRMA 4JT8A 3TEJA 4CV0A 1NLYA 4GOXA 3SOZA 1CK4A 1WCV1 3EXEA 3GFFA 3C5WP 2ZYIA 4GPAA 3UMGA 3K70B 2CGEA 3TJMA 1UEIA 3F1LA 3QTTA 2FLKA 3SXUA 3ZK7A 8AT1A 3HR8A 1XCGB 3DLBA 5DN6D 3S5UA 4B4OA 5IVKA 4KO2S 2NUPA 2W2LA 3E9EA 3EF1A 5IXJA 4NYJR 1VXRA 2WV9A 3C7DB 3USES 4P4GA 2X1MA 1LSSA 3QM1A 4FYVA 4B9AA 2F64A 1N5RA 3AP1A 3V4VB 1TZMA 1YB4A 3Q0EA 3FYHA 1DOAA 1BRMA 3AG6A 4RVUA 2EVWX 3GARA 5AH0A 1VFNA 1BE8A 4Z51A 1I5OA 2XE7A 3R0JA 2LRHA 1X6VA 2QRKA 4GZ3A 1K0FA 1UBSB 3S70A 1I32A 1E3WA 1TOAA 2CHFA 4M1QA 3HKCA 1SIBE 3G6KA 1YQ9A 3NBYC 3AFOA 2IHNA 3AX6A 4ZYWA 3PEVA 1UK9A 3RU3A 3K5WA 4QUIA 3U40A 2AE1A 3UMBA 1YMQA 3AUTA 3ZKWB 5C52B 3EMDA 3H2KA 3SP1A 3TTTA 1OWNA 3RKSA 3CCBA 1CJBA 4U2FA 1RTKA 3E53A 3Q3JB 3IQXA 3NT5A 3O8CA 3AJRA 2VJDA 2WHYA 3KNZA 1JB1A 3S0JA 2CDBA 2H5IA 1F0YA 3QU4A 4QREA 5KTTA 4QGFA 4BX3A 2R6ZA 1HYBA 4HAVA 1QMPA 1KFBB 3ORRA 2H11A 5DT2A 4GI5A 3VR1A 5I4IA 2IU4A 4FIDA 3OJEA 3M49A 2O2EA 4JYZA 3GJ4A 4NHEA 1G38A 4YDRA 3BXXA 4A0QA 5CYPA 1OGIA 1GZSA 2XMBA 4EEZA 2QZSA 5HZHA 1R8SA 1AH2A 4PRLA 3EX7C 4Y6RA 3QPCA 3TE6A 4G0YA 5D87A 3TAUA 4FX5A 3A1WA 1HEUA 3WJ7A 1NT2A 3PWKA 4KXLA 2F43A 5TMDA 2H8GA 4FZVA 2L19A 1BQ4A 1EJ0A 3O2SB 4UPDA 5KYNA 2HDHA 2O2HA 1TVEA 2Y8EA 3LUPA 4EB0A 4NU8X 4ZU6X 1JL3A 4EA7A 1PEDA 3IS3A 1PU2A 2NQ8A 1E9DA 4KJZA 3D6VA 4MKRA 3TK1A 5KVSA 4GPTA 4JLBA 5C3MA 1YIDA 4JN6B 5FTNA 3ROEA 3T3DA 3U62A 4GKVA 3VHRA 1VRWA 2QPTA 2AE2A 3H5IA 2TYSB 3D7MA 3CNHA 4HD8A 3T1QA 5K8JB 3SDBA 4KQHA 1G2QA 2CLOB 4IJKA 2X8JA 1K92A 2IW3A 2QD3A 1W9HA 3DLAA 4XSHA 5A62A 5K6TA 5L40A 2BGMA 2C7VA 1S2LA 5EIBD 1ULTA 1WX1A 4YRSA 5KCMA 2R84A 3WK7A 2NADA 2VS1A 5JATA 2YWGA 4IZIA 2HQRA 2B1JA 4KPUA 1EESA 4MQEB 1P74A 1N3YA 2YWHA 3LUBA 3BHNA 5BVGA 2P7HA 1NV8A 2XMPA 2B5OA 3PFBA 2J0VA 1F14A 2IIVA 4UUOA 4QNNA 1CUGA 4RS4A 3ZWNA 1R64A 2GEBA 1OAKA 5I7SA 2CXSA 1RU3A 3NHFA 3PJFA 3DZBA 2HTEA 1VOTA 4RWZA 4BTEA 3W5HA 1CWUA 1SO8A 2Q3DA 4E2FA 2EHJA 4GICA 5CW2A 4AN4A 1P6UA 4O4JA 4ZANA 1HOXA 3BD9A 3L0SA 2QD4A 1SUEA 3PQ2A 3WLKX 5E3HA 3DZIA 1O77A 3GX1A 1XAJA 2ZE7A 2XIQA 1F8GA 4GO1A 3HA3A 1L3IA 4JASB 4TWJA 4DXHA 2DH6A 1JR3A 3NPMA 3ACCA 4CI0B 1Y3IA 3JPWA 4F1KA 4CU2A 1PJ8A 1H0RA 1RTTA 5AKJA 2RB4A 2GN0A 1IY8A 4D9MA 1X9IA 2R60A 2WW8A 3H2JA 2YOHA 3C6YA 3KVYA 3L0BA 4V3CA 3WQBA 4C76A 4K5QA 1EP3B 4BXOB 1S8NA 1SXGA 2NZYA 1QK5A 4R2JA 1B1CA 3T4EA 2AVDA 1WB4A 2R86A 4QOGA 4V1CI 2GM4A 3PS9A 3NIFB 3SBXA 3DDCA 3CHYA 1PHPA 2JARA 2XIJA 3OPQA 5K5EA 2R68A 1H69A 3BGOS 1GUZA 3GAZA 4S35A 2OKCA 4BDSA 4YRIA 3PC6A 4TXNA 5IWCA 2QV7A 2DETA 2CCGA 3QJYA 4XVQA 3GOQA 5FLYA 4M1EA 2L0XA 3CSDA 4NQZA 2MYPA 1A9YA 3GJ3A 5FR1A 1VCIA 2Z5LA 4F3KA 2GKSA 4P53A 4Q9HA 2PX0A 3UJ6A 2PUCA 4YJHA 4F6CA 2QM0A 2BIFA 2PAAA 1FX1A 1TU3A 2BI8A 4XVRA 3I12A 2QVBA 2A5LA 2YJTD 2YN2A 4J0EA 3SK0A 2YZMA 3UHAA 2QL7A 3UY4A 3EW7A 3VHXA 4DCCA 3BSWA 1W44A 1UL1X 1WRBA 4JAVC 2WQZA 1Q83A 1M9NA 3NKVA 3LY8A 1OH7A 3RSLA 3P27A 1IN6A 1HXHA 3FNEA 4B83A 3U16A 5DHPA 1P2BA 1KZ7B 3DZ8A 5HTOA 1UXHA 3VR4H 2DVMA 4RETA 1N3LA 3DTVD 3ZGXA 2PQ2A 1U8XX 4QXPA 3O84A 5AVKA 4UUMA 1JAXA 2GBIA 2I5PO 1XVTA 4C4AA 1HNWB 3ZZMA 1OLUB 3I92A 2YW2A 5LD2C 3NVDA 5K0NA 1A8PA 5CNKA 3H1BA 2WVHA 3MINB 3ABOB 3BWYA 2F9FA 2PX6A 3BSFA 4D8XA 3A31A 1X8KA 1ZGAA 3SY8A 5CTJA 5DGTA 5GZ6A 1G3IA 3SGLA 4IH1A 5I8PA 2QLTA 1NA5A 4X84A 4A8HA 3RUCA 3GJRA 1HK7A 2ZG6A 5FUBA 4JY7A 3SQNA 1KWGA 3FNRA 4YH1A 1T9GS 4MMYB 1JEQB 3LT0A 4ZTBA 5THXA 4B71A 4RPJA 4MWBA 4K7JA 1YA4A 5BQXA 3ZY5A 1A77A 1RZRA 1KRHA 3M6UA 2C2OA 5A9TA 1SA0B 2HCBA 5CEJA 3AKEA 1Z2DA 4ZD6A 1X1RA 2QP4A 4ALIA 1XVUA 3EAFA 1NSFA 1SQ6A 4YRCA 4FYWA 5LZ7A 3IVCA 3UAYA 3DHYA 1X0VA 1E98A 1Q1ZA 3FAZA 3HEMA 5LA6A 5DDIP 3WHIA 2C96A 2PSFA 3WICA 3HCOA 2CBZA 4RTPA 1O94D 4QRDA 4HTAA 1MBZA 1GNRA 3HB0A 5B3LA 1T5OA 1ZX1A 2PSHA 1XTIA 1ZAYA 3W5IA 4ILKA 2FN7A 