2I2XB

Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
MLDFTEASLKKVLTRYNVALEKALTPEEAAEELYPKDELIYPIAKAIFEGEEDDVVEGLQAAIEAGKDPIDLIDDALMVGMGVVIRLYDEGVIFLPNVMMSADAMLEGIEYCKENSGATPKTKGTVVCHVAEGDVHDIGKNIVTALLRANGYNVVDLGRDVPAEEVLAAVQKEKPIMLTGTALMTTTMYAFKEVNDMLLENGIKIPFACGGGAVNQDFVSQFALGVYGEEAADAPKIADAIIAGTTDVTELREKFHKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
pubmed doi rcsb
molecule tags Transferase
molecule keywords Methyltransferase 1
total genus 79
structure length 258
sequence length 258
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 2i2xB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2i2xB02
1K98A 1E1CB 2XIJA 3IVAA 5REQA 7REQB 5C8DA 1BMTA 4REQB 4R3UC 2XIQA 4HEHA 3BICA 3KOWA 7REQA 3REQB 1FMFA 3KP1A 3IV9A 3KOZA 2REQA 4HH3C 3WHPA 1CB7A 3REQA 1BE1A 4HH0A 2I2XB 4JGIA 1XRSB 1Y80A 1REQB 2YXBA 1E1CA 1B1AA 4Q37A 4HH1A 6REQA 4REQA 2REQB 1K7YA 1CCWA 1REQA 3KOXA 3EZXA 1ID8A 6REQB 5REQB 3KOYA 3BULA 1I9CA
chains in the Genus database with same CATH superfamily
3C70A 2A86A 3ABSB 4HFJA 3NEPX 1WAMA 1LPAB 3PC3A 5DOVA 2RHCA 3H2JA 4KEAA 2NXCA 3OI7A 2UZ0A 4J0QA 4DLZA 3V97A 5AK0A 5AVQA 2CNBA 2X4IA 4RIEA 3K92A 1FS6A 3I4LA 3K1YA 4WADA 3ZE1B 3FOZA 3OEHD 4AZ0A 3WYNA 4DMUB 1RE1A 1RP1A 2BHTA 5F7ZA 3RRYA 3FHCB 3ASVA 3KE8A 3L7IA 2VOEA 4IDGA 1XO1A 2ZBGA 5GJWC 1M5UA 1V2GA 3RG8A 3ZK9A 2CLSA 1LXCA 5KTMA 1Y9DA 2GZAA 2HADA 3QW4B 4TTAA 3TPFA 1G55A 3WNZA 4UHBA 4RTQA 5DFAA 2H5IA 3CSUA 4YRLA 5MF6A 2IZ5A 1S8FA 4UUNA 4L16A 3ZWVA 5K6AA 1DC5A 1WCIA 5E1OA 5C7YA 3PGKA 3MJHA 4MO9A 4GDFA 4L4YA 4M1OA 1P91A 2VK1A 1QRSA 1AO0A 5IC5A 3O8QA 3O95A 2BIFA 4X8QA 4AY2A 3UH0A 1Q0RA 2JGIA 4FGLA 4J16A 5A6SB 5I5EA 1OB2A 2F9MA 1Y63A 5D8DA 3ILXA 4MX8A 2AR7A 4X54A 3OQNA 4FSHA 2PX8A 4UDOA 1N1GA 2CVPA 2WT4A 2WWFA 3A31A 4NE7A 4OJMX 4TMWA 3F5MA 2PSHA 3NT4A 5HOEA 5JS1A 4RHEA 4B74A 5NLLA 4YI5A 5CAEB 2ZT7A 2GCGA 5DTJA 1XRJA 3MHPA 4QQFA 2F8TA 3ZWOA 1A2OA 2R1TA 3K0EA 2QTWB 4BFLA 3MINA 5GP1A 4I46A 1IQUA 2J70A 5ICEA 1XT6A 5T6BA 1WM1A 4AO8A 5MN5A 4DV3B 5AI6A 3E1KA 1XYYA 4ZXPA 4PGAA 4IHQA 2R1VB 3F67A 4FKBA 3G85A 3IKJA 5IF9A 1UWKA 4RH0A 4R8SA 1WIWA 3IRVA 3ZUGA 3U3JA 3S2ZA 5LKRA 1EX6A 2EZUA 4GMKA 4LRYA 5ALVA 1T2DA 4LMRA 5GOZA 1NGSA 1UPCA 2Y6UA 4FDUA 1L5FA 3S81A 3OCVA 1VCOA 1ZOOA 4UEQA 5AW3A 2IXEA 4D02A 3FLBA 3SZGA 2VLBA 3VYVA 3H1BA 2AH5A 1R50A 2Y77A 5CVJA 3TRHA 2RCYA 4EPXA 2DPGA 4ME6A 2BVNA 1R27A 2PM8A 2YMQA 3O03A 4IFIA 3L6UA 2P9EA 3LKBA 1V4NA 4HS9A 5FL7A 5ITSA 1B6SA 1DINA 1A8SA 3C3YA 2IVFA 4FD2A 4BFYA 2R6FA 5KOJA 4QPZA 1CZHA 3C7DB 3SHTA 1JVNA 4OA5A 4WKGA 2B4KA 5AVJA 5LBUA 4B45A 3R4CA 2VSXA 2P0AA 4KOAA 1WO8A 4EI9A 1T0JB 1I6MA 1SBTA 2AOVA 4PSUA 4P7GA 2YXEA 3G79A 1NBME 3ELYA 2WPDA 1PYOA 4M36A 1HL7A 2O3RA 2XNSA 3FAKA 3SJCA 1Y3CE 2ZWIA 4DIFA 1II8B 3LHKA 4IJMA 2E4AA 1OI7A 4B3MB 4OMFG 3DFZA 2Q5IA 3FKJA 3UMFA 2C83A 5JPIA 5TF0A 5EE0A 3RD5A 3RPEA 3A0UA 4GMFA 1C30B 2GHTA 1VBKA 4ZK2A 2Z3ZA 1IB6A 3U3DA 1XVIA 2FPMA 2EKZA 1RPNA 2XY4A 4H1TA 4BGEA 1C9JA 4FEGA 2YMPA 1KHTA 1H2FA 4YIHA 1JRLA 4WTOA 2WD8A 1NATA 3E9QA 3WWZA 2ZAYA 3OD1A 5TQ2B 3K1AB 1NBOA 2V59A 3U7IA 1FF9A 1ABBA 2DH5A 4C05A 4PQYA 2WJIA 5B1SA 4MW2A 1M33A 4QXMA 1OOEA 3PA6A 3R6TA 2X8JA 4IDCA 4O2RA 4EUFA 1O08A 3EUFA 1EHIA 1X2EA 3O7MA 3QHAA 3ASYA 2OFWA 4XJTA 2VAXA 5AI9A 4KI7A 3WK4A 3HHPA 1F8FA 1U5BB 5H9VA 3L84A 3PD7A 4PNEA 4GIBA 4KMMA 1L9KA 1PJLA 2PGIA 2VHUA 4M1SA 4EG3A 1AG9A 1H2ZA 1CJUC 1KDPA 1M7HA 1XDSA 2CK3A 1QHSA 4LV5B 3PU6A 1G4AE 2B1QA 3SJZA 2QE6A 4YACA 3PUVA 3ADCA 1VG1A 1EEHA 2GJ9A 1WXFA 2IUFA 2XA9A 3N59A 3KIPA 1S02A 2PX0A 1SXGA 2CXRA 4MYDA 5TJ9A 4RM3A 5LL6P 4B47A 2ZE5A 1Y37A 4KFTA 3SC2B 3OWHA 3Q87B 2REOA 5LU8A 4C2TA 1FUYB 5FBWB 5GY7A 2F1IA 3C97A 3R8CA 1ZRHA 3TFOA 1UBNA 2ADFA 4YCMA 1UFOA 3U4GA 3U1BA 1CHNA 4MB6A 3IA2A 2P40A 2FZLA 3JAKA 1Y81A 2J5QA 4RC9A 3AUKA 5AI0A 4HFMA 4HLDA 1G17A 2J31A 3KR1A 4EUSA 2FAXA 2BM8A 5IHXA 1EB9A 2ACEA 4JB0A 5E95A 5LXTA 1FMFA 1YTUA 5DCYA 1XTTA 1NVVQ 2IPLA 3AINA 3Q9SA 5BMVB 2YNMD 2X8BA 4Y6OA 1DWPA 2ZULA 4F4HA 1C8LA 2HGZA 2O8VA 2QG4A 4EJ0A 4YMTA 2AXNA 5FPYA 4XCVA 4BLTA 4RXMA 5EJ8A 1CUBA 1X1SA 1ZVMA 3U3ZA 1XZBA 3TE6A 3U17A 4EJMA 1RXUA 4EHFA 5E2BA 3E35A 3T1YB 4NZYA 2A2ZA 5FTKA 1RWKA 4ZALA 1RJWA 3IP1A 3AR7A 5FNZA 4EX7A 1GNSA 2MSWA 5E8RA 1N9KA 5JBIA 2VAVA 3M70A 5DISB 2VDVE 3A6GA 3H42B 3TRIA 3BQNB 3CVOA 2C54A 3OD5A 4YRTA 5IKXA 2JFPA 2R96A 2NYRA 1IN8A 4M0MA 2TMYA 3KXLA 4CT5A 5B3LA 5KDDA 3V2GA 1Q0PA 2GA8A 4P54A 4AXXA 3LF1A 2NSHA 1K8YB 4HLNA 3RHFA 3WKDA 4HDSA 4JA0A 2I2XB 4OBWA 4H4CA 4CMEC 3GFGA 1L4HA 4RAOA 1Z18A 2VRBA 4I50B 1OF1A 4MVWA 1STOA 1UBEA 3E22B 3H1EA 3I8XA 2O8EB 3A9SA 1KDOA 2P11A 2WIGA 5BRJA 4ARIA 1XMJA 1YVDA 3Q7QA 2H2AA 2J3MA 2OM6A 4R98A 4DAOA 1E9CA 1GGHA 1UZUA 1I51A 2FZ5A 4NMXB 1GLGA 3O8RA 3TRKA 3W3AD 3AJDA 1KBQA 2Q3CA 2W2LA 2P4QA 1FUIA 1KQOA 1VRCA 2BF7A 3O3NB 4JHLA 4M0EA 4M46A 4HMOA 1HXHA 4YRCA 1G8FA 3AWDA 3DFFA 3NHMA 1B6GA 4WNAA 3RIHA 3OX4A 2JIQA 3WYGA 3RYCA 5J23A 3W8EA 1FDRA 2GOYA 3LA6A 