2RGXA 1YQEA 3ICCA 1L8OA 3IB6A 4ZVSA 1OGJA 1L4FA 1P9LA 1SZPA 3GGJA 4Q00A 4RPKA 1G64A 5JVDF 2ZJ7A 3H2SA 3IXLA 1QB8A 3TWOA 1HA3A 4RHCA 4BLOA 2AN3A 2WUDA 4KSCA 4BX9A 2HJHA 3CVOA 3IKMB 3V46A 1C3XA 4AKGA 1N2OA 1YZ3A 2V7QD 3GCZA 1QGDA 3WNZA 2QBYA 1Q92A 4G09A 1O57A 1G5RA 5AWFC 4BLTA 3QV2A 4EHIA 1RPNA 4B81A 3DV0B 5AI4A 2C58A 1IZ7A 3NDPA 4MPJA 4TRRA 1RAHA 1U4OA 4JXXA 3E9QA 4F8JA 2NM0A 2V6IA 4QPJC 2EJUA 4D3FA 2I22A 4OM8A 4ZT7A 2HGZA 1XNJA 1JSLA 4EG4A 2GZ3A 2VHVA 1MG0A 2GK4A 1PAUA 4X6YA 1F0PA 1L8XA 1U3FA 4AVYA 3RGWS 2V54A 4WK2B 1ULHA 1U80A 3NNSA 1VM6A 5A4IS 4LJ4A 4AS2A 1AE1A 5E2AA 2GNAA 1NV9A 4UC0A 2XB6A 1AHPA 1XJ0A 2G07A 1NZDA 2B1QA 3AGPA 4I1IA 1QIGA 2GZDA 4XPZA 3SHWA 4IIDA 3WBFA 1QG0A 5LLSA 3VR4A 3T5AA 2NTYC 2PBRA 1FF9A 3Q9SA 4Q3AA 4WJZA 2QQGA 4IM7A 1I30A 3KUXA 2PWBA 4N3AA 1E20A 3KOUA 3BDAA 3KWMA 4TT3D 1Y3FE 3C16C 3PD1A 3W5VA 1O97C 2FUNB 3K8OE 1UEXC 3TQFA 4BN5A 1BH2A 3PNPA 2Q45A 4QYIB 4RVGA 4B6QA 2VP9A 1S3FA 1IY9A 4H6VA 4L7VA 3KWLA 1CXZA 3BOSA 4FEEA 4DVJA 5HOEA 1F5SA 4FDAA 2DMRA 3WX0A 1Y6ZA 3G0DA 3K3PA 4EYEA 1PT5A 1XZFA 4UNSA 3T5BA 3THYB 1JBKA 4AUNA 3IUJA 3LX4A 4NDZA 3M6LA 1TLLA 2IYAA 3PC8C 5ED0A 2D2IA 1WHSB 4OUDB 4X93A 1GGEA 4B3HA 2ZXUA 1VMDA 2C3MA 4BMYA 2GVDC 5F2NA 1LK0A 3LLSA 4M99A 1KRWA 3ILHA 4QPNA 4EO7A 1RMYA 4A8PA 3B51X 5HILA 2XGMA 2I2XB 4FDTA 4AZ3B 2R87A 4C05A 3O3OB 1OKKA 4KR0A 3CBQA 3UHFA 1R16A 2GN4A 4NRDA 1K3FA 4TVOA 4DCUA 3IEMA 2IHUA 5LXTF 1PKXA 4DKXA 2OK7A 3NOVA 4ZZIA 4DV0B 3HE3A 3FMFA 3DKPA 4JFRA 1K3TA 4DQKA 4OHWA 1PV2A 3R1IA 1DC4A 4DMFA 5J9FA 1N2GA 2HHJA 3BQNB 4FGUA 3EDYA 2IPAB 2HBZA 3FFXA 4BQIA 3VJKA 2G70A 2JIPA 2CYAA 2ILTA 1NHWA 2YJ6A 3ZS8A 1FNCA 1XELA 4S12A 4HB4A 5D5HA 1N1DA 5UKDA 3R7SA 4GBJA 3WFIA 3ASVA 1DPGA 4JB0A 4J1SA 4CKCA 3N39C 4DLPA 2D8MA 1WMSA 2PR7A 2IZ7A 3HJBA 2C4HA 3TCNA 2GFHA 2Q3MA 2WJYA 4GGPA 4KK3A 2F6RA 1XZKA 4EHLA 1NX9A 4E5UA 1KFKB 5JRDS 2YUIA 5DXAA 3UPUA 2XZPA 5DHTA 4MS4A 1DARA 2R2AA 1Y6JA 4XW2A 4HGRA 4I4CA 4NYJQ 4WAUA 3T35A 1F7UA 4YQFA 1AVTA 2FPGA 1CQJB 3ESDA 4JOBA 4LWQA 1JLHA 4MUNA 2NVUB 1MKYA 4C7OA 3KUKA 4FEGA 2LTAA 3TDKA 3CRQA 4LVOA 3ZGNA 4YRZA 2VPZA 3VR6H 5KPJA 3K9LA 2ORYA 4B7AA 5M34A 1D6MA 1TCAA 4ZAXA 1DRVA 4C6RA 3GJYA 3P9ZA 2OL4A 2X8BA 4W9NC 3FZGA 2RG1A 3PHLA 4S04A 2NU8A 1NWCA 1H6CA 5CA0A 3DDWA 5HFNA 3GT0A 4PAQA 4ZGBA 2YZ7A 4D56A 5CYOA 2P5UA 5HZGA 4X61A 2B7CA 2LZ0A 1JAYA 3CSSA 2JIDA 3DBOB 1UWVA 3LCUA 3QPDA 4ZWNA 1RYHA 1XXHA 3T7DA 1X8JA 5BMOA 1KFEB 2JFGA 3H9BA 2XCIA 1NUTA 2JJ1A 3WS7A 3ZLBA 4B79A 5JRZA 5KTOA 3C5CA 2YVQA 1G21B 4IDPA 3PFFA 2GN1A 4B45A 4LMRA 1FJGB 5TXGA 3RYCA 4IVRA 5AUOB 4BNVA 5LU8A 5MFZA 1EJBA 2ISSD 4OEHA 2I1QA 3L41A 1X7ZB 2ANCA 2QNRA 2W2KA 3GRUA 4KACA 4M87A 6LDHA 2I80A 4NMWA 5EI5A 2IHBA 1DADA 1T9AA 4UM8B 1RIIA 2Y0DA 2QN2A 2PLNA 1UBFA 2WJAA 3CZ4A 4M49A 3ELUA 4ND6A 4YJ3F 4CW7A 3LWDA 4DJAA 1MR3F 3VYVA 1M5RA 3N6RA 1UDBA 4NIMA 4LNAA 4TXLA 5ALQA 4GM1A 1GQRA 1FUIA 4ROSA 4U7WA 1QFYA 3S1AB 4KLAA 1SOMA 2QIPA 1L4BA 3UJAA 1PDWA 2C3YA 4IGKA 2F3TA 1FB5A 4PHHA 1T1GA 3L46A 4D9NA 2FSVC 3KBBA 1HZJA 4XB6B 5E9QA 4E0BA 1Z6YA 2WWRA 4MUHA 4I1YA 4RW0A 1MCZA 1PX2A 1MMFB 3PC8A 1RWWA 4O1HA 2APJA 2QRPA 3K0CC 4BP8A 3JPYA 2CBGA 3U3OA 3MWEB 3COJA 4LXIA 4F1WA 3FVVA 4TYPA 4COOA 5DW3A 1KY3A 3JRXA 5HMMA 3KSAC 2A9VA 4LFCB 3ENNA 1OWMA 3D8TA 3PGA1 4FU0A 5JY1A 1Z18A 3CF0A 2ZIXA 3D4LA 3R9KA 1RLJA 2JKVA 2OV2A 4ZCMA 1MJ5A 5JCJA 2AG8A 4RV4A 2EU8A 1FU4A 4MJ3A 1FDUA 4WDQA 1FXSA 4V0ME 5HCIA 3IDFA 5EXSA 2E7ZA 2KX7A 4HGNA 2R96A 3LNCA 4KV7A 3WGJA 1NBIA 1Z4KA 4BTVA 2B7LA 2VK1A 3FZNA 4TUYB 5JBNA 5LYJB 1CY2A 1U98A 3L7BA 2HB6A 4RA6B 1CY8A 3PT9A 5D86A 1LDEA 1A5AB 1EUDB 5EIWA 3ZJYA 2H1OA 1JT9A 3R5KA 2M6LA 4MP3A 5L4NA 3V7FA 3H1EA 4K2HA 5ALRA 3VR6A 4AJNA 2J0SA 5CLJA 3KZMA 4K9DA 4CCWA 1MP0A 4ZQIA 3OKCA 2GCOB 1U2QA 2ATXA 4N4AA 3V55A 2OUIA 2VR1A 3L1UA 3IAM1 4JEUA 1QGYA 3QFSA 5CD9A 4JI4B 2PH7A 3RBZA 1TX4B 4QHSA 5CR9A 1UWLA 5CT8A 4RCYA 3ECCA 3RYIA 1ZH6A 4YAOA 4Z0NA 4E08A 5BMVB 1U1GA 2X6QA 2JI6A 3BWXA 1GCOA 5LFAA 5IEBA 3K0SA 2DTEA 1R3UA 2D5CA 3E9NA 4G8DA 1XQ6A 3UXYA 2NVOA 1T9KA 4FGKA 1PIWA 4UUPA 4V2IA 4R8SA 3W3AD 1OWOA 1WHTA 4KYVA 3W5JA 3ZCUA 5JROA 3HTXA 1TUEA 5FBZA 3QVMA 2O8CA 5AVQA 3HYTA 2WIKA 1Z6QA 2Z2JA 4JROA 4DS3A 3W79A 1X77A 2BRUA 3KLNA 2AUNA 5AW2A 4F6RB 2ZIGA 2H8KA 3FOAA 3KUCA 5AHXA 2QTVB 2O2SA 5DLEA 3MTAA 5DU2A 5DSTA 1MC8A 2HBQA 4PYKA 2O0MA 4KMOA 5CVUA 4PR3A 5AM5A 3ZXUB 1NJFA 4E15A 3QMMA 3QXHA 5K05A 1AG9A 2FDCA 4W9NA 4J0KA 4P2BA 2H1LA 2YY7A 2ZUDA 4CEJB 1MABA 3K0EA 4BKMA 8OHMA 1ABBA 5M04A 3QX7A 4HFRA 3L40A 1IM5A 2VUIB 4G26A 2DHRA 1YB1A 2O8FA 1OMOA 4CCAA 3E0QA 1SHZA 4RL4A 2Q27A 1P9RA 1A9OA 2Q21A 1GYPA 6YASA 2BI4A 4YDQA 1QP8A 3LKDA 1OAAA 4HNAB 3SZLA 3ZJUA 4MI3A 1HO3A 4LF9B 1C9JA 3O1HB 2WI8A 4JBLA 1O8BA 3LD9A 3PHIA 1Q1BA 4B0OA 4G8CA 2H9IA 5KC8A 3ZXIA 1UTUA 3EEOA 3VI3B 3IODA 1U3GA 3C1OA 2BHRA 1KO8A 3MW8A 1H8HA 5JWRA 4QXRA 4DBVO 4RZIA 3V8RA 4PQGA 1NURA 2QVXX 4CUZA 2BISA 4DREA 5JDIC 3ZDFA 2PTHA 1U2SA 2XRFA 1EDZA 3IAS1 1MIHA 3W5AA 1N4DA 3R5XA 3SICE 5CXSA 2AK2A 3N6XA 4NTZA 5DK4A 3H3JA 1HE1C 4M9UA 4F4FA 1BAPA 3HJFA 2NO7A 4HMOA 5THKA 4B46A 4EYKA 1T43A 2FEXA 3H2GA 2OP1A 3W8RA 1THMA 2D06A 2W8BB 4EG6A 1UC4B 3O2QB 4QUDA 1DZ3A 4ZEMA 1ECCA 3B1VA 1JEAA 3U7RA 4EVSA 2H7XA 9LDTA 1FJXA 2X7XA 3G2OA 4K9KA 4ZOQI 2XZLA 1PS8A 4P5DA 4HNGA 1KY4A 5KYTA 1J21A 2P6UA 3TOZA 4E32A 3OTOB 1NQOA 4JLUA 2C07A 4I9FA 1VJRA 1VA4A 5KJEA 1JVSA 1QGUA 2VAWA 1M7GA 3AERA 3OOYA 3ROKA 2EP7A 1KJWA 4OQNA 2NZWA 2B94A 4BJ6A 4KR2A 3H3XA 2HWYA 4H6XA 2IBMA 5EJFA 3THRA 1ULAA 2A94A 3GRFA 2G3YA 3L8DA 3K0CA 4LRTB 5EZYF 3UW3A 4X1YB 1G18A 3WLAA 1P80A 621PA 3S28A 4XOIA 2DCMA 4KFTA 3JYPA 2YWDA 3A1FA 2GI4A 4FYKA 3DZJA 1YCGA 2NU6A 1GNLA 1TK2A 2X0JA 3FOCA 5IJWA 3R0VA 3HJNA 4FSXA 4ABYA 3A05A 3MJ4A 3JAWB 1WDMA 5H4GA 3R3YA 3ZV5A 2EC5A 2X13A 1GRNA 1BDHA 2G63A 4GOLD 4JR1A 2XJ9A 4R7ZA 2NOAA 3MJFA 4OQDA 4RYLA 2PY6A 1M7BA 3RVKA 3CVUA 1VKHA 4LEIA 1Z62A 5CYGA 3ESCA 3T3OA 1HDEA 1AB6A 2JAXA 1JP7A 2OKGA 1LVUA 1GFSA 5FHRA 2OBMA 3HBLA 2B35A 1JJFA 2C3UA 3FTCA 3NR2A 4OXIA 4IIFA 5H83A 4ESOA 4J3NA 3UUWA 1V96A 2BFAA 3LS2A 1A1SA 4GZLA 1I0LA 1RJ9B 1VQ1A 2F3PA 4OOFA 5EUQB 1WCYA 5CB4A 5JCOC 4PYMA 1CRZA 3FYTA 3GCXA 1ZEJA 3LLUA 3FVWA 4WY5A 2ZSHA 3HFRA 3SQOA 5A7FA 5C32A 4XKJA 5KTRA 3FI0A 4PQYA 3E9RA 1B0AA 1CQWA 5JI2E 1NLMA 1RW4A 4F11A 3O4HA 3X44A 4C4SA 4QM7A 1OLSA 4Z3KA 1SXJD 1D4ZA 1DDOA 1WY7A 5H8WA 1GZ4A 1XU7A 2ZRBA 5JQGB 1D7AA 3BF8A 3GA5A 1AUQA 3GDHA 3SBOA 3F7NA 1II0A 2MYTA 2PEYA 1UF9A 3B5IA 2MSKA 3PLRA 2WFLB 4LISA 3QJGA 4KLZA 2EGUA 3QVKA 2EG9A 4RD0A 4WSOA 3K2QA 3UEOA 3ER9A 4FGWA 3OQJA 5EPEA 2FWMX 4D8YA 5I7FA 2D1TA 3RJ5A 2DGDA 4PO1A 2J3HA 1ML4A 2HHCA 2OCGA 1NXTA 2G7MC 4M22A 4HLNA 4R98A 1AF7A 2IC5A 5AK4A 1I4TD 5EKUA 2AR7A 1CVLA 4NOLA 4EITA 1FTNA 5DLYA 2A5YB 1EZ4A 1L5WA 4HH3C 5EUBA 4BV3A 5I9NA 1TVKA 1WMFA 2QUAA 3F2IA 2ZBVA 3NWJA 1U28C 2DQSA 2HX1A 5EQTA 4ND8A 5FJIA 3LM8A 1QYIA 1KO5A 3GW8A 4KVFA 2P6OA 1NBOA 5FNZA 1P44A 2NV2B 1U3WA 4QL3A 2EFJA 2XUPA 1SUFA 2NZVG 1Y5MA 1SNYA 2QD2A 2WZDA 1C0EA 1VLZA 4RO0A 1T26A 5DX0A 3VH1A 1JR2A 2BP7B 5IJ9A 4N01A 1P1JA 3UCEA 1YR1A 2QGNA 2Q3EA 1Z5OA 5G02A 3UKOA 4DIDA 1RJWA 1QH8B 1YR3A 2X4GA 1DTEA 4EIWA 1H5UA 2E6KA 1TTTA 2OG2A 5JDIA 2OAGA 3OT1B 4EW3A 4Q3CA 4D8UA 4EF4A 2C7QA 2LVBA 4UZSA 4GC9A 2PU5A 5EIBC 4TMWA 2VH2A 3PUXA 2MR6A 1GQFA 1Q84A 1R5OA 3QHQA 3BREA 4MS1A 3F3MA 1QRTA 2MSLA 3GEDA 5BNWA 2C84A 1F2TB 5EMKA 1JXOA 2QN1A 3TCXB 3GLTA 3MJCA 5D3ZA 2AIRA 1T8RA 2WHPA 3I9V6 4CM8B 1JILA 4X8QA 3P9RA 4LN1A 3ND7A 1X39A 4YIKA 4YR9A 1SUYA 1CF2O 1F20A 2IBTA 4CDMA 1TMYA 4FD2A 4K9RA 1JHDA 