4UKDA 5ALOA 1QRDA 3CNOA 1VJGA 4HWPA 4Z0TA 1WZEA 4X94A 3MLBA 1ZJYA 4D4KA 4TLBA 1VYHA 2JIZD 5IXYA 1P4AA 2VT7A 3V8NA 2WIAA 4JC5A 5GAJA 4BZZA 2UKDA 3EJ6A 1LRJA 2Y0CA 4RGYA 5JISA 5LP6A 5DM70 4RTMA 4BVKA 1TQ8A 1WB5A 3EIEA 4EA7A 3DOJA 3MJRA 2OFFA 1ONBA 2YOHA 1KK3A 3BJEA 1HT3A 2WJAA 2Y99A 3U3MA 5EPOA 4DNPA 2GM3A 4E22A 1EFAA 3WWYA 2CF5A 3ZDYB 4E4TA 5BSEA 2C1EA 5DT2A 4E21A 1RRCA 4RPCA 4KWHA 4XGQA 1GQSA 2NPIA 3F6SA 3AEXA 3EW9A 2H63A 4D4MA 1ZK4A 4AIRA 4FZRA 2YN0A 3CJRA 2H4FA 2MWMA 3HXLA 4X6XA 1A9RA 2D2IA 5IK2A 2H2FA 2JBHA 5CCDA 3TYXA 3K4PA 5T4BA 4AKHA 1R9GA 2ZVQX 5EIBD 4NYJQ 1Y9AA 2IYSA 3B7WA 1NU8A 2EG9A 3BRCA 3G2JA 4P58A 4X1KA 3RYHB 1DHTA 3NHPA 5AKXA 4FLFA 5E6SB 1E7YA 1KYYA 3CWZA 3IP5A 4ND1A 3SZMA 2XVZA 1AGPA 3NBYC 4AJHA 4JODA 4YUVA 4MA4A 3CRVA 1SCUB 2R8ZA 4RFLA 3ZNNA 1G4HA 2YWRA 1CUIA 3DWFA 4G8BA 4JP5A 2DQSA 4LQLA 1P7PA 5CW1A 4DR4B 5FPQA 3C74A 3HKCA 2CCGA 3JRNA 1MAWA 3I28A 3G13A 3OCWA 4OBXA 4WOKA 5FBQB 3RBAA 4BX8A 2IHUA 5A03A 4C7BA 1ULUA 1GA1A 3PDWA 5AVSA 4JLAA 5JW6A 1GZ6A 4Q1EA 1PEKE 3GLVA 2YOGA 1V47A 1YKFA 4GM1A 1SELA 4IDEA 3KB2A 3T9BA 2ZXUA 3K71B 3BGIA 2LIVA 2QYSA 3S68A 5L4SA 4FYVA 5TPWB 3VISA 5LQCA 2QT0A 3W5BA 2DVMA 3OJEA 3W8NA 1CV2A 3CJQA 3QUAA 1I1QB 1FMTA 3DZGA 3Q8MA 3MAGA 4F60A 4ETIA 4YUXA 1VLMA 5AYVA 3CG0A 5ICFA 4JL8A 3DL7A 3A7EA 3JWPA 5CW2A 3IR6A 3JQ9A 1HNZB 5DHFA 5HF6A 1E0DA 1M72A 2J5XA 4XPIA 3HZOA 2YVUA 1PX2A 1SBHA 2YVLA 1A04A 1NVWQ 3S7TA 1N4DA 4K88A 4WW0A 4Q00A 3EAFA 4BU0A 3E3LA 4MNTA 1XVLA 3DV2A 1SUWA 1QQAA 1E6CA 1KH3A 1MVNA 3L1JA 1BGXT 2Y1GA 3B6JA 3FGZA 5DM2A 3AY7A 4D9NA 5GONB 3I58A 3BH6A 3V2HA 4CV0A 2ZUFA 3DVAB 3CPJB 3CRMA 2Y1EA 1LA2A 2LW7A 2SBTA 1XKTA 4IXTA 4KH1A 3NEYA 3NKLA 1GGVA 4M0KA 4AD8A 2IXGA 4ZOLF 2WLSA 4FYWA 2EFDB 1G20A 1KZHA 3L04A 3ANYB 1RPAA 1GGFA 4ERXA 3WK7A 2CJPA 4HH4A 5CB4F 1SR8A 2O8BB 4KVGA 1U6IA 3TNDA 5CEJA 2QUIA 3E5RA 3V3TA 1EXVA 2CL6X 2KS6A 3NHYA 4BJ6A 2EV9A 3WA6A 2ZRQA 3SOZA 4A0QA 4BC1A 4MDEA 4CUKA 1A4IA 3AQIA 3KS9A 2GHIA 1GA4A 1M2GA 3QUTA 5DI9A 2G77B 3DV9A 4OO3A 1OZGA 1X6VA 4UBIA 4YMIA 1M2KA 1J90A 4EGJA 2FY8A 2GWRA 4REQA 4Y6QA 2ZS9A 5GADl 1X3SA 3IBGA 4L2IB 4BTLA 1LS6A 4DTCA 4DWJA 5LQKA 3DT6A 2H4YA 4KO3S 4X93A 2JHPA 1T8PA 1LK0A 3DE0X 4MVJM 2Q6VA 4D98A 1HPLA 1Q15A 3P20A 4QBKA 4KR2A 4GZ5A 1T8RA 4FGKA 2O8DA 4AIIA 3T41A 1RWVA 1TTPB 1GRCA 4P9NA 1T2FA 1DJOA 3ER9A 1A9OA 2C00A 1SZJG 1V4BA 2ZZKA 4E5KA 2WJ6A 3LP8A 3T7RA 2UDPA 3N75A 2WQZA 4AS1A 3ROFA 4BQFA 3UGQA 1NNI1 4MCAA 4U02A 2ECKA 3V1YA 2I1WA 3ZX5A 4J0IA 2WFZA 3GD7A 1C1DA 1YUMA 1U8UA 4JB3A 1T9DA 2A0XA 2W2PA 4LJ9A 1OU4A 3ZI4A 2Y9MB 3JR7A 3H4VA 1KI3A 3WAJA 4LZPA 1S89A 4H3SA 5HR5A 1ZVVA 1IEWA 3PYMA 4DQKA 1NL3A 1J8DA 1VI6A 3LT4A 3HL0A 3M6LA 4JAVC 5T3YA 3JWGA 3SDSA 5A9SB 4X41A 2ZIXA 3TX2A 1PWHA 3PA8A 5DASA 5ALPA 4C07A 3RRFA 5I7RA 1RJFA 4OPMA 3VZRA 1H8EA 2ZIAA 1QE3A 2FCAA 3K9NA 3ZU4A 1FFBA 3KLNA 5JRJA 3JSAA 3WNDA 1Q19A 3K4HA 4MP6A 4FCCA 3VX4A 4BFVA 2D1RA 3DT9A 1ISSA 2GZDA 4F4CA 2ID4A 4Y9TA 5K3SA 2UYOA 1YC5A 3X1YA 4FMPA 2VTDA 4E1VA 1ISRA 4I0WB 2GPWA 4PM4A 2FW9A 3IOCA 4R9SA 3QVVA 1GGJA 2C57A 2RD2A 3O2NA 3FGOA 1ESMA 3NNDA 5LFAA 2CXSA 3IERA 1G8KA 2DR0A 2ZJOA 5KPDA 1K7YA 2V7EA 4BO1A 1SHLA 1HYHA 1QMPA 2HC9A 3TXXA 4GGMX 5HK8A 3VZBA 3NETA 4OQMA 1FXSA 2HTFA 3IIMA 5AOCA 1N1EA 1V8DA 5EESA 5CLFA 3KQOA 1T26A 4QM7A 4R41A 4CQLA 4ZTBA 3NWJA 4YXFA 1KSJA 2XODA 1QAQA 2Q0HA 1XXLA 4L95C 3PCTA 4JBGA 1XU4A 1O5IA 3K96A 3F3MA 4PLGA 1I7QB 2PMDA 2GF2A 3G2NA 1LDMA 3PKIA 4LJ6A 4HCJA 1G21A 1W88A 3FTCA 3LXXA 5CNKA 1S1CA 4O3MA 2YUTA 2W5UA 1LDNA 4IV5A 4HQRA 4KLZA 4UHFA 2R79A 1YVPA 3LHSA 2OYRA 4W5OA 3EAQA 3L8HA 4XQEA 3TNJA 2FTKE 4XYLA 1BDIA 1JSXA 4BXOA 3EYAA 4CV1A 2PS0A 1GG9A 1EDEA 1QFSA 1T5HX 1VRVA 1DAIA 1EVLA 1S01A 2PSEA 4E3ZA 2JIDA 3VNUA 2XRZA 4ZQIA 1TCBA 3M4ZA 2ZJAA 1X3LA 2OECA 3VI4B 2ZYWX 3HDVA 2K5UA 3LOQA 4M2LA 2FGJA 2GZRA 4XJVA 3PUJA 4HXFB 3GEEA 2FFJA 4GBMA 1RFGE 3IH5A 4WOCA 3O4JA 1BH2A 4P4TA 4HUTA 4Q7QA 5BSGA 1K4MA 3W2IA 7MHTA 5AOBA 1ECLA 2Q4EA 4MVJG 4A6PA 1SKBA 2XITA 3LHIA 2E87A 1B93A 1O96A 3OEED 1VE9A 2C2OA 2FQ1A 2G6TA 4AJOA 3EVZA 5JYEA 3OQIB 3GGSA 5ALGA 1PEDA 2X3UA 4DANA 4MVJF 5ICGA 2DHRA 3QWIA 4UXJA 2X0EA 3RYHA 1N2ZA 4PF1A 1HURA 2D7CA 1DEOA 3D5QA 3IKLA 2QT9A 1UOPA 5B58C 4QJIA 1DBPA 3WS7A 1NG9A 2HW8A 3MIZA 2R8YA 2V7QA 4OXXA 3T99A 2C5HA 3HJTA 1MEJA 4HVLA 4MHSA 4R2WA 4MUFA 4GL4A 2HPVA 2JGFA 3AHGA 2CE7A 4JL5A 4NICA 4JSYA 1AQIA 2F3SA 3RK0A 4NC9A 2ISSD 4QARA 1WF6A 5KJ1A 4FW9A 4U9IS 1GADO 4G0MA 5E1DA 4FDMA 4PZEA 1PW5A 3E3AA 3EQ6A 3D54D 2RKOA 3DYIA 1FFGA 1FDVA 4LX0A 1LPBB 3OTWA 1Z22A 1RM4A 2OHHA 1TVCA 2YFQA 2GBLA 2QN6A 3GLHE 1CKEA 2C0QA 3BYZA 5CYOA 2C9ZA 3W9UA 1DBRA 4JLKA 4WL0A 4EAQA 3F3KA 3LO5A 3OJCA 4MYCA 1XX6A 1J5PA 1QYXA 5IUKC 2UZ1A 3IVRA 4C7OB 4IPTA 1ODFA 3CVUA 4TSKA 5CRIA 1MRZA 2OP0A 4RACA 4HGPA 2YZNA 2E18A 4YJHA 3CF0A 4B3RB 4ZAWA 1NI3A 2HQRA 3BC1A 3GDOA 3KQLA 4CM9A 5H16A 4EDHA 1FE8A 3EDCA 1LV8A 4Y2UA 3QU7A 2Q6TA 3AVXA 1VL8A 4E33A 1IRXA 4RJKA 3MMXA 2AW3A 1NKTA 2EBFX 4D43A 2F43B 