1RHRA 5BN4B 3TOVA 1V3TA 3H75A 2H7YA 2P0EA 3MYYA 4QTZA 3WGNA 3FSGA 5FBHA 1NPDA 1GGNA 3LL4A 4A10A 2P77A 2NIPA 4IOMA 3W5UA 2OOSA 2Z08A 5FI3A 3MSXA 3NH6A 1RI4A 4MR7B 4F2WA 2VKTA 4KGZA 4RXUA 5K3FA 4IDQA 3CXRA 4FMBB 2EFYA 5C4GB 2HT1A 1WZNA 4L76A 1UFRA 2P9FA 4PRYA 4HI0E 4DDUA 2P5SA 1QOZA 4TLMB 2PEZA 1O3YA 4MLZA 1AY0A 4BZPA 2J9YB 1NLZA 3PDJA 2KLBA 2ID8A 1CE8A 2VNJA 3SBDA 3VVBA 2JFQA 5ALYA 2HR1A 1Y3HA 5HRUA 2GJAA 2PHZA 2EZ4A 1D07A 3BGVA 3P19A 5DN6A 1UFOA 2H2IA 2XUFA 2EKPA 2Q62A 3D8RA 3P4UA 5G4LA 4AJLA 3NS7A 4CN8A 1QF6A 2GSDA 1HE2A 2X3UA 3W2TA 5IJAA 2WJ4A 3X2EA 3Q2OA 1Z5WA 4EATA 4ZYLA 4KN5A 2ODPA 2DG2A 3MJVA 1P8AA 1UK7A 3K6KA 3QKRA 1H2EA 1UAYA 1WF3A 4WRRA 2XYGA 3R6DA 1XZHA 4Q12A 5EWMA 2P9YA 3STUA 1G5FA 3HXMA 3WXMA 2IZ0A 1KXZA 2NO1A 4KODA 4DCJA 2YJ3A 4RKQA 2P75A 3IAUA 5C0OE 5A3JA 5BWMA 3CUWA 2AB0A 3I30X 5JCOA 5HZMA 1U0TA 1QQAA 5CDUA 4UU8A 4U7GA 4C5AA 1J2TA 4MKXA 2J9GA 3LC2O 2QTNA 1KTIA 3AW8A 2JG3A 4ARZA 1L7EA 1WXFA 4AZ0B 2G1KA 1KL7A 3K70D 4PQEA 3K1YA 3CO5A 2W42A 3CKLA 4MGHA 4WKOA 3UG6A 2WNSA 3DD5A 4QAQA 5HM8A 1JG7A 1AOXA 3MBKA 3VJRA 3IQEA 4CQJA 2J87A 1LI7A 2ZJFA 5IT9A 4QGBA 1BCSB 4FW8A 4KB5A 1ZM4A 2IYPA 1ODIA 2P9JA 3HRHA 1SPXA 4QRIA 2W7TA 4LXTA 4V1CB 1S2NA 4IQ8A 4WUTA 1TD9A 2H3HA 2ODBA 3FTPA 2KSQA 4R5HA 2CNKA 2R5WA 3A36A 3WB1A 3WFJA 3P9SA 1P7CA 1N7IA 2WPDD 3MA0A 4M7PA 5AXBA 2IPOA 5EIEA 4KOEC 4BS9A 3B2NA 5HBGA 3S2IA 3AKDA 1YS9A 3ZXSA 4B85A 3QBJA 1MC4A 4UFPA 1IH8A 4LZAA 3H8VA 2ZCVA 1AS2A 1FTSA 1T2UA 3ZYCA 4R2XA 5BWCA 1GRVA 4N0MA 4F2HA 1U28A 4GSLA 4MHSA 1ZD8A 3X1DA 2GAOA 1V2HE 1XP5A 2VUTA 3D3KA 4MWGA 3UG7A 4INAA 3UFXB 3VO9A 5LZ4A 5C8XA 2W8ZA 2XDQB 4N5DA 1XA3A 2MMGA 2JIMA 1LPOA 4FFWA 4X8OA 4F93B 2OGTA 3QLJA 1Y8ZA 1Z6TA 4OUKX 2ORIA 1T13A 3A8TA 1GU0A 4WVLA 2BHSA 3JARB 3K0FA 5JNTA 1FRZA 1O94C 1PFQA 3OOWA 3Q87B 5SYNA 2QN8A 3UJ3X 4CYMA 1LRJA 4DDMA 4EFMA 5HJ7A 1QHEA 4HN2A 1IU9A 1UBNA 3ITNA 4KDRA 3K0KA 3G1WA 4OKNA 4W99A 4MK4A 1WB6A 4WBNF 4EW2A 2OC9A 4IQGA 2FPXA 4NJMA 4ZO8A 1I4WA 2WY2D 4DJTA 1MRNA 1NDUA 5ESWA 3OQMA 1D2HA 2J5RA 3DOCA 2VTBB 2BTQA 1QFZA 2RGBA 4RABA 2GNOA 4E13A 4YJ2B 5IVPA 4BQPA 5ALIA 3BJIC 3ZS9A 1M8PA 3LBHA 4MGEA 3K1AB 2CVPA 1J42A 3H0CA 3JR3A 4MAMA 3U7JA 1QGAA 2NAPA 1LX7A 4JLVA 2R8XA 3FGZA 5KMGB 5JHHB 3EUEA 3I2KA 1WV0A 2GRJA 2PGAA 5HHTA 1C7RA 4II2A 4QBKA 5FRDA 2UZ4A 1Q2XA 4D6XA 3FB1A 3C5EA 3NORA 3BL8A 5EQFA 4NNOA 3TLAA 3DKKA 1H2BA 5FJJA 3UMRA 4UHHA 1W4CA 5FF9A 3AR2A 1YIAA 4P4TA 2G25A 1YK1A 2VWGA 2WU4A 1EMDA 5IMSA 2EJWA 2ZM6B 4OKSA 2XGSA 3NBKA 4LOLA 4WE3A 5H0IA 2F59A 1X7YA 4OHVA 1FUUA 2ZUVA 4YRBA 2ACKA 5C5CA 4C7VA 1NF8A 3CINA 2PM8A 2HLHA 2X86A 1KQNA 1YVDA 4RQUA 1OI3A 5JWHA 4BX2A 1KYYA 2C8KA 1FJ2A 4C4TA 4E6EA 2WWGA 2BM1A 3FPLA 1K8RA 3EQ2A 2Q6IA 4RZQA 2VQ3A 5FNVF 3BD8A 5FUMA 2JI9A 1Z2CA 1DX4A 5JZOA 2IUEA 3MT8A 2E18A 3G2MA 4BB6A 1Q7CA 3QBDA 5COAA 4BV8A 3BJZA 3L8ZA 4FT2A 4DC9A 1QHYA 1H2XA 1DVRA 1Q7GA 3QW4B 5JE8A 4EYQA 5MN5A 3KCQA 3V6MA 3GMSA 1YA6A 3IKTA 5EMNA 1W5BA 3EGCA 3EDQA 4JNCA 1A98A 1TUBA 4GOOD 1H22A 1YBHA 4IDNA 4TXHA 3RVMA 1DO0A 4YXFA 3N8NA 1ETHA 3G1UA 1ARZA 2WFZA 3B1XA 1ODSA 2QLLA 2Q07A 3MTBA 4RE5A 4E5YA 2PUVA 4PR0A 1X70A 2F3UA 3NQ41 4ON9A 3KQYA 1T2FA 1AHNA 3BA1A 1KHHA 4F2DA 1EH5A 1U04A 2VDWB 4HEA6 4JV5B 2CFTA 4PNEA 1K98A 2OHFA 3DTVA 1AUVA 2BGKA 1XLVA 3EXEB 5I4BA 2WTEA 1LLUA 2FX5A 4S2EA 3VNQA 3ZBQA 3RIEA 3AR6A 1N0UA 2C2GA 4UNIA 1R88A 1ND5A 4ZPXA 5KOHA 4ZQEA 1BU5A 3WJ1A 4WFIA 4US1R 3U81A 1JDVA 3KLPX 4DDHA 2CFCA 4POOA 4X3CA 1L7PA 1P33A 1QE0A 2ZIEA 4JCCA 5LXTA 3CT6A 2R8YA 5B1IA 1XOIA 3TRKA 2V9ZA 2ZB3A 4G5SA 5DGCA 4D80A 2W6MA 3TKLA 1C1HA 4L8WB 2CNBA 1XRJA 4NFHA 4F21A 5DTJA 3JQAD 5J4YA 5KTYA 2DWQA 4LOJA 5LNK6 4ZN6A 1OLXA 1P81A 3M4YA 5JH7B 4OHXA 4EPWA 1QG6A 3JATB 1E3WB 1GTG1 5HMLA 1TM4E 5EHIA 3RT7A 2PX4A 3C43A 