4F21A 1OWPA 1YS4A 3R3VA 1TEXA 4FFNA 1E1CB 1TUIA 4C0WA 4ZVSA 2VJOA 1GR0A 2C5FA 2OBMA 4P38A 2BC9A 4EJ2A 1CE8B 2YJ6A 4HR7A 4L76A 2HMTA 2OVFA 1W1WA 1MMFB 2F1JA 1T2AA 2AFHE 2XXBA 3OE7A 4XX1A 4AJEA 1TYDE 3F4KA 3FPKA 3K15A 4G0OA 5ALQA 4EEZA 2L19A 5EXPA 3VH4A 1Q1NA 1T5LA 3WGTA 4NR0A 5LUAA 3C48A 1C9KA 1P17A 4YAKA 3N0XA 2NACA 1WMDA 1Q7BA 2I6SA 1VA5A 2ZJYA 3LCRA 1MC5A 3DONA 2ZROA 3QBEA 2NN3C 4QGGA 1AU9A 3HN6A 4YJGB 1X9GA 5FYQA 3FNIA 3TE7A 3UOWA 3W7VA 4BAZA 1EUYA 2J4FA 5HJ7A 4F8EA 5G3ZA 3VU0A 4XI9A 1J39A 1FX0B 1V1MB 3H05A 4KDCA 4O4HB 2GM9A 2DPYA 2QPAA 3EG9B 5JPDA 1JJIA 1DC4A 4C3OB 1QNFA 1W0KA 3U3OA 4CR7A 4Q1DA 3EWIA 3ILHA 4HADA 3W5UA 1QX4A 5BYKA 7REQB 3MCAA 5AM2A 3CH7A 1FZTA 3GCWA 3IP9A 1T5TA 3ZWNA 1Z0JA 3KVRA 1AQJA 3OIDA 1SG0A 1M34B 5GV8A 1LTQA 1KIMA 4GUAA 4D9KA 3Q8XB 5LB4A 3I34X 3C1TA 4GZ6A 4I6EA 4P5PA 3RE1A 3VPGA 4DY6A 1JWBB 3HYTA 1M66A 4IIHA 3C6KA 1AQUA 4L6AA 4MMYB 4NCKA 3WR5A 4F12A 4O02B 1H6DA 1GM5A 1HDOA 1SC4A 1YS7A 3CXRA 4WEOA 3JQAD 1WBBA 3CEJA 3TZCA 2P91A 3FRJA 2V6GA 1W2GA 3GP5A 5AP9A 3VAZA 2AZXA 2QVGA 4DA7A 4N5MA 2V6FA 3EASA 5AVRA 2E21A 4FFPA 4YPOA 1WV1A 3DPUA 3PVSA 3DTVD 4IDAA 1HH4A 4EBFA 1KGDA 2VF7A 3EDOA 1AN0A 3HLKA 1V7ZA 5J9FA 3ZHVA 4C0AC 4UBLA 4GEGA 4BO5A 5JNVA 4X1KB 4OHFA 3CFYA 5DW3A 1HO3A 1KAHA 1W6UA 3PXAA 1XZGA 4H08A 3KTAB 2BMVA 4EY5A 3CG4A 5IDWA 1MUUA 1N5RA 2MR5A 1A3CA 3FE2A 3KHKA 4LDQA 2ZT8A 3QJ5A 1SUBA 4URUR 3VPCA 3AKZA 1G7RA 3SF8B 5DNDA 2HV9A 3CRNA 2PFKA 3R77A 3DXYA 2YOFA 2J3KA 4Q1AA 4C4TA 4WK0B 1Q0HA 1SXIA 2G72A 2E4VA 2AV6A 3BHJA 1G4UR 4N48A 3HCNA 4OQPA 4B83A 3GGDA 2J30A 2JAPA 2W2TA 1CJVC 1FP4B 2WSYB 4K7JA 4BP1A 2C4TA 3L93A 5F1KA 3E05A 3H04A 1Q22A 4M0LA 5LLTA 4IICA 5F2EA 2ADMA 4XYEA 3CTPA 1GPLA 4LHYA 3DDCA 2O20A 1U8FO 4XTCS 1BXGA 2XDWA 4WNAB 1E9FA 1W85A 5H3HA 1T3SA 4PCLA 1ZI9A 2ZTMA 4BEVA 4E7PA 4ESOA 4UNRA 8MHTA 4FINA 4KZKA 1AUPA 3EMDA 3ZYCA 1MX9A 1JDUA 2FMUA 3BRWD 4P33A 4PCVA 2O2JA 3GQVA 5HX7A 5J43A 1MJNA 1T91A 2OV8A 3IMKA 3FCUB 2O7RA 4HFNA 1P2VA 3VH2A 3WBJA 5ITWA 3Q6NA 2O2ZA 4XFDA 3G2LA 2ZSJA 3R0IA 4BMOB 4X90A 3U9SA 1TUGA 3FFXA 4IIEA 2OR3A 3TLAA 1RC0A 2QXYA 2EKLA 1JHZA 1MW9X 4CV3A 3SK0A 3MCUA 4BXOB 3SR3A 1TYBE 2JGDA 3DEKA 2I4OA 1OLXA 1QGAA 5D01A 4OHVA 3TZLA 5JAQA 1XQXA 4D4IA 3ZJUA 1G9SA 2QQFA 3T3PB 1BD4A 1EFUA 3LQYA 4R8MA 4YK7A 4B35A 1QQBA 2A0UA 3RARA 3QV2A 2Z0MA 4NZMA 1TF5A 2AF3C 5ICSA 1VC2A 3CTMA 3V33A 5DLDA 3NBQA 3I12A 1F9EA 1JG4A 2VT2A 2A9FA 5KYUB 3D1VA 3PRYA 1IXSB 3IDAA 2O8CB 4IIVA 3IUQA 4H6WA 1IDN1 1E0JA 1MZPA 1KZGB 1HKUA 1JDPA 3PFIA 1KEVA 1WY5A 2YIJA 2C77A 3OLCX 1KU0A 4JOBA 1X13A 2I8LA 2JD1A 3NT2A 2BGTA 5E4JA 1AXEA 5GJVC 4D2IA 2FMFA 1D2AA 4L5BA 2DG2A 4LXIA 1ZNXA 3L6CA 2OY0A 5LKAA 2ZS8A 2VEOA 2Z58A 4M22A 5DYWA 5ARBA 1K8RA 1H9AA 1QYRA 3R44A 3U40A 1HTTA 4FIDA 4K6GA 1GCGA 3GFRA 5BSRA 1Z38A 3OZUA 4DHWA 1WHSB 1EZ4A 1TMGE 1LLUA 4C06A 2GN4A 4IHJF 4OBEA 1VSTA 1XTIA 2PYIA 1DX6A 1N2CB 2JGEA 4YMVA 1P74A 3R9KA 2FUG1 4BFTA 4MLDA 2RHMA 2Z8YM 4R1OA 2QXTA 3IXQA 1YJAA 1E6EA 5JLAA 3JQ8A 3PENA 4LNUA 3KZ1E 3MN1A 3C1AA 1KFEB 4M9XA 4ZRNA 3UMSA 4PN7A 5KTTA 4J94A 1E69A 3FYCA 4D57A 2QD2A 3EZFA 3IELA 1Z0ZA 4V0KA 3ZX4A 2PUAA 1AKYA 3HDJA 2PBLA 2HIMA 1K08A 1L7OA 2GUGA 3OT1B 5GGYA 2IS1A 2EKQA 3ODPA 5CD9A 1PQYA 2IYNA 5DNCA 1XPRA 1XNHA 4Q34A 1XEXB 3DMTC 3D31A 5K0LA 3P71T 3WB1A 3VC3A 1CQPA 1QVWA 2QAGA 1CY0A 3QMPA 3WV4A 2NPOA 3UJCA 1H4QA 3U4MA 1KHHA 2I62A 2FQWA 2ZATA 3QYJA 1L7RA 3CMMA 3HFGA 3CEAA 4GC5A 3TOSA 3L40A 4F3YA 1I30A 1B43A 1TLFA 4IEFB 5SY4A 4BAGA 2W83A 1J2EA 3I5UA 3KR9A 4XWTA 1IG3A 2C88A 2R8EA 4LHXA 4X1OA 2M2IA 4DZTA 3KT6A 3TAXA 5AVTA 2BFFB 1RU3A 2GBFA 4Y2YA 2QQEA 2VXCA 3ZTTA 2PGNA 1CEXA 4JVSB 4MR9A 3R20A 4I36A 4UBJA 3FCXA 4QFMA 4YI3A 4GX5A 3WWPA 2OV4A 4CGYA 1X15A 4Z49A 2EP8A 3H7AA 4KN9S 1OPXA 2G08A 1PSWA 3IAFA 1B0ZA 1IZ0A 1PT7A 2WIKA 4OLFA 2Q5HA 4MA5A 3ZE0B 4TV8F 5A1TA 1NUPA 2JI8A 1GDDA 5JC1A 3K9FC 5AKGA 4OFBA 5DSZA 3IIIA 4O1HA 2P90A 4G1MB 1OBFO 4IDOA 1H1TA 3FDIA 2XMZA 1ULHA 3GROA 2ZPTX 4KQXA 3TW8A 1OUMA 4UPVA 1UR5A 1ZONA 1LWOA 1QCZA 3OG9A 4ML3A 4QOJA 3PFGA 1HDZA 4QNRA 4ZQHA 3ZXUB 5AESA 1XP5A 1T2EA 4OP2A 4UPDA 3ZWMA 1RC1A 4IGEA 3BSFA 4Z86A 3UV7A 4AJ1A 2QIOA 3DQPA 1FX0A 3PNMA 1IC6A 1P1FA 1I3KA 1CS4C 1Z26A 2ZRBA 5JSYA 5FBVB 3G0CA 5FLEX 4CEIA 2WG0A 2OXIA 1F6BA 3N8DA 2YBDA 3LFTA 3V8EA 4UCFA 1VMKA 3V46A 4AF8A 1L5NA 3H9UA 4BKRA 1FFEA 3JQBC 4O1MA 4BVJA 3H3FA 4CQJA 3OH8A 3A6HA 3HLYA 4WXRA 5F73A 1IOZA 1LKZA 3DDWA 3EXAA 1OW3B 3PHGA 3Q98A 4WACA 1GRRA 1RM0A 1IEXA 4LE2A 4TLMB 4ZU6X 1THZA 3SY8A 3W8DA 2IHNA 1J0EA 2EXXA 1EFPA 5ERGB 1R0LA 4FUTA 5GVRA 2O5EA 4HDMA 4H0FA 1KTVA 3QXHA 1GAJA 4ETWA 5GVSA 1PEAA 4MUIA 2BBWA 3ZWBA 1L5HB 1M0EA 1EJBA 2FEAA 1D7OA 4NEHB 4FIZA 4D9EA 4DM3A 4PQFA 1M2EA 1CY7A 3AR5A 4ZCLA 4ZDWA 4A0HA 2OD2A 1RAFA 1P2SA 3FPBA 1KDZA 5CG2A 2HAEA 3B3AA 3V8BA 2PEZA 1E1QA 3KKQA 1KQNA 5K1ZA 1PZMA 3VKFA 4LV8B 2FW0A 2VA8A 1TCCA 1RJGA 2HIAA 4RSMA 1GL9B 4WY5A 4WA8A 2NP7A 2BZ0A 3JR3A 2G1KA 3GB9A 5J47A 3Q6IA 2IHBA 3FCOA 4W5TA 3D6NB 