3CPHA 2W98A 3HKCB 3PNMA 4FGSA 4JLKA 4ND3A 2R48A 5L3ZA 3UB4A 4X65B 3K1ZA 1VZ2A 2ZM5A 1FDRA 4BP3A 1E2MA 1SKUA 3VC2A 3H05A 4Q1FA 1W36C 3AV3A 2O8BA 2NPOA 1H1TA 2B8WA 3E3NA 3M6MD 4M36A 5JEDA 5A5VA 1ZVKA 2EL9A 2QYHA 3PNYA 5IYZF 4E30A 7YASA 4TVSA 4F6LA 1D0SA 4C22A 1M2JA 3HKEA 2PS3A 3HSYA 3DB1A 5K3SA 2H2GA 4FR2A 1HNNA 4LJLA 5ENVA 2XNHA 3HKDA 1XFAA 1QORA 3I2IA 5DX1A 4EKNB 5LQNA 2PRJA 3B9QA 2BYTA 3L7CA 4RJIA 4BQQA 1DAOA 4HRVA 2CXUA 2QKYA 1AIPA 1V39A 3FRJA 5FB3A 3ZDQA 3NHAA 3L18A 3CO0S 4JZYA 1SUDA 2OMEA 4UNRA 4TMKA 2I7VA 5ALUA 3AYZB 1OI2A 1F1BA 2TSYB 3DLPX 1S0UA 2W6ZA 3DOOA 1VCOA 5CNJA 1O5OA 4ACAA 1PE0A 1FYVA 5J1SB 4ZICA 5SY4A 3DJYA 2B82A 2F43B 3CLHA 4Z8YA 1R1DA 3H8SA 3PNBA 3AEUA 3IT0A 3L8HA 1U7TA 2FFAA 5B2EA 2PZMA 1ZNWA 4ZQGA 3MN1A 5DGDA 3F5SA 1SELA 2J4FA 2X0IA 2GKOA 2AHOA 3BILA 3HKBA 1CNFA 1U8TA 1YSCA 2NO6A 3MB5A 4Q0MA 2FSIA 3RVQA 1TM3E 4CVNA 4EJSB 1PJAA 4B8YA 3NLLA 2HBRA 3QNUA 4M8SA 1F8UA 1QQ6A 5E4FA 5F4BA 3RJ9A 3DTYA 1R74A 4YN3A 5G0WA 3NZEA 1N9ZA 2ZBEA 4PICA 2HSJA 4U9UA 4XIFA 3RIMA 1U8ZA 2RSLA 3OKAA 4Z4IA 1UK8A 1NF9A 3JWPA 4FBLA 3KAQA 2PKCA 3TPCA 3OA2A 1JQ3A 2PMEA 1PSWA 1RIFA 2D7CA 4XWTA 2WWWA 8ADHA 5U1PA 3UICA 1VSQA 3LU1A 1M3SA 4EUFA 5BVGB 4YJ3A 3EVGA 2CLIB 1M10A 2CLEB 2Q3FA 3DE6X 3L7IA 2FQWA 3LGSA 5KSOA 4TRMA 1TA0A 1Z6XA 3I1IA 4ETIA 3THXA 3JZIA 1ZQ9A 4XDHA 3ZU3A 4XGNA 5JY6A 4O4JB 4KREA 1VJDA 2FZCA 3FETA 4DHWA 1DIBA 4DLKA 4EA6A 2WEKA 1TT5A 4NATA 5FWAA 5GV8A 3MTGA 4EJFA 1KZ4A 2HV8A 1E1NA 2B4KA 4QEKA 2J3EA 3W7BA 1J06A 4HV4A 3LHIA 4BWGA 4L3VA 1JKMA 4W1PA 4D5GA 1PR9A 3K09C 3WIOA 2Z8YA 3AKYA 3GBPA 1M6VA 1XDSA 1I13A 2FFRA 4ZOBA 1IHPA 1L2TA 3FCUB 5HE9A 2ZCJA 1QG4A 4UTPA 3BE5A 4D9IA 1T5SA 4MA4A 4QQFA 5IWAB 3D6AA 5FWYB 1U0NA 3TQTA 3Q0IA 2ZB7A 4XWWA 3CTPA 3H1FA 1CVIA 4RPHA 5C5IA 2C7BA 1RYNA 2HWWA 5K0ZA 1EWQA 3PJEA 3EVNA 4IVNA 1KE1A 3IV6A 1SBYA 3F4BA 2QJTA 1GNPA 3UGKA 2REBA 1ZAKA 1ZRSA 7MHTA 5FBWB 3OQVA 1YZHA 4DAOA 4UFNA 4EMSA 4EG7A 4I55A 2NTVA 5AI0A 3BFPA 4CMGA 1Y80A 2C2MA 2PQMA 1HDIA 4AUKA 1IN4A 4IX1A 5CB0A 5E2IA 5HXAA 3WLQA 1B2LA 2OZKA 2HADA 1P0IA 2HDNB 3DTNA 3EULA 3F5MA 4R54A 4UM5A 1TM5E 4TTVA 5DH9A 1ZJJA 2WF8A 1UP6A 4JI1B 4TTAA 2Q2NA 4BO8A 4BNUA 1Q0SA 4D4HA 2MINA 3CKKA 2GBGA 1AQJA 4KR7A 2RGAA 3B2QA 2QUHA 2ZDQA 4Q9IA 1U65A 2E4ZA 2WILA 2LE0A 1R8YA 1IL0A 1I7NA 4LI0A 2Z9BA 4KHPB 2ZRCA 3PX3A 4RKYA 2AOVA 4L02A 4DLWA 3V2IA 2DECA 4GI7A 3C7KA 3D7LA 3P4YA 2CE2X 1LDNA 2AQIA 3D6FA 3ZHQA 3ZY3A 4O08A 1WKCA 2A4KA 2IZZA 2ZXFA 2SHKA 2FMHA 1XQXA 3RVSA 3Q0TA 4JL8A 1DMRA 3LVFO 5BT8A 3OQ6A 3AEKB 3QVXA 3MD9A 2ZVJA 2QTMA 4HAOA 4MYSA 4RSHA 5E3IA 3HR4A 1GZ3A 1QHFA 2WMYA 4HQLA 4EHKA 4M37A 5KQRA 4ALKA 1ZONA 3DKIA 3RFVA 3TLBA 3KAJA 3ZDZB 3BDVA 3WNVA 4AM8A 4R1QA 1E69A 2IFTA 2O1SA 5E6RA 3BERA 2PUAA 1D5WA 4LK2A 2GILA 2C5SA 3YASA 4L8YA 1KIFA 3GHHA 3MMZA 1LBSA 5LA6B 3BL6A 1Q7EA 2ZYGA 1VHJA 3D5QA 1AV6A 1C30A 3SC4A 4DIKA 1I80A 3HPRA 5B5SA 4BRUA 1COZA 4XUDA 4KXQA 3I9JA 5ILOA 1Q6YA 2PLRA 3A3KA 1WBJB 3COYA 3EZGA 2ZUCA 1GIAA 3HBMA 3GA0A 5DW0A 3RSZA 4EY4A 1RE1A 2ZIUB 2ZRDA 3WWEA 3I04M 4OMDA 1QKJA 3C5VA 1HNZB 2XYPA 1JWLA 1JH8A 3IO5A 3TGLA 3VNUA 3OM0A 3H9GA 3WNQA 4BUZA 2HSZA 2IH5A 3I3SR 3M9WA 2Y3IA 1GU7A 3WKEA 5A2QA 4MVXA 1SOUA 3JWHA 1DZIA 2PSDA 2QBYB 4PAGA 2PGIA 3LPAA 1JJIA 1L1EA 5L6MB 2H1RA 4R31A 3RADC 3C7TA 1U7DA 2C9BA 5AK5A 4B5LA 1MEOA 2QP3A 3GWGA 3SIRA 2WAXA 5CX1A 3E35A 1ZYUA 1UZMA 3FZEA 2QB5A 5IP5A 2C61A 4UFOA 3ADBA 1Z7EA 2V45A 3S6JA 3T3PB 1KDPA 2QG4A 3GLFA 3AJ9A 1DIGA 1ONSA 1PJRA 2UVDA 4J75A 3WWYA 1N2JA 1WUKS 4QQ8A 5CITA 4BGDA 2C5GA 3ED1A 3P8ZA 2JLQA 4B8WA 1EA7A 3H18A 2FPPB 2XMZA 1TB4A 2OB1A 3K0HA 4GX1A 4OHBA 4YQYA 3WA6A 1K7EB 4L27A 4EYGA 4BN4A 5B7NA 1DGQA 1XALA 1GPH1 2WABA 1CY1A 2PL5A 2DUJA 3K09A 4NCIA 3HB1A 3JTMA 3VC7A 3UF0A 4LHYA 1XFDA 5EZYA 