4HTAA 2GRAA 1IB0A 2BM9A 3VKWA 2CFSA 4EGFA 4MGZR 2FW8A 1YE5A 4GOKA 1RZRA 4YALA 3OQPA 3ES9A 3CN7A 3IKMB 5F1OA 3I64A 1VIYA 5ILOA 1FP4A 2E2WA 2W8BA 3AHHA 1KFBB 1FJHA 1CUYA 2GTHA 3EQ7A 3OIVA 2IV3A 3K53A 1SO8A 4HDCA 1DHRA 2GUWA 4MV7A 1W4BA 2E89A 2Z4SA 1QLJA 2NQTA 4IQ4A 4ZO6A 1QB7A 4L0CA 3VR4A 4FNMA 4WDQA 5H83A 4CKEA 1C3VA 1EUCA 4JI7B 1JAHA 2R6AA 1P31A 1J8FA 1PFKA 2DWUA 3DYVA 4WECA 3GPBA 4DT1B 1OKKD 5CJPA 3U1VA 1YI0A 2QE7A 4A9AA 2QR5A 2AC7A 5K01A 1RYBA 1TZKA 2OZVA 3PC6A 4QULA 1ZMTA 5KYNA 4HYTA 3ZYZA 4TZ0A 1E4EA 5DBEX 2WTAA 4P3YA 1PJRA 3EXHA 3A1NA 4FUQA 1CDZA 1VI2A 2QZ9A 3QMVA 4JP8A 3RSQA 4TT3D 3E9ZA 3B12A 4MINA 3CNLA 1NY6A 1W73A 2X9QA 4LJKA 1FRNA 4X24A 3I45A 3KQSA 1R0WA 4GQBA 3K30A 4M37A 3ZD7A 5CVUA 3CX6A 3Q9UA 3MJEA 1GTL1 4FK8A 1QYCA 1XLVA 2DLDA 3KEMA 4M49A 4DLRA 4Z2AA 1VCMA 3CLSD 1ZIDA 1KRHA 2B94A 1O4WA 3FNHA 3GLHA 4QSMA 4N01A 3RU7A 2WJVA 3VBEA 2QRUA 3SXUB 3FFBA 2PQ2A 4W9NA 3SAJA 1I2CA 3NATA 4KXNA 1QG6A 1CUEA 3CONA 8ATCA 2XBLA 2XF2A 5HIIA 4ZU1X 1PRYA 2H7XA 3ACCA 1DO8A 3PSAA 1I4LD 4TV9A 1R18A 5JZBA 1T9GR 1JKMA 2Q99A 3L05A 2R1ZA 3D0QA 5EHZA 3M5CA 2EATA 4YR9A 2O2HA 1PAUA 2V5UA 3DMRA 1Z5UA 2PFSA 4O4JB 4QOEA 4GVPA 1WD7A 1F3OA 2IRWA 2QZJA 2OTCA 4J1NA 1LK7A 1NURA 2A59A 5FD8A 1LZLA 1NF9A 1NONA 3PUYA 2REBA 1KWGA 3GLGB 1L4LA 1DJPA 3M9LA 3ZOKA 5C32A 2WIDA 2XYPA 4KX3A 2LTAA 1WLSA 3QW2A 3R6DA 5IJAA 3U62A 4B3GA 1N2JA 2XNJA 3WGJA 1N36B 2HHLA 3PPWA 4B6GA 3ETCA 1HX7A 4ZRDA 1U2GA 5GINE 4UFPA 1Z8FA 1FU8A 2P5TB 2VHWA 3L8YA 3PX2A 2OXRA 3WO1A 3PPYA 4OKIA 2HCJB 2ZZNA 2VK4A 1T1IA 2VJNA 3F5QA 3G7SA 3SG0A 1SWWA 2BT4A 2ZE7A 4UREA 1JLMA 3M49A 4YDQA 2I7VA 2V6MA 4PYIA 1YZUA 2QMYA 2PU7A 3D4OA 3EVDA 3MTAA 3O8BA 4Y1RB 3NP9A 3TMKA 4KBGA 2Z3WA 2Y8EA 1QNLA 2ZSDA 3RTBA 2HSGA 3OKPA 4M0DA 2ZJ2A 2PL9A 2PKRA 4Z9BA 2PT7A 4Z3KA 1G18A 3SIPA 2PMEA 1DWUA 1XXHB 1K3UB 4AJ9A 2ONJA 3VXKA 5D7BA 1C7FA 2DFLA 5G1OA 1YI8A 3O1IC 3NNSA 1IVSA 2IPOA 3PHJA 5JU6A 2VPWA 1WHTB 1MN6A 1W30A 1C2TA 2QAGB 2YY6A 1QHHB 2BR3A 3PQFA 4TLAA 2QYHA 3SF8A 4D3FA 4YJFB 2DTEA 1EBBA 2J3JA 5HPYB 2GHRA 3AHJA 3TIFA 4CEHB 1NHWA 2EBWA 3EC1A 4LDZA 5JBQA 3FPAA 3UICA 3EOAI 2RGDA 5IANA 1JAIA 3UT5A 5J5VA 4UM9D 5AJUA 2WF8A 4F92B 4RA9A 1V37A 1MH1A 1WPGA 5AW8A 2V0GA 1NUAA 5BRAA 5EY5B 1OX5A 3F90A 3SEQA 2RGNC 1MJFA 2QW0X 3HQ4O 2O9JA 1WV0A 3GGOA 3L7AA 1T9HA 5KSZA 3L4JA 3MD9A 3H9CA 3GFVA 4PTZA 1XEWX 2BUCA 1X77A 2A88A 2CXOA 2KM1A 1EI9A 1NPTO 3MEQA 1UAAA 5TF4A 4LX8A 5EKSA 2B8TA 2ZTUA 3H17A 1KE1A 4UOZA 3SD7A 3E9EA 5H3LA 3MJCA 3RRMA 2WKWA 5LDGA 1W52X 2J87A 4RHCA 1CX9B 4ZCPA 2VZ8A 1QIDA 3UUWA 5IN5A 4R9UC 3TSYA 1Q50A 3CVYA 1B8NA 4X95A 1W59A 3E9CA 3TIVA 4CMHA 2H9AA 4G6ZA 2X15A 2JGAA 3FVVA 4HQNA 4DCPA 2ZM5A 1F20A 4YMUA 5JO9A 2AMFA 3AR8A 4K8OA 4DUGD 1XDWA 3QLVA 1AE1A 2VQDA 2PBFA 2VDKB 3D4PA 4NJMB 3EBPA 2GJ4A 2FZCA 2Q3MA 4X65B 2DZDA 2RGEA 3KYDB 2Z2ZA 5BP7A 1MCZA 3ILYA 1J0BA 2EJCA 4Q66C 4JJ4A 2AD1A 2GBCA 3WSTA 4ZIRA 3W4JA 1IHPA 3N86A 4LY9A 3KC2A 1WE2A 4B17A 4ZOLB 2ZIWB 1QTNA 4GRDA 4Z54A 4EKYA 3A3KA 4CCSA 2GETA 1U0RA 3MERA 1LJUA 3DB2A 3CB2A 3GO4A 2G6BA 4E88A 4F3CA 4MMZB 1IN6A 3V32A 1CP2A 4CTOA 3G5AA 1VKRA 3HSKA 3V8QA 4MTLA 5KYXB 2VUSA 3F3SA 4I3GA 3COJA 4JI0B 5AQ1A 4JDUA 2C4WA 4BNNA 1B15A 1IBKB 3B2NA 3DMYA 1F8XA 2C42A 4FFLA 5LQDA 2EZTA 3OZIA 3TCKA 5IX8A 1MRSA 3VHRA 4CLDA 2MMCA 1BG6A 4IWYA 3I9MA 4N5DA 4E5DA 3Q5EA 3HU1A 1MVLA 2NO5A 5FTWA 4LYGA 4RY8A 2G8LA 4JI1B 3KWJA 5ILQA 5DNUA 1NKSA 3SQXA 3KJNA 2RHLA 4LKOA 2W93A 1DT3A 3S27A 1RI2A 3R74A 5B37A 1L8OA 2H4HA 4UVGA 3THYB 3QF4A 4UNNA 3O3CA 4FT4A 5KNDA 1RQRA 4RZUA 5F5XA 1UPAA 4QUIA 2J08A 4DL9A 3MS4A 2P75A 4Q9AA 4QTZA 1A9QA 1ND6A 4JCOA 3ICQB 5TQ0A 1C0PA 5C18A 1JAXA 2JCVA 1JEJA 3IDFA 5LQNA 2CV0A 2FWBA 2FW1A 3KEFA 1NF3A 3DZFA 4IIYA 3IKTA 4EPWA 3L9TA 2PWYA 1E3IA 1VIMA 2NZ2A 4B2IA 1NP6A 3VNSA 4JLUA 1CJCA 4YWJA 1OXXK 4FR5A 4EJSA 1YD7A 3L4EA 4LDPA 2JGLA 1E4VA 3V4FA 4QXQA 3OX3A 5DGCA 2YINC 1O5OA 3BXOA 3U5ZB 4NCIA 2J9ZB 4L73A 3THWA 3U7QB 4EZEA 4UOEA 4BTVA 1JEEA 1B42A 4LRTB 2W9XA 5ALMA 1DT5A 3ELWA 2WF6A 3PWTA 4L02A 4BEJA 4BVFA 4CUZA 4D1YA 4POOA 1H8HD 1U2EA 2ZTHA 3CPEA 3F9RA 2PNJA 3SVZA 2JGKA 2EARA 3WWEA 2IXBA 3PNBA 3THOA 4D8TA 2E4WA 1C8BA 5TGDA 2FRDA 3FYTA 4UMVA 2HIGA 4MVJD 3DLPX 2A84A 1PIWA 4I6JA 2BKXA 4RD0A 3R5FA 3STVA 2CZQA 1A2QA 3R5KA 4GBGA 4M8IA 4BJ3A 1AHHA 4LV6A 1Q0LA 2FLVA 5CB4A 2FWMX 5KOHB 1H3NA 4X62B 4X66B 4AECA 2EP5A 4Z3OA 3GNLA 4IVPA 1GKLA 2QAGC 1M1YA 1T1EA 2AWNA 2DPLA 3EBLA 1NV9A 5G4LA 2FN8A 2BFCB 1MZVA 2X86A 2G9QA 3G49A 4ZA2A 3W06A 2FQXA 3LBFA 5KSYA 3NB0A 3JQFA 4HVAA 4GPTA 2JLCA 3TDNA 1FFYA 5AHRA 4R81A 5DYNA 1HDYA 3CZCA 4C3UA 1W36C 2ZCVA 3G8DA 2H17A 3O8OA 3P52A 1RXIA 3B48A 3CR3C 3CKLA 1M2NA 1SC1A 5C34B 1Q14A 2CXNA 1B41A 2H1RA 2H3EA 2P9HA 2QI9C 2Z5VA 4PLHA 1T9ZA 4KJZA 4RS4A 1XF9A 4PLWA 1UFVA 3ZBPA 2GO7A 3QEJA 5JJBA 2H1OA 1GTVA 3WLMA 3CZPA 2KWIA 4DXAA 5HZHA 1TPYA 2OB2A 4MV5A 3TRDA 5IKEA 3K09C 5FQOA 1CY1A 2PVCA 2PKXA 4DA6A 1OYWA 1TYZA 3MGCA 1XJQA 5HKKA 1PGNA 1DAGA 3TF5A 1ZW6A 2OAEA 1SHZA 