3SDZA 4KAAA 4FHZA 5DGHA 3A14A 2XCSB 2B4QA 3ZCPA 2R4QA 3LWBA 4JKYA 3H9UA 5DCUA 1E2QA 2H5EA 2HK7A 3KR9A 4NCBA 1NBMD 5LPNA 3CX7A 3ZNPA 1KEWA 2V1XA 1OU4A 1DFIA 1Q0QA 3VTZA 2AR9A 4R1PA 1IYZA 1WU7A 4ERNA 4DLRA 5JC8A 3RUHA 1ZM2A 2PZ8A 5IT5A 5FUQA 5HK8A 1KNQA 5KS2A 3FPHA 5JQWA 1WG8A 4EPRA 5HCUA 2XB9A 1QNFA 1SBTA 2FZKA 5SY6A 3M34A 2Z6QA 4LE0A 4DHEA 2HYDA 2W90A 3A6HA 2DKFA 2ETVA 2YIJA 2YMPA 3IKVA 4RHEA 1XTVA 1EDBA 5FOTA 1O89A 1DWQA 5B3AA 3RVLA 1GOTA 4FHFA 4DIOA 3E9YA 2O20A 3EJWA 3NJRA 3ETDA 4JI2B 5EL0A 5IDWA 1PG0A 1SXJC 3PDWA 1H4TA 4XYBA 5E4JA 5TGDA 1YJXA 4OREX 1KORA 2O2YA 1T0PA 1W2WB 3N2IA 1LPNA 2ON6A 4IIXA 4JB2A 3L6EA 3UMSA 1L7OA 1Z26A 4AJPA 2VFAA 4JLWA 5IZ4A 2W71A 4B43A 1NBAA 2BBTA 3PVSA 1ZHHA 5LJLA 1CUWA 3AOEC 4M4SA 3HUEA 3B5EA 1DC3A 3ONWA 1K06A 3CX4A 4GKAA 4LMAA 4R8LA 1RC0A 4MKZA 4TM7A 4E70A 2X6RA 4FXPA 2Q5IA 3MMSA 3CKYA 4YK7A 4DBLC 821PA 4MTLA 2P8SA 2ZANA 3IL2A 1RQRA 4J03A 1ML3A 1JW9B 1XRRA 1J8FA 1LQTA 2YCLA 5BO5A 3JQGA 3ZY4A 4CDRA 1FX0A 1MO4A 2IPNA 4P34A 4CKCB 2ZRGA 3GYGA 4AS3A 1LX6A 4YEDA 4PC3A 2ZJ1A 3MWDA 3UA3A 4B35A 1N25A 4X8HA 3D9QX 1ZD3A 3AR7A 3KB2A 4L74A 3X0DA 1BS1A 3OUUA 3LXXA 4U02A 1KJQA 4IQ0A 4UAJA 5ERGB 1BIFA 4Z4GA 3ZUGA 3ISTA 3F47A 3JZMA 1GCIA 1R6BX 2G0TA 3AUJB 1W2GA 3L7YA 3OHPA 3F5FA 4L8FA 2I3BA 4XIGS 3V34A 3VZDA 4RGVA 4MS4B 1TMKA 3FRIA 4Y1FA 1T1EA 1VKNA 1XMPA 3A70A 2CJYA 5FD8A 3W9UA 3HWWA 1VSBA 2YQ5A 2F8MA 2FPGB 5DM70 1XWFA 2EX1A 1ECPA 4YP6A 1AKEA 4MAFA 1VHLA 1PJLA 2V7UA 1AT1A 1XTRA 3MIIA 4GWGA 4C7OB 3FUUA 5ETJA 2HMVA 1S1MA 1QH9A 1TMOA 2Y2UA 3WK8A 4E12A 4AO8A 5AQ1A 3BXHA 4BDTA 3NDIA 4FDMA 1Z07A 3A6FA 4CLHA 3SDSA 3ZDAA 5BURA 1U8FO 1NHGA 2CUKA 2NZXA 2P91A 2QUZA 3L6RA 3UT0A 2VOEA 1TEHA 3A06A 4FSHA 4F91B 4BLVA 2X9VA 1G63A 1KQPA 1D4FA 2UKDA 4QBHA 2NU8B 2OTCA 3EODA 5CA0B 2QMEA 2XDYA 4RD3A 3C98A 4FZJA 2QTWB 4BASA 3LIPA 4U2BA 3GLFE 2Y99A 3GH3A 1Z6AA 4HQNA 1XXHB 2CK3A 4NBWA 1U2DC 1IQ0A 1Z22A 3CB4A 3JYHA 1Z6GA 3WO1A 3AJAA 1H3FA 1QFXA 1GGKA 4RMIA 4X92A 1XU4A 1ANKA 1BVYF 3UWOA 5A3VA 2OO3A 2ZRKA 3WQSB 4F4HA 4S1NA 1N33B 3SMVA 2HMTA 3HZOA 4IDFA 2QYTA 1P3JA 1TT7A 1BMFD 1EX7A 4Q3OA 5K01A 1FOEB 4WKBA 5AJXA 5F7OA 5AVUA 1B23P 4QJ4A 3B5JA 1KDYA 4AAYA 3KVOA 1EAYA 2W2KB 1EZZA 2VWQA 2B7BA 3DF9A 4HLCA 1KBQA 3FHJA 1Z8NA 2NNWB 1X14A 4FFNA 4QDZA 2NU9B 3VPCA 5JISA 1V48A 2P5YA 3Q8LA 3OE7D 3STVA 2RGRA 1SULA 3W2EA 1O2DA 2EGGA 3TUJC 2XY4A 1VE9A 2GJKA 2Z5VA 3FGPA 3I8OA 1FLNA 5ESRA 4V24A 5IASA 1B6RA 1YCHA 1KH1A 4EJ0A 3RNOA 2NLOA 3U6BA 1SIUA 1Q0ZA 4LK3A 3IFSA 3AEQA 1KEZA 3M6IA 5I48A 1IBRA 1KQOA 4FHCA 4GUDA 1VBMA 4QQRA 3JSAA 4F3YA 2I6TA 1FFGA 1KKLA 3RRZA 4RTJA 1GQ2A 5HDQA 3RODA 1CUSA 3K96A 4RTOA 1RYEA 5JLJA 1LJUA 2XQIA 4YRJA 5FCDA 3QPUA 3NC0C 2PKEA 4UASA 3PE3A 4UCWA 4UOEA 2BH2A 4C21A 2P2CA 4DZZA 1P9WA 2PUWA 4X63A 3R0QA 2I3ZA 4IO1A 4UVHA 3K70C 1G4HA 2MYUA 4KBYA 1SXJA 1WCXA 4I46A 3HEBA 3PEYA 2X14A 4WJKB 1JG1A 1A2KC 5ECDA 3CNEA 1GPUA 1U94A 1B3BA 1QNLA 2O1XA 4JSYA 2QTRA 3QV1A 4OX9Y 4IVQA 3IUBA 5HUJA 1PFWA 5KYXA 1E2DA 4H1TA 1NF2A 4B3DA 2O3QA 2PU7A 4YMIA 4WY8A 2B2XA 2LWIA 2IV2X 3AOEA 5HIMA 4S3MA 4UXJA 3REOA 1PUJA 4MPRA 3GDWA 4AQDA 4IO0A 1YQGA 1A9XA 1YBFA 3NUZA 3OY2A 1L5MA 1N2HA 1XCLA 3GFGA 3HXKA 4A0GA 4J4TA 3W4IA 4MWDA 1GT91 4H2DA 2PRSA 1E7SA 3A3YA 2NXWA 1FEZA 1T4MA 3IAFA 4ZARA 4TLLB 1UOOA 1DRWA 2GHTA 1BS2A 3KSUA 1E9AA 3KFVA 2KI5A 3TQSA 1A88A 2AYYA 4FYIA 3TDNA 3TINA 5KINB 2COEA 2Q3JA 3BKXA 1FRNA 4WCFB 1DINA 4HBGA 1E4OA 3I05A 4MLCA 4UULA 3UBMA 2VWHA 4REOA 2ESRA 3HWX1 4KGXA 4AKTA 1H5QA 3LWZA 4C2BA 4R3UC 4S1WA 3U5TA 4KIUA 1IXRC 1XEWY 2Q99A 3VUFA 2B2NA 2NXJA 4KG7A 4ENQA 1LPPA 2IF0A 1P4RA 2FRVA 1JQAA 1EVKA 3GRCA 4PIPA 2VF8A 2PUDA 3GO4A 4XQGA 2VHUA 3L1KA 5TSDA 3SSOA 2ANBA 3GZ4A 2O8CB 2WM3A 4XB1A 2ZYUX 4J90A 2FE1A 5BQPA 3WG9A 1O96B 1USGA 3VO8A 4B3GA 3T54A 4C3ZA 4AY5A 3F73A 5JXIA 3C24A 3DP9A 3ZEIA 2Y05A 4F86A 2O8NA 3K2BA 2PLFA 4WUVA 1ISPA 2A86A 1RWXA 4LYJA 1PDVA 4PIVA 3V1NA 4E3WA 3ZKAA 3O26A 4JIGA 2W4IA 2PTGA 3BEOA 1P5FA 5AW9A 4DIEA 3CE6A 5DM1A 2PK3A 1XMSA 6GPBA 3FPGA 1MABB 2X5KO 2WD9A 1OCEA 3EW9A 4WPGA 1FS6A 3NM5A 4X7MA 4WN3A 3ADDA 2O8FB 1TF5A 3FOWA 3JQCA 3DEZA 1KOLA 1VPDA 1Q6ZA 5BSKA 1L4MA 5LB2A 1U2DA 3DQZA 1R6VA 1WW8A 2YV1A 3CF6R 3AIIA 4JA2A 1NX6A 2W6QA 5B6IA 5CXUA 4RF5A 3UUFA 3VAAA 1A7JA 2Z2IA 1FFBA 4TKZA 2ZATA 2F67A 2AYZA 2FR0A 1XZLA 5G3ZA 3WMRA 5HIKA 2IOHA 2QQFA 1A9QA 4MR9B 5JNUA 3O8LA 4YX9A 3N86A 1VMKA 1PJTA 4FPXA 1GL9B 2ZR0A 2QF7A 1L7MA 2UZ1A 4ACBA 2ZDHA 1GPKA 2Q2OA 4LWOA 4HDKB 1NKTA 1WDKA 1E6EA 3K9BA 3PKIA 4R5MA 4ZVLA 4UHEA 3NHBA 3VMFA 1FY2A 1XMOB 3KE9A 5COBA 1G9SA 3JAKA 3AETA 4E94A 3EZFA 3RTCA 2QT0A 3HU5A 5F51A 3VZPA 5JMOA 3VHLB 1VRVA 4DDKA 4YBRA 3D0OA 3NDJA 3V4PB 1LI4A 2PUJA 5F3WB 3TQRA 3AXSA 3P2JA 4D6YA 3PIIA 3ITKA 1W5TA 4B33A 3NETA 4UHJA 4FFOA 5LQAA 1K0UA 3EG5A 5FX2A 2RGYA 4UTZA 3QBVA 5DCYA 1NC1A 3TFQA 3P20A 1A9RA 2EARA 1QGUB 4J2OA 4RFSA 5A3QA 3KJIA 3LYHA 4RCVA 4TKUA 1DI0A 3DL4A 4Y9UA 3EC7A 2PRKA 1SXJE 1TJ4A 3M1MA 4MUEA 3M4JA 4C6TA 4H60A 3EN0A 1PHRA 4GKKB 1ZISA 3R3JA 5JO0A 3VZRA 1QU3A 4FYYA 1HT1E 3E0XA 4GX2A 4J16C 1POWA 1Z13A 3H20A 1RYMA 1ZOLA 2NU6B 3FBWA 4NS4A 4Y2YA 2A67A 5FBRB 3O93A 4MRAA 2IITA 4KUEA 2CW5A 1R0RE 3AHHA 3DFUA 1I7PA 2FQ1A 1W96A 3OCWA 3QVLA 5FAXA 2ZRAA 5JJCA 5K8TA 3QSYA 3HXPA 1E6CA 5C35A 1BTOA 4P81A 4DBLE 4M0DA 4Z9FA 1WMEA 4MPDA 1REQA 2BL4A 3UNXA 1CEYA 2X0NA 4RD1A 5B36A 4HXGA 4IMPA 3QWIA 3MGBA 4OMUA 4QFDA 1EUQA 4ZXFA 5EQDA 4Y2JA 3TNFA 4KUHA 3RF7A 1T8UA 7GPBA 1MV5A 3ANTA 3OZRA 3E1SA 2FVYA 3AOGA 1P5HA 3I2HA 4BUJA 3LUGA 2P3QA 1OLSB 1MO2A 2KHZA 1ZSNA 3R9IA 4UDXX 4Y2SA 3V1LA 2XXAB 2RAFA 4CTJA 3EHEA 4R1OA 1XP8A 3K9WA 1KAQA 1G19A 2FRXA 3HZZA 4HDRA 3R5JA 1JSRA 2ZVPX 1ODJA 1X1SA 3FUTA 1R37A 5U4QA 3NWBA 5GJWC 1Q3KA 2FF5A 2X5OA 3EOBI 4ZJYA 4BBZA 3R7WB 2UXCB 2OFXA 3N2KB 1E5LA 4YVFA 1L7NA 4IIJF 4B6OA 4E51A 2QX8A 3KP1A 5KYUA 3T9CA 1J00A 1Z36A 4JQCA 4K6FA 2RJ3A 2VDVE 4L16A 2Q6KA 3O95A 5IUNC 3JD1A 3SPXA 1PR1A 2JFOA 3VYUB 5G2OA 2ECQA 3BWCA 3RIXA 4O59O 2YXBA 1B7GO 1X2EA 2OBXA 2XAUA 1J99A 5BSTA 1YR9A 4GKBA 3LECA 1TVKB 4LSMA 4EAQA 5HSGA 4ND8B 2XGJA 1IPFA 1I1NA 3BXEA 3RR2A 4DR7B 2V9CA 2VBIA 1VL1A 5CM9C 3CF4G 4MIKA 3UK0A 2H08A 2BFFA 2DZDA 4BJ3A 4LAFA 3GB9A 3DJFA 1TYCA 4JNKA 3WK6A 1QV7A 2WHQA 1RHJA 5SYMA 1RBYA 5K8IA 1XVVA 4HXEB 4LJSA 2OM6A 1GLGA 3FDJA 4RMGA 5CJ2A 2CLDX 3IDQA 2QU7A 4BP9A 2R6GA 2V7WA 4R81A 1KXJA 3JXEA 1AN0A 4KPFC 3LFTA 3K15A 4XFJA 2FSGA 2Q50A 1BDJA 3AMVA 1SD2A 2XYRA 2ZS7A 3BFVA 4MTCA 5AJUA 1EP9A 4GC5A 4S24A 3ZY6A 4ADSG 3IMEA 1SXHA 5E9WA 4EBBA 3AILA 5F98A 4L51A 4NR0A 3GFVA 2B5WA 5D6NA 3PI6A 3P9KA 3X3HA 4JGGA 4MS1B 1C3JA 2C9CA 2PGJA 3TW4A 4F45A 4Y2VA 2HV9A 4NCAA 1OPXA 1H3NA 2I03A 4TMFA 4AO6A 1YTLA 1U4NA 2WHPB 1JHQA 2FKNA 5DHUA 4OA5A 4IEFB 4S1VA 2R6DA 2AN4A 1RQGA 3EEIA 4H77A 3ESXA 3AY6A 3KC2A 4Z86A 4OYRA 5AHWA 3PEWA 2O54A 3EUWA 4IDBA 4GR5A 4F4CA 1GUDA 4LYAA 4QOIA 1PR2A 2IY8A 3VPBA 4R2HA 1XDBA 3MC1A 1OH6A 2WUFA 2BW0A 2PCJA 2HPAA 4L8LA 3TLEA 1XPRA 1JHXA 3BFKA 2VF2A 2QXUA 3AVPA 3R5HA 3DQPA 1YJQA 4NOKA 4OI4A 3OURA 4OXYA 4RJLA 3RC7A 4W7SA 4A8JB 3TNJA 1MVNA 5BNZA 5K3FB 2FLVA 2Y71A 3SZ3A 3I9NA 5KUTA 3CG4A 5KNCD 3KZ1E 1GGVA 2P69A 4RXTA 2FMKA 1H05A 1QJ4A 1Z8HA 2J6ZA 3D6TB 3HDHA 3LO8A 1RKUA 3PITA 4J16A 3WISA 5IJ0B 2OECA 1Q3TA 2FLWA 4JGIA 1CE8B 3C7AA 4LIPD 2AQ8A 4M6WB 5IW8A 4DZTA 3AFGA 3L49A 1RXIA 1EX6A 1TZJA 2J8ZA 3DZGA 1BD3A 1JIVA 2VDPB 1XYVA 3PJDA 3C41J 1RAFA 4RNDB 5AKKA 4XLLA 4LRSB 4MW9A 2BT4A 3HY3A 1Y1KE 1CSEE 3QXGA 2HF2A 1IDN1 3I2YX 5K03A 1CZNA 2O2JA 4QOSA 3SS9X 2JLZA 2R6HA 1NBHA 3QKRB 3EGIA 1YOBA 3D0KA 4YASA 2R1UA 4DRYA 5DO9A 