3X43A 3EZYA 1MU0A 5LA6F 1GKKA 2A58A 4GNRA 2AB0A 5BQOA 3GP3A 1W5AA 1T4CB 1RAAA 3BWXA 3GAAA 3QUQA 4QHTA 1SU6A 3S40A 1KZ1A 1E58A 2CYAA 4GOJA 4MUXA 3B51X 3A1TA 4EQZA 4AY6A 4O8ZA 3CH4B 3S5JA 3B2EA 3HNOA 2HSJA 2JHGA 2P9CA 2WHYA 1GCIA 3AYXB 5G0WA 3V9PA 4J91A 4H7PA 3M33A 2BHNA 1TM2A 3QPWA 1CFJA 1O97C 3D4BA 1QRTA 4I9UA 3SYTA 4UM5A 2P2LA 4M60A 1W29A 2EQAA 4A16A 3U4HA 4D3ZA 1JEYA 1ZD8A 1C3LA 4JEHA 3TOZA 3RK4A 1VOTA 3HC7A 4BVLA 3L7KA 1VBMA 5JDCC 1JZSA 4CTNA 4MW4A 4ZHQA 1GNQA 2C7QA 4OQEA 3RFXA 4RLHA 3AP3A 2X9VA 3H19A 5G02A 5AVKA 2XZPA 3TTSA 4EGSA 3OUUA 1CIVA 1DXOA 2RJOA 2Y4NA 1KYTA 2L69A 4NAHA 3QKRB 2YIVX 1F8YA 3PFBA 5AVYA 2HHAA 2ZIFA 3LMKA 1V5FA 1GGKA 1EX1A 1HM5A 4UNSA 1LVGA 2GFIA 5CNMA 5LWHA 4IQ0A 2XOXA 2B21A 4FYHA 2RKWA 1VCNA 2HO4A 2LCIA 3OEWA 3PQ6A 2FMME 1SU4A 2WM9B 2Y92A 2I33A 3MS7A 2YWGA 2CE2X 3B5JA 3QLEA 4XKJA 5CLIA 2IH4A 1TZJA 3LYLA 2C5GA 5KKAA 2IHKA 2VJCA 1T8YA 2PKQO 4MYHA 1HORA 2ZUTA 4X3OA 3ZWXA 3DZJA 3K9WA 5ILGA 4FZ3A 5FBRB 2PKCA 2FPGA 3OFND 4EPYA 3N0WA 5BSVA 3GUYA 4JUBA 3PEYA 2XF8A 1TU0A 4B3TB 4RYDA 1SQGA 2ZRMA 1XQWA 2F8MA 4RZ3A 1IBLB 4PNHA 5KU7A 2OESA 1FJXA 1R5JA 1JI0A 3CZ9A 4B84A 4Y2HA 3OM9A 4CCYA 1D5WA 4BVAA 5BNTA 2XVAA 4OXQA 1YDHA 4QFDA 2OGUA 3KOWA 5LPNA 5L4NA 2CSUA 2HWUA 2X2EA 1Y3BE 1N57A 2VWQA 2YFHA 1VLHA 2HA2A 2PMKA 2EFEB 3I39X 5LQSA 3N2EA 3T4UA 3W9SA 3G0OA 5J63A 5BW6B 3JQGA 3L4KA 4O4JF 4D97A 1UH5A 1ST2A 3DR5A 3WL5A 1MXFA 1O95A 2QX9A 2D00A 4HZGA 3AEUA 4XIJA 3NWOA 3FTFA 3X1KA 3VR5A 3R5SA 2WHPA 5LP1A 1QZ3A 1RJDA 3HGQA 5A4FS 3ND7A 3TW4A 5HUQA 1YHYA 1NAHA 1US8B 3FF4A 4OFZA 2ZWPA 2EOAA 4J0DA 3PEVA 4FT2A 2XNCA 1GN9A 2Z9DA 3PXXA 4O4IB 2XGSA 5AM0A 3WIUA 1GSIA 3D3KA 3URMA 4BQSA 3HKEA 5HQTA 4ZI7A 3SBXA 1O0CA 1A9ZA 2WU4A 4GNKA 4FCVA 1P60A 2AKAB 2OHVA 2ZBFA 2PYDA 2WYVA 1HLPA 3IQFA 4GOLD 4ZVOA 4ZO7A 2CHGA 2JFHA 1MA0A 1MX1A 1R5OA 3IBFA 3REGA 5I7UA 2OHXA 1E3WB 1R6VA 1YVRA 2DR3A 3THYA 1M6WA 4DDUA 4XA8A 3G0BA 3PUZA 1ITZA 5K7SA 3PNSA 1UINA 2NG1A 3EXG2 5KYWB 2ZRAA 1TKCA 4O29A 1YBVA 3W2EA 4KV7A 4B3HA 5EIAA 3TQSA 2RARA 3OBIA 3UFBA 4G8CA 1KQPA 3GPLA 1W36D 1IHUA 4MCIA 1I2AA 1HZZC 3SZLA 4AM8A 4DUZB 2HTEA 1OTYA 1PG0A 1IQ0A 1YIOA 4HRVA 1DJQA 1TAQA 5ANRB 3ZDAA 3EXHC 2H1FA 3O1LA 4QYXA 3VV2A 4BQEA 1PWXA 2Y1LA 1T8UA 1AB6A 3UGKA 4CPDA 3I52A 4OMUA 3O75A 1D09A 1T2CA 1XQVA 3MRSA 4NMLA 1OT5A 5JVDB 3OOEA 3C3JA 5NULA 1VL6A 1Y6JA 4P8RA 3N2KB 1KI4A 3ZQ4A 3SXUA 3D2LA 1CNEA 3G3EA 3KB8A 4GF5A 3TG8A 1BFUA 1C4KA 1FYDA 1O6BA 1Z0KA 2WB4A 4BWYA 4ZCMA 5LOVF 2GEVA 4LJRA 1BS9A 1E3JA 2V7UA 4KX5A 1YB4A 3FSGD 3KQVA 1IY9A 4DSTA 2I1QA 3EN0A 2NP6A 3ZVNA 2B1IA 5GZ1A 2YZ7A 2DF8A 4YUYA 3V8MA 2ZVDA 4REMA 4ZHQB 1QIKA 1UOQA 3N0VA 3IVAA 4QG3A 2WINI 4GRIA 4UTNA 3GMDA 4L75A 1J0XO 3B89A 4LHEA 3V2UA 4ARZB 3QE9Y 2EGGA 2WJ4A 4KFUA 4LSGA 2X0IA 1R0ZA 1CNFA 2GBLC 4IUCS 4Y2RA 4UVEA 1B4DA 1TQ4A 3OJOA 4GXNA 4IS2A 3GLKA 2V5AA 3LY8A 1KDRA 3MCTA 4I5EA 2VBIA 4DC1A 1YBMA 4WKOA 4L0MA 4EW3A 5JTUA 3TNYA 1DX9A 1UWVA 1PL7A 5E0OA 3W9BA 4AUMA 1P8AA 5A4JA 3UMRA 4GD3Q 5AH0A 4NU8X 4ZMBA 3S0JA 5HCUA 3HM9A 1G98A 3GA5A 5BMOA 3TD9A 3I05A 2MU1A 4OQQA 4AWBA 3UK0A 4B3FX 2PRJA 4NULA 2JFZA 1D04A 4WN9B 1EX7A 4MV6A 4XB6B 2AX4A 5L7YA 3GXOA 1NC1A 1VJ1A 2EWVA 2YFKA 3MWDA 4GLBA 5BWLA 5FTNA 1RBZA 3V55A 1NP7A 1F9AA 2DHDA 2PAFA 1NF2A 4YRQA 1WG8A 2MIIA 1YZYA 4OOFA 3A04A 5GJCA 4PLPA 5EZYA 2B25A 1O96B 3H65A 5CA1A 3H97A 3T0GA 4LAFA 3USCS 1QHHA 5H9WA 3HZHA 2XTZA 1N5LA 4F8JA 1AMNA 4YP0A 3WKCA 2V96A 2FWAA 2OMEA 4LBWA 2OO7A 3BBPA 4EHBA 5IAAA 1V35A 3AH8A 3GJRA 2VC2B 3EG5A 1KI6A 3GNTA 3LUPA 3IQDB 4MDHA 3HVUA 3IT1A 3TW6A 4GAEA 2W0MA 1P33A 3RQIA 3CHYA 3QX3A 3AO0B 3IAS1 3INNA 3BJDA 5KWSA 3LYAA 2TRSB 3LUJA 4IIFA 4G41A 1NFQA 3U9LA 1WXEA 5U1PA 2JBWA 3D5EA 1YAHA 2H7YA 2I4NA 2M32A 4J0GA 2HLPA 3ESRA 3WSWA 1BAPA 2W43A 2AXEA 2RGNA 2HA5A 3FKSD 4U2FA 3S2GA 1WUYA 2BL4A 5IYZA 5DT9A 4KBYA 2Q6LA 2X0NA 4ID3A 2ZKLA 1K8QA 1QVZA 2JJYA 4JX8A 2ID8A 5JS2A 4QPPA 4RYLA 5CIYA 1W85B 5EUBA 1R66A 2QQ5A 1A96A 1AURA 1O7JA 4KKVA 4CMGA 5C5CA 2JEZA 2G3YA 1NASA 2GDZA 3SEZA 1F2VA 2IHJA 2ZWAA 3LPMA 4GKAA 4UXIA 5B3AA 2EDCA 4ARSA 1C9EA 3MJSA 4J6FA 2NV2B 3T7CA 3ZD9A 2AFIA 4BFUA 3JQBA 1F5SA 3MJVA 4DN6A 1D0VA 1MW8X 1MO3A 5I51A 2GKOA 4A92A 4KR7A 4Q3CA 1BA3A 1X80A 2ZI3A 1C1XA 4G56A 4GYJA 4MMXB 4XSHA 3ZW8A 4XUGB 1AKTA 4FU0A 3CGWA 2Q3JA 1BQEA 1DELA 2B6NA 4HTFA 3LX6A 4PAWA 4C01A 2X2FA 4KQFA 1EK5A 3VUFA 2K87A 1B0UA 1PT9A 3P9NA 1R6UA 2J6HA 3OC6A 4YJ2F 3WSVA 1WB9A 1NBIA 1NP3A 4B6FA 3PI6A 5B3JC 1ENOA 1FX1A 1S3GA 5D87A 3GXBA 1TA9A 1TB4A 1N2IA 1HDXA 1SBQA 1YJCA 4LOIA 1AKRA 5E0KB 1ZU4A 2WQ6A 1FTNA 4OU4A 3MF4A 1XQ6A 4QGHA 4QUKA 2ISCA 3KKMA 1J8YF 1ZN9A 4QD3A 5L3SB 4LPSA 2JKZA 2WAOA 1PWZA 3PTZA 4MIEA 2C7VA 3NC1C 3PX3A 2WWYA 2GCOB 1DJLA 3LCMA 3M9WA 2YW9A 3QVKA 3R7FA 4E13A 4JX9A 3CWQA 3D59A 3F98A 1NYRA 1TM3E 2IQ5A 3KK0A 1Y6ZA 4FCWA 5D3QA 3VHXB 1HOXA 1C0EA 4WXHA 3BIOA 1IDOA 3K2EA 3NEJA 1ZKDA 1P9WA 4X7BA 4EMSA 4XD7A 4LC1A 1R8YA 1DO2A 4C04A 2DXIA 4OQ4A 5TRTA 1W4ZA 3G5TA 2I4TA 4H7EA 