1EFRA 1C1XB 4KMRA 3V80A 3FPFA 3JQAA 4O4HA 4RENA 4DV5B 2TMGA 4ZMSA 3F7TA 2H07A 4IEEA 4B3XA 3ZWCA 5BSFA 4NZZA 5H3HA 1W47A 1PQ4A 4IEIA 2Q4OA 3OZIA 1X19A 3SKXA 4GS5A 3T7KA 4EOGA 3KKLA 4C1NA 4HAWA 1PZGA 3KEGA 5LM3A 3F6YA 3CH4B 4HDOB 4UAUA 1PZHA 2AFHB 4Z9YA 1DUSA 4B7CA 1N34B 3FIUA 1EFPA 1C9DB 1DXQA 2BY4A 3PR3A 4IJUA 2JJQA 4R05A 1F7VA 4Z5XA 4D92A 4GLBA 3BIWA 4BBPA 5IU6A 3X1KA 4IGFA 1XMQB 1RYZA 4MRMA 4L75A 3WBJA 1HT0A 4XSGA 1N5LA 2H65A 2WJJA 3IT2A 4JR2A 4K8RB 4AJEA 4AXXA 4F9EA 1XLUA 1Z34A 3QKWA 1IB0A 1W29A 2ZRMA 4DR5B 3PFIA 3W1VA 3VR0A 1T0HB 5B7GA 3GJTA 1ZJ5A 1PVDA 2JHFA 1DKRA 4MVJM 2NSHA 4YGXB 3GUUA 3QMPA 1KDVA 1MA0A 1GNTA 1IXYA 2J3KA 1H9BA 3OCZA 1QOPB 2FCAA 4Z1OA 5CFQA 5IN4A 5JH7F 1VG8A 4H08A 4ZODA 1MU0A 4R68A 3ICQB 4C14A 5JFTA 2J3DA 1IEQA 4R9UC 2IU6A 3WIBA 4QASA 4RF3A 1Y3CE 2VJQA 2OENG 3NWOA 1EX1A 4PNHA 3BH6A 2JLRA 4UVDA 1R0BA 3GRVA 4D6PA 1FFXA 1L7QA 1XROA 3ABSB 3K1JA 1KS2A 3HVIA 4DJEC 3K0FB 1QTNA 3OPXA 4FKZA 1BMDA 1DKPA 1DDGA 2G6BA 1OU0A 3PCTA 4L4UA 4EAAA 3KQKA 4YNBA 4PYJA 2AMLA 1BO6A 3KJQA 1GCUA 3FOBA 1JDZA 4NI5A 1WEHA 4AK9A 4DLYA 2DTDA 4NJMB 4MDFA 1BVUA 2UUBB 3UH1A 4HNUA 2G8LA 4W82A 4CLRB 3O47A 2BTQB 2ZRNA 4DR2B 4D02A 1ZUHA 3SLRA 3U60B 1NAIA 4PPQA 3UJCA 7ADHA 1P77A 1PFUA 1DBIA 3IA7A 2CHEA 3K6RA 1DC5A 3C6XA 2Q5OA 4JT2A 1M6YA 5ITVA 2XUZA 1UP4A 1JECA 1T36B 1OV6A 2FZLA 2ROQA 3DE4X 3D0RA 3HHEA 3QVWA 1H42A 1IHDA 3ERCA 1BMQA 1HTWA 1JQBA 1UC8A 2G4VA 4N3GA 3IBTA 2HW8A 1ID8A 1N0IA 1ODTC 1TGVA 3P52A 5LQMA 3F4KA 4P3XA 1KRXA 1NTRA 2O4CA 4P33A 4Q82A 5KWEA 5K9ZA 1Y8AA 4L4ZA 2XNJA 5DIZA 2HHAA 2XA9A 4XXHA 3RWOA 1KOFA 1YE5A 1H2FA 3LO5A 3ZGLA 1W1UA 4Z4EA 4II3A 1JAHA 2NQTA 3Q6NA 1R9MA 3ETEA 5H02A 1R66A 2BVNA 2X1HA 2UV8A 4QFBA 3BS4A 3UUEA 2CVZA 2ETXA 1B6SA 5AW8A 1BYIA 1FK8A 4TKMA 1A4RA 4BATA 1WY5A 1GRQA 1ZBDA 3CLSD 1X7YB 2KW5A 3LYAA 4G5FA 2VSXA 4TKVA 2A88A 1W36D 2IEGA 1XJ5A 2DP4E 2JJYA 4MUIA 2XODA 3T4XA 2HFKA 4JEHA 3MMPA 3WMFA 1GKKA 3CVYA 3SE0A 2J0EA 4P35A 2DAPA 3E81A 4FR0A 1M8GA 4HQ6A 2GXQA 3KAPA 1WP4A 2I54A 1XEAA 2QJOA 4V02A 5DSXA 4A26A 5AXAA 2AXNA 4L4RA 5J63A 1P5RA 1PX0A 1Q50A 1K5PA 2HA6A 1D3AA 4O2RA 5JS2A 2RGNC 5AUQA 3TZHA 5TVKA 2JFFA 1CBUA 3HB5X 3M4XA 2IV7A 1R0LA 5BN3A 2CXOA 3KKKA 1KJIA 2EW1A 2V5VA 3MGAA 5D5QA 5HEKA 5B2ZA 3UAZA 2HJWA 5DASA 4FN4A 3HUDA 4K9MA 3W9YA 4N7JA 3DP7A 2PS0A 4DXDA 1X9GA 4YDHB 3W78A 1TUBB 3O8NA 4ND2A 2J0UA 2DC1A 4HWRA 2QL9A 4QO7A 2FV8A 4KXWA 4WNCA 3FZYA 4BAZA 2XH8A 4DUYB 1IVNA 3S55A 3DO6A 1E7WA 3ONVA 2N47A 4I3GA 3T3IA 3KHSA 3CNNA 2W6ID 1BVHA 2VXCA 1AQYA 2C0CA 1UFKA 3NG1A 1XZJA 5LBIA 4YPOA 4ZDJA 3T34A 3O03A 4KXYA 2E85A 4UAVA 5KTNA 3PPVA 4KXNA 4IFBA 1MAWA 4R9SA 1UKBA 3B6EA 1AA6A 2JGLA 2Q5EA 4KE6A 3E9MA 2IDJA 4R9VA 1QR6A 3N5KA 5KOHB 4FSDA 2ZUSA 4CKWA 3JQ8A 1N78A 5FPQA 4C07A 1EK6A 2YY5A 1VBNA 1E1RD 1T6NA 2XI4A 3P0EA 4F3NA 2OO7A 4ZGWA 3GVCA 5LXTB 1CUEA 3DOFA 1UJ4A 2EQBA 2G1JA 3LHFA 2OG1A 2P3SA 4TQ9A 4DNPA 3W9SA 2D5BA 4QU9A 4KE8A 2AG1A 2CXHA 2Q5CA 3L7KA 3S1SA 1NN3A 5FO0A 1OLXB 2PZFA 3PEFA 4QGAA 2Z4SA 4PTYA 5G1OA 2DUMA 4NBTA 4QYMA 1D0VA 2GF0A 2IXGA 1GUAA 2Q4RA 2RFLA 3C48A 1QWOA 3IUNA 3A27A 1NVGA 1Q14A 2VJPA 4WLUA 4IRMA 5ALZA 2JIOA 4DWJA 4F96A 4J0GA 1DV1A 5TIIA 3IDSA 2QN9A 3CLTC 1N8NA 4BKRA 4B17A 2JGFA 3V8QA 4FCCA 4TL7A 4L73A 1VYTA 3D6JA 2Z83A 3I0NA 5DHRA 1IBCA 2R1VA 4ENVA 4F9TA 4CJXA 3HKEB 4BFVA 1TRHA 3VZCA 5DYGA 1H2YA 1P0CA 2CHQA 2H1SA 3MCZA 4FFDA 3HKDB 3K6SA 5ESDA 1ZL2A 2MSNA 5CFRA 3F90A 4Y67A 1I5RA 3TNYA 1V7CA 2AEFA 1KAOA 1C7FA 1TL7C 3JYLA 3R4CA 3FCSB 4IV0A 2JFXA 2ZBQA 3CVXA 2HQ1A 1NW6A 2WMNB 1SM4A 1W8DA 3F8SA 3V8NA 2IH2A 1R6UA 2Z8XA 4JYCA 1DX6A 1ISIA 4G2NA 2CLHB 3VZQA 4AJ9A 1ZVVA 1KMMA 1Q6BA 4L5CA 4LJKA 1KZHA 3DDNA 3WYNA 2HKIA 4D7AA 5KWVA 5CURA 4NMXB 1J49A 2WIFA 3CPSA 1GLNA 3V1UA 1Z4QA 4BO6A 2II6A