4YP1A 3PQDA 4UC0A 4HZUA 1HYEA 1JXOA 1WHSA 4BO9A 3V1MA 5FPKA 2QG6A 1GUDA 3CSDA 1AIPA 5IAGA 2QLTA 1M9NA 3UUGA 1MEOA 1NBEA 2YWJA 1VE5A 1HRKA 2DFDA 4U2EA 4ZI7B 3O73A 2HV8A 4P4SA 3U3RA 3ZD8A 3LC2O 4WUTA 2ZQZA 2DKOA 1ADGA 3C5VA 3ZV4A 4BNXA 4TL7A 3WRYA 4HMQA 4TSRA 5AW9A 2O0LA 5F52A 2NWQA 2YWEA 1V9CA 3CINA 1MQSA 1AHNA 5A0FA 1N3IA 2PA3A 1YQTA 2PH5A 3NAQA 3QFCA 4I4LA 2KBEA 3R3UA 3B1FA 4OXKA 3LJKA 4B43A 1V8PA 4BCDA 1PNVA 1X42A 2C03A 4EJSB 2A67A 1YE8A 1I4WA 2D1FA 3H2BA 2UZ4A 1RRMA 2JG3A 1T4CA 4NYJR 1PG5A 3GK3A 3H99A 5DNYB 2PQ6A 2X7XA 3ANMA 3FBTA 4OQFA 1FSSA 1Q1EA 3OX2A 4H77A 5FHQA 3M3DA 4CN9A 4YECA 1DQZA 3VPHA 5CLJA 5FORA 2EEPA 2PCJA 4KVAA 3RYIA 4JXXA 1C8VB 3EMBA 3V1NA 4DPKA 4HDNB 4M7RA 4H0NA 1RC8A 3VC1A 4OYYA 3UCFA 3PUHA 3H5VA 2C99A 3IX7A 3FTDA 4C21A 4CU2A 4R1LA 4B3SB 4JI8B 2ZVPX 4LHVA 4BNDA 5EMHA 2FU5C 4N12A 4B3CA 3A14A 5ALEA 2DMRA 4GC9A 4F9FA 3ZXSA 1OFGA 2BUBA 1DUVG 4I19A 5CURA 2HUNA 1NAIA 4KV9A 3LA8A 5AJYA 2JRLA 5EKUA 1MB2A 4CKWA 1CZNA 4IGIA 1DOHA 2J0UB 1DKLA 3I9OA 4BP3A 2GN6A 4RDHA 5KSWB 1YJBA 1YGYA 5D2CA 2P65A 3FVTA 4M0CA 4KPFC 4DARA 1PV4A 3OQBA 1SFRA 2D2XA 2V6BA 3V4SA 2D0IA 3UB4A 1JG3A 2BGNA 2J59A 1IH8A 2RMKA 1WMBA 4IIDA 1DJNA 1Y7IA 4PYKA 4H4EA 5GMOA 5A6SA 1HR0B 2R751 3GT7A 4KO2S 3MMSA 2AUTA 3PWKA 3QA3E 1U2ZA 1ULSA 1LBTA 3GQBB 5DBHX 4Z9FA 1QGUB 4M1KA 3MSCA 2NM0A 3RAJA 4D0NA 1S1MA 5JJLA 3OMLA 4MO2A 2NXJA 3PL5A 3M6WA 1QJCA 3CF4A 5JASA 5AW0A 4F5WA 1PK7A 2P2ZA 3HSSA 4YGYA 1GAEO 2G8NA 1SN7A 1RR6A 2Q1WA 3M2PA 3QWBA 3TLGA 2N1MA 4D9CA 3GLUA 1WPRA 4EFKA 2G5PA 3HXQA 4B6PA 2ES4A 3ICWA 3ZZUA 4X92A 2X8JB 4TZKA 5IMBA 2FWRA 3WKEA 5TLSA 3KPJA 3ND9A 4YAGA 4AMZA 1M2HA 4G2NA 4CLOA 1SD2A 3A27A 5JCPA 3KUDA 3BXXA 3ZE2B 5DGIA 5FBKA 3A1DA 3REOA 5F9MA 1U5BA 4JOQA 3WKAA 2PLFA 1FPMA 1JHQA 1OXKB 3BHMA 4XFKA 4HV4A 4ZCIA 2PGXA 3W8RA 3A1FA 4E6EA 4Y9DA 3LT5A 2D1SA 3FHTA 1GPNA 1DIGA 2WK1A 3ZCSA 5HIAA 5IC4A 5IC6A 1SVSA 3SM9A 4R54A 4YV7A 3R8FA 2OUIA 4JWKA 5CH3A 5KVSA 3TD2A 2OAP1 4R2HA 4N40A 4MS3A 4QYMA 5K3FA 4FKMA 3UANA 3BE6A 1IYZA 3GIWA 3MB5A 3E3OA 4E5SA 2J67A 4G0ZA 4TS9A 3WNCA 1UXHA 4MKIA 1DO0A 2ZIZA 4FS8A 3DBOB 4FFRA 5I4CA 5L4LA 2FW6A 3O4RA 4FJ2A 1QGYA 4OHPA 4XR4A 1KZ4A 1JR3E 3O47A 3UHJA 4M8KA 2BZGA 5K3AA 1GV0A 2QP3A 4RKEA 2JFQA 1CR4A 2XVMA 4CDMA 5EKTA 1C50A 1RKBA 4J7AA 4W9MC 1ULZA 4KNYA 1CUGA 2VNSA 2R8RA 3AL0C 1Z5PA 3GRAA 5JMTA 5D6NA 4R83A 3T1NA 3BQ9A 3NTVA 1AHPA 3QBTA 3H11A 4IMPA 2BEUA 4S1TA 4YRNA 1PJ4A 3VSEA 1T2UA 4LE1A 4F9GA 3NBKA 4PLCA 4R0VA 1L7DA 2HR1A 5TEWA 3OF2A 1DG9A 4XXHA 3QLTA 4I1VA 4Y9SA 1UMKA 5D1NA 2I1LA 3NI2A 5HBRA 2G4VA 3ZLTA 3WGGA 1VJCA 4Q4DA 1UPUA 2HPZA 3IOYA 3LYHA 4W5JA 3VOBA 2XOKA 1Q0ZA 1M8PA 4TQ9A 4YB8A 2VF5X 4XB2A 1EVJA 3IJPA 5HEKA 1ZL2A 1ZGHA 4ZVVA 3U31A 4JUDX 1U9JA 2NO7A 1Y8ZA 4R51A 1A76A 5K3OA 3PJFA 3IAS6 3TFQA 4MQMA 3T9EA 5KKNB 3PZBA 3ZY5A 2P9YA 4MGHA 4OI1A 4MV3A 1Z2CA 2A0FA 2YYZA 2P9JA 1D9XA 2R25B 3ROGA 4F5DA 3OY2A 5IDYA 4QQRA 4F97A 1N4AA 3LIPA 2CUZA 3O31A 5EWLB 2C8KA 1DRUA 5DM60 2PKWA 2H7VA 1U02A 3EE6A 3JYNA 4JC0A 1MEEA 4W5WA 1DGQA 1BE8A 3BMQA 3G8CA 2BKVA 3SC2A 5L3SA 3GWGA 4A82A 1X8LA 2DULA 3I9JA 1JXAA 1PU2A 1Q95A 4HRYA 4ISCA 4L6IA 4XCQA 3AHFA 5H59A 4ZRMA 1JBKA 1Z9BA 3IQWA 4JLJA 4RF2A 1UBRS 1CRPA 3A6FA 1O94A 2F90A 2GPTA 4KXMA 4PAOA 4QXPA 2HNBA 1IWBB 4WGGA 2JH9A 1P0FA 2HMUA 2VAMA 4BJ1A 4R05A 2IIQA 2X42A 2AJCA 4UE3S 1COWA 2EJVA 1YZHA 4ODIA 4WVFA 5EUCA 1K8XB 5KJFA 3V48A 5A0VA 2DUUA 1ZLYA 1NFRA 1XMXA 4IH9A 4C4XA 1JFFA 4CMEA 1PS0A 1Q92A 1NW7A 2VK8A 4LISA 4PCUA 1KFCB 3BWYA 3TEJA 3WMXA 3NHJA 4ZGWA 1DXYA 1C9YA 3E7FA 2ACWA 1YQ9A 2WSBA 1MOZA 3D6VA 3GAMA 3MRXA 1WXGA 2BM0A 3OPNA 4ZODA 4YWHA 4B80A 3DTNA 5J2UF 2BMEA 3M6AA 1XCGB 4BS9A 1GPH1 1BRTA 3NP7A 2GEJA 4JN6B 1NXOA 5CPFA 4OD0A 1DWQA 1JJFA 2IOHA 6CHYA 4O5OA 4UARA 1UL1X 3R5JA 3KNZA 3HMQA 3STYA 2W2KA 4Z7QB 2GX6A 1XRRA 5DM1A 3WB9A 4TMYA 4H7FA 4IHAA 1TQ2A 1YS2X 3ISTA 4Q0MA 1NNEA 1CS0A 1Z7GA 1EG2A 2FPUA 3ED5A 2LWIA 4C76A 5CA0B 2XXJA 2XUKA 3CV3A 1LBQA 1XVAA 3CRZA 3GDHA 4OXRA 1HE8B 2D54A 2D5LA 3NT5A 5CT6A 4KQ9A 4B09A 3OX1A 1VHJA 4PYOA 2WKSA 4UEOA 1NHGA 5FUXA 2HWWA 4IF4A 4BGIA 2XRFA 4MLZA 1O94C 1L8AA 2UZIR 1N8KA 3LCCA 3R40A 3WGZA 4J07A 3KT0A 2AG5A 4NLLA 3UT5B 3AFNA 4OLBA 1LNZA 3KWMA 1SB8A 4KH0A 1XA0A 4Z7OB 2VF4X 1LCIA 4G01B 4O6VA 1QX3A 2I76A 3PNQA 1N6LA 1WS6A 4FBLA 3PL1A 1PK9A 2HNAA 1QKKA 1XJCA 2PRYA 2PPLA 3BWVA 3ETJA 3E48A 2QUZA 3H18A 4ARAA 4JUIA 4KGVA 1SV1A 2F3TA 4DTIA 4XRRA 5GPBA 1M8GA 2NZXA 3DDUA 3QVSA 4N9QA 5E3IA 2IBTA 4LXUA 1XMPA 2G06A 3TBKA 1BFKA 1SHKA 3ICEA 2X8AA 4OHXA 2DHEA 1MF7A 1JE1A 2I6QA 4PX2A 3LECA 4KR6A 1KEEB 2WFAA 1H2WA 3FZNA 1HE3A 2QPOA 3NRBA 1JHUA 2PSFA 1J49A 2UYYA 3O93A 1E79A 1YQXA 2V1XA 2XQIA 4HWKA 1CQJB 1G2PA 3U61B 5JNSA 1ZHOA 4RTJA 2PE5A 3VSCA 1I4DD 1UJCA 1YQQA 2Y1FA 4MKZA 3ZZ1A 3FOEC 1T0PA 1OXMA 4FOTA 2AC2A 2XX3A 5E7IA 5C8YB 4PX9A 4WOBA 1NE2A 1OFTA 1N6PA 1QV7A 3EGVA 4KE8A 4RK0A 4U7TB 4ACAA 5GIOE 5TT1A 1KO4A 4MJ3A 3FNGA 1E7SA 1L7PA 1X7YA 4M38A 3F5SA 3ZI0A 1C1YA 1G0NA 1KMHA 1TW3A 4XWYA 1BU8A 1L4BA 3W2FA 4ZAFA 1U04A 1XALA 3BB4A 3MQ2A 1QE5A 4GZMA 3VU8A 1NPDA 1YT5A 1BRMA 3L1KA 4G1UC 4URWR 3JVVA 1NSFA 3K0FB 4Z0PA 4OXIA 3UBTA 1IIRA 4BJHB 2B4RO 2UZAA 3AQ4A 1E9RA 3K9GA 1M2FA 3E9YA 1VM6A 2VFAA 3TX6A 4YX9A 2AJDA 4TV9B 3L43A 1A4RA 1H4VB 2P3SA 1JHDA 2XNHA 3WMWA 3BXPA 3H1GA 1XPUA 1YJXA 4IJ5A 2XWBF 2FPWA 3F7TA 3PE3A 3SI7A 5ELXA 1V3VA 3J7TA 1O03A 2PGOA 4MAAA 1JG2A 2TECE 2P3OA 2VPXA 4DV6B 1GPUA 2YNMC 4HAOA 2QVLA 3V4VB 4NE2A 1OILA 4UTXA 4FLEA 1UAYA 4PWYA 1QFMA 4HZUB 2PT5A 3SLKA 2O8DB 1DKRA 3P4XA 3AIMA 3O8DA 4I5GA 1C81A 3SYRA 3P96A 3AP2A 2HWXA 2Z4TA 3C7AA 2C4HA 3U16A 1QE0A 1XB2A 4GPD1 3CLRD 1GFSA 3DZKA 2XCQA 4NDNE 2PV0A 1E9VA 1Z3IX 4Y18A 4HP8A 1PYGA 3QTTA 2DFPA 4WESB 4JMLA 3N3AC 2JJMA 2GBGA 2Q29A 3BJMA 4JP2A 3RJMA 5C5EA 2CDBA 4P3XA 4RETA 1P61B 1QGOA 1VPEA 4U9HS 4PZCA 2DJIA 2Z6VA 2V4ZA 2N1BA 4IRXA 2BLLA 4EUHA 4LJYA 1R74A 3D4LA 5BQ3A 2P4EA 4TMVA 5I8PA 4MRMA 4C3ZA 5JAUA 3SC6A 1ZOSA 1QR2A 2II6A 2Q46A 3LX5A 4QUHA 3RWOA 3ZCUA 1HLGA 2PRKA 1PO7A 4G1EB 1B76A 1E3EA 4AZTA 4KQWA 1EVIA 1P72A 1JYSA 2I67A 2HXSA 3I2KA 1A88A 2J9XB 1UZAA 3IUBA 4CLRB 3ZJ4A 3PQ7A 1CEYA 4V1CA 1PD1A 4ZGGA 1N9GB 2Z8XA 2RG7A 3K6JA 3RFTA 4L07A 3NHWA 2FLKA 1AQNA 2O8BA 1QBKC 2GXSA 1RXCA 5C7LO 1A7AA 1ICEA 5AJWA 3S55A 3UEOA 4BNKA 1N3YA 1ZM3A 3ESDA 1CU1A 2O4UX 4L0QA 1IEVA 1ZH0A 4PYLA 3ZKWB 4FYIA 4B5LA 5BV1A 2QI9F 1G3IA 1DAFA 1XN1A 2H1LA 2WAXA 3DNPA 3PXUA 3UXHA 1MFZA 1U3TA 2JFFA 4Y1FA 4IIJF 1BKSB 1ZS9A 3TLKA 1MP0A 1OD6A 1Y1QA 2FX2A 2Q0SA 4IWXA 1G21B 2D4AA 2ZR7A 3EJWA 4D0RA 4RFSB 1EUZA 3ADDA 4K2HA 5BN4B 3FZQA 3HU3A 2C84A 2GEBA 4HAIA 4HYEA 4PIMA 3SHFA 3PHHA 1GEEA 2QG9A 4WI1A 1EH5A 2L2QA 5T8KA 4BO8A 4Z5XA 5CLHA 1VBFA 1WUTA 1T8WA 3EXFB 4CKBA 4PN3A 3H4MA 4R31A 2VDWA 4L7VA 3L7NA 3H1FA 3UMBA 2WWTA 1JG7A 3L1VA 4TS4A 4XUDA 2X3FA 3SR4A 4G5RA 4NJMA 3RVKA 4DRXB 1LSUA 1E4YA 3EC2A 1MB9A 3JS5A 3AU8A 3L8DA 3LLSA 4P3PA 1N2BA 2LVBA 2VQ6A 1SCAA 4LC9A 3WXBA 4HF7A 1PJBA 4I5IA 4M87A 2GN8A 4MEJA 4B9AA 4BB0A 2J45A 2W90A 2OXFA 2HU8A 4HEA6 4Z4GA 1Z68A 3OFJA 4U3JB 4JUAA 2X0FA 2AK3A 4QDZA 4MUYA 4GSLA 2WWGA 3EW7A 3RKRA 1MTZA 1XLTC 1Z6GA 3JD1A 3WBFA 1DFHA 1BWQA 2OCPA 1KMMA 1Y6RA 4YASA 4ARVA 3D4IA 1F38A 5K4AA 4CXMA 2BKUA 3OA2A 4RE6A 1C80A 1IZ8A 3BEOA 3DE7X 3E8XA 3MK31 2G40A 3K1ZA 4R68A 2EBHX 2P6OA 2XA1A 3KVVA 3QKIA 1XGKA 5ALWA 4NH4A 4RF5A 3SS9X 3VTFA 6ABPA 2EW1A 3P2MA 4KQKA 3HY4A 1G64A 1AUOA 3BOSA 1ZISA 3EPPA 3UUFA 1GSHA 4FYYA 4NFLA 3K8OE 3IC5A 3RRXA 3BGDA 5AFSA 3LSYA 4Q9DA 3UATA 4D4LA 3DLCA 3RSFA 1E62A 4F5EA 3HP1A 3ZU6A 3JWJA 1IULA 2IYUA 4JFRA 1JYFA 5IWAB 4RGBA 3SMQA 5IUNC 1T24A 1XIVA 1ISGA 3BXZA 3RSGA 2UVDA 3GBPA 3DP7A 1SGWA 4YA6A 1QGUA 3HP7A 3JYHA 2WW8A 2O6LA 3AR3A 3A28A 3OIWA 4WMLA 5BO5A 4FS3A 3W79A 1V11A 1E98A 3ZN2A 3ML1A 1BHQ1 1SXJD 4CHGA 4R3NA 1JQ5A 3H1PA 2CMGA 1B1CA 3QFSA 1E2DA 2NO9A 4ER7A 3AJAA 4CR8A 2P62A 4OLHA 5E7QA 2AMVA 3SIWA 4YAIA 3FIJA 4LF8B 1O6FA 4RCVA 1PZEA 3M81A 5F4BA 5T67A 4D82A 9GPBA 1WOYA 5H0IA 5DYGA 1BGVA 3IDSA 1U9CA 4TLEA 2NU7B 5EGSA 5A02A 5C37A 4CN8A 1M5RA 4UEJA 2WI8A 1RLJA 1ISMA 1UQUA 2DWCA 3K0BA 3QX7A 2XMSA 2QWXA 4C08A 4D3XA 2N0SA 3DBHB 4E5PA 1XD8A 2WWIA 4CMIA 5JSUA 2HK7A 1YU6A 1EKXA 1JFSA 2ISQA 1TZ2A 3M4NA 2ZJ5A 3II6X 1OLXB 4GZ3A 2DBYA 3GPIA 1CUVA 2W22A 5E3JA 5HCNA 3RC3A 4ER6A 3QX9A 4O4IF 5FV4A 1KMHB 1Z5VA 5K45A 3OCCA 1M67A 3B36A 4M83A 1LJ8A 4CL2A 2NZVG 2C04A 2UVQA 1HQKA 3HYCA 3EIWA 1V4VA 1YO6A 1OBVA 2I65A 3OECA 4G5XA 2F2TA 3PHIA 4PZ9A 1H9CA 4OU5A 3SX0A 1YK0A 3USES 3BWDD 3FIUA 2VO1A 1NR1A 3FDZB 4CIBA 4Z4FA 5CBPB 4B2PA 5KTNA 1USKA 3E5MA 4BX2A 3TSWA 5JXHA 1SUYA 1WLYA 4I8XA 1BDMA 5AM3A 1OVGA 1KRWA 5F12A 1JT2A 4PFQA 4ARCA 2ON6A 3MUEA 3TFWA 4PZZA 1YIDA 2V6IA 2OOSA 2B7CA 2P5YA 3ESAA 3P2JA 4RJTA 4X63A 4C43A 1QYIA 5EJFA 1BCSA 2Q2NA 2RAVA 3L6DA 4RFVA 1YH3A 1KC1A 1T0BA 3AR6A 3N39C 5EWMB 4Z4IA 5JZSA 3ZIUA 4CKZA 2O54A 3SNHA 1OWMA 2IYTA 1SEPA 1CUSA 1RXYA 1G5TA 3H3XA 4A2CA 1I14A 1EWVA 3EIXA 2V7TA 2WYWA 1FPQA 1I6KA 3KLOA 3GG9A 2W8ZA 3OF3A 4WCFA 4N5NA 3N6VA 2CKMA 3EFEA 4H7HA 2AXPA 1H5UA 4PTLA 1DXHA 3BGWA 1JXMA 1UEIA 1X87A 1ACLA 5TX7A 4BGUA 4EB3A 1P6UA 2VDOB 3DNMA 4NATA 3PGA1 2WT8A 1MABA 2P6PA 2Z5LA 2NTNA 1B74A 1HG0A 3GR6A 5SZKB 3B52X 1P77A 2QLBA 5DP1A 1L7NA 3ZE8A 3MCZA 5KCZA 3F9IA 3G5LA 4RZSA 5FLKA 4G25A 4TTJA 5J4KA 3RNLA 3C3BA 5E1MA 3BS4A 3ENVA 2UZ1B 5BSHA 1VPVA 3GCXA 5JCJD 1E2PA 1KNQA 3AVQA 3G2KA 1U0OC 1JJBA 3HZRA 4HPXB 1B3RA 1UBTS 1T8SA 5C1OA 2XZLA 3K0AA 4AG3A 2OZPA 4TRJA 1Z4MA 2GYUA 2HMYB 1LV7A 4G5FA 4KWIA 5EVJA 4DY4A 2HYIC 1AA9A 4Q18A 2IW3A 1N5MA 4Q47A 4BIMA 3VKGA 3VNRA 4U2KA 1CD5A 4OQNA 2OCIA 1N6NA 5C31A 2HRBA 4G36A 4ZEWA 4Z51A 4J2HA 1NN1A 2PKYX 5HOQA 1DKQA 3TCXB 4ZAGA 2OA0A 2DWQA 4AZ3A 5A5GA 4TKVA 1EBFA 2HEGA 1DI0A 4EO4A 1ZRNA 1T9KA 3H2ZA 5AICA 4GE3A 2MYTA 1I13A 4FI3F 3N8GA 2W4QA 3RSOA 2HHJA 5IEJA 4M98A 2P9BA 1SUDA 4L5AA 1ZMRA 4WCFC 5HNKA 5BR8B 3HTXA 5TVKA 4PY2A 1L3BA 2HMAA 1FXUA 3JZIA 1NYLA 1YJ5A 3O8QB 2H6EA 3Q7RA 4LDAA 4U6SA 2ZR9A 1M74A 1ZUNA 3MZ0A 3H5TA 3LDUA 4U00A 4IDQA 4NS4A 3QOFA 4XQCA 4CMCA 1F14A 1WDLA 4CODB 1M6HA 3GLFA 4C0JA 5EFZA 3TW8B 1VDZA 4F6RA 1U7PA 5K0CA 3ZZMA 4DLTA 2O23A 4D74A 1A9XB 3TZEA 1JYEA 4FOOA 4DLVA 2XNDD 3U7FB 2NX2A 1C3EA 3IVXA 1XDDA 1ZJ4A 2WM2A 2ZUWA 1JHAA 3FPFA 3JD3A 3M5DA 4P93A 1ZM4A 4QOSA 3SCZA 3TGPA 2DCMA 2E55A 1YF3A 3BAFA 4HNTA 2QTZA 3UT0A 1GTRA 1NW8A 2CBZA 3A6ZA 5KSOA 2JGDB 1JWLA 2PX4A 2PWZA 1ZC3A 3WP1B 4EI7A 1X7YB 3K2IA 1SURA 2G9ZA 1XMSA 3E0XA 4XTRA 5DYTA 4EW1A 2PQ0A 3MT7A 4X5OA 2FZEA 2AN4A 3W5SA 4OCZA 5TNXA 4HH1A 1X92A 1FCJA 3NHSA 3BFXA 3ITEA 3PC2A 3RCBA 3RRZA 5CVTA 4S1PA 3G2MA 5G0SA 2AQKA 3M34A 1PQUA 3SGLA 4EYOA 3HVJA 4JI2B 4UM8B 3NYIA 3MGKA 1K9SA 4TYPA 2OSBA 1EWYA 3OQ6A 4RGQA 3VR2D 3JD2A 1ZCBA 1SKYE 4C6SA 3ETHA 2VJPA 4Q3NA 2QM3A 3OPXA 1B8PA 2VVTA 2IHYA 4JLOA 1WCV1 6ADHA 2L82A 2IKQA 2ZR0A 4GOOD 2VG8A 3CBGA 1JPJA 4M8SA 2P78A 3VU9A 4DIMA 4UNQA 4GR5A 4KFSA 4WY2A 2I2DA 2GI4A 3PPXA 4KDRA 4QBIA 3X2EA 2UUBB 1UCFA 3CIFA 5HBGA 4TYYA 2MINB 1JX6A 1V26A 2FUNB 3CWCA 4KXXA 2QGZA 4H3HB 3I6IA 3T3IA 2O3UA 1QIEA 5AM4A 4ZVRA 3WJ1A 1E92A 2R44A 1B8VA 4BCBA 4V1CI 4HAUA 1H2YA 3NHUA 1XWFA 2OLKA 1BA2A 2F3QA 3BCRA 2NUAA 2QYOA 3N2YA 4WXMA 3VOTA 1X7ZB 3PTLA 1ZAYA 2FMTA 2C2WA 3T4EA 1ZSYA 5SZHB 1GPJA 1FDSA 2HU7A 4GP9A 5CT5A 4C5BA 1YR2A 1LW7A 1ZVJA 4HN9A 2JGMA 3WY9A 4HNAA 2WIBA 4IR7A 1D2HA 3HJHA 1XELA 4HSEA 5IZ4A 3S2UA 2RHTA 1GAQA 3L8EA 4C0QC 1SKAA 3RVOA 3MUNA 2GT1A 2ODEA 3L1HA 2OORC 3IV6A 5EIOA 4AN4A 1G7CA 1AV6A 3QPVA 1E4EB 4RWZA 1ZMOA 2AFIB 1L3CA 1EHCA 4B0PA 1NVBA 4RE5A 2EQBA 1V2ZA 4NS1A 3HP4A 1SBCA 1V3UA 2B4YA 3BVPA 4EARA 5JVDA 1OX6A 1YBFA 4W5QA 5C8DA 5H5JA 4CIYA 3ET5A 1BW9A 2BEVB 4GS5A 3TG2A 1Z82A 4KQ2A 2J0SA 4DQVA 1SBYA 4RVFA 4LF4B 1P9RA 1N8TA 2IOYA 3K0FA 4HAWA 1TT5B 3KV3O 2YDXA 2ZT5A 4YV2A 3TDMA 4IFTA 4RA6A 4MWDA 2RGGA 2YWHA 3AJEA 3H5AA 5EMNA 3WWOA 5D00A 1DUIA 5AKKA 1HYQA 3UPDA 1QRAA 3LNTA 4YP9A 1FRVA 4UTZA 1PFGA 4XDZA 5JI3E 5HILA 4F1WA 1VL1A 1H93A 3P9IA 4JKOA 3RS2A 4Q9KA 4DSAA 3K20A 4PZUA 4OGFA 2AHOA 2O7VA 3WLPA 1Y98A 4IKEA 4QXAA 2JLXA 3MYRA 2X76A 3HU2A 4PRLA 4LGYA 2ID9A 4DMLA 6LDHA 4C3VA 1PG2A 1UIMA 3MUFA 1EFLA 3D5TA 1QH1A 3DTTA 5K0EA 2ODQA 4QUJA 4R5MA 4X6LA 3EQZA 3DO6A 3I76A 4OHYA 2EZ4A 2X9NA 5CXUA 1W7AA 4Y2JA 3KXPA 4HLCA 2RB4A 1RYFA 3NM5A 1KI7A 4DBVO 4FWIB 5BOSB 3COYA 1NTRA 4FHDA 1MR3F 4PIPA 4PWZA 2XUJA 4RWEA 4IX9A 1I7PA 3GG2A 3OC0A 2P7IA 2CNWD 1NT2A 1WEKA 2PX3A 3NG1A 4UUMA 4DEXA 1V5GA 2JL1A 3L9XA 4XLTA 3M4JA 1AB5A 3WMEA 4I1IA 4IDPA 2PXHA 4ZVKA 4CW7A 4CCWA 4ZVMA 1HLFA 1P44A 3MWDB 1SD1A 4P86A 3DVQX 3RS8A 4ADSG 4MR7B 1XCOA 4D9FA 4DGQA 1G6Q1 1AMOA 3FGPA 3O4GA 4N18A 4I1UA 2EFCB 1E1NA 2Q62A 2QX8A 4IIJB 4X6UA 5WRFA 4AP6A 3A1WA 1OHHA 1GRVA 4FKZA 4R3UC 1HF3A 3FCSB 5LMZA 1RI4A 2P9ZA 3ZWPA 3NNNA 1GZVA 1M73E 2NSLA 3HYSA 3TKLA 1P0QA 1J8MF 4TTTS 2JFGA 2G28A 2B6HA 1NJ2A 2FSIA 2PS1A 2HKIA 4C20A 4ABTA 3IIJA 5DHRA 1PFWA 2FZWA 4CMAA 2GK3A 5ES4B 4TVKA 2B0JA 1CNMA 3SKVA 1ZMBA 2VP0A 5E8JA 3AFGA 4HDNA 2DQ4A 1Y6GA 4UZFA 2OC9A 4NBLA 2VBCA 3FYHA 3RIGA 4TVOA 4QAQA 2C5SA 3MGBA 2X5XA 3GJ8A 1DTEA 1XTVA 1KZ7B 4KYVA 3X1JA 5KYYA 1EXDA 1VLJA 2GCNA 4JMPA 2WJGA 1H9BA 4C4AA 2N46A 1U0TA 2OCYC 4I3FA 4D8WA 3CF4G 2ZYVX 3O90A 1VXOA 2YRFA 2QTCA 3D8NA 2I7XA 1FTQA 2MTBA 1SCIA 3AL3A 5E4TA 3T7KA 5GWXA 4FGUA 1JGTA 2NXWA 4KGXA 1E2KA 2QD4A 1A82A 1K5PA 1DS6A 3I9NA 3T3DA 1R8JA 4LWPA 1X0XA 1VZ3A 3PGJA 3R75A 4D99A 4EPRA 5DMHA 3ICCA 4JLDA 2NU9B 3WLKX 2Z2YA 3AONB 3DYBA 3WMRA 5B55A 1GNTA 3FTQA 1OBCA 4CV2A 2NV6A 2OV3A 3DE3X 4KXWA 3OIUA 1VMIA 1JFLA 1QHYA 5CYFA 2R5NA 4QBFA 5CH8A 1E3TA 3GGGA 3Q72A 1OQAA 2PGDA 3E1GA 2C4UA 1QH9A 2XGGA 2JB9A 3F8WA 4XPIB 4KRFA 1GUYA 4HUQA 2C3MA 1YJQA 3U44B 3U4AA 2WF7A 4BNUA 4QELA 4N82A 4DV0B 4AJJA 2P77A 3GCZA 3B20A 3FNQA 1NRXA 3NHKA 3O4FA 4CRWB 2EKBA 5BXYA 2WVGA 1YMUA 3DZIA 4CYMA 1NVXQ 3DZHA 3FG9A 4GW3A 4D0SA 1CRLA 2ZK7A 2H52A 3T5GA 3LGSA 1CJSA 1R16A 1DQYA 2IX9A 2WP8J 2FB9A 3PNKA 3HCRA 4TZTA 3DFKA 2DKNA 2OGSA 2OFOA 3DB1A 3KUUA 3IQZA 2G04A 4Z9XA 4L3OA 8GPBA 1TUEA 3WJAA 3ZTYA 2Q9AA 3WRVA 3OM0A 5AKJA 1G3MA 3AILA 1WQ3A 5CCEA 2QY6A 2CJFA 2O2YA 2Y1OA 4X85A 3EBOA 1H42A 2YXDA 5H4HA 4BNLA 5IT9A 4ZO9A 1KXJA 4EG8A 2G80A 3DM9B 1N75A 1XA3A 3QKUA 1X1RA 2V74B 3MLAA 5B64A 2XMRA 2B1RA 3AM1A 1EZZA 4YLEA 5GZ6A 2OBYA 3K6RA 1U2GC 2A30A 2IH2A 1JU3A 3BTSA 3AF3A 1YZFA 3ZNPA 2CL0X 1UIRA 3DDOA 3L0PA 3WGNA 4QICA 2BEWB 1P5ZB 3OE1A 1VL0A 2IZ1A 1XFDA 4MRNA 3E4CA 5L51A 1SOAA 1SY7A 3G9TA 3R3YA 4L28A 3MWKA 2ZI4A 2Y0BA 3P2IA 3QEKA 4A6DA 2PS3A 4PFJA 4XWAA 4TLDA 4JASB 4EECA 1ZC4A 4LRUA 3SS8A 4R6WA 1W4AA 3AI2A 3H75A 2ZYTX 5JE8A 5L3QA 2BWJA 3HY6A 1GP2A 2AEEA 3EDRA 1ZD5A 2MOKA 4CF4A 4HI0E 3M1MA 3K70D 1YVEI 1DKUA 3USZA 1Y4ZA 5FNVF 3T95A 1DC8A 3QOYA 3IE1A 4J3NA 1VHTA 5JROA 2CFRA 2XZOA 2D4HA 4Z1MD 3TB6A 3P4UA 3W5JA 1XDBA 3H5RA 4QLOA 3MUOA 3IBSA 4UJ5A 4WZBA 2QD3A 4TL6A 5JSFA 3RV4A 5ARDA 5U9CA 4NBVA 4MAFA 4ZI5A 1WQ1R 1UAGA 1Z4OA 1RMTA 5ALTA 2P6RA 3PLAE 3SF0A 1MAAA 2GRUA 4RK1A 5G41A 3I01M 3VOSA 3GLIB 1UDWA 3MJFA 1N9ZA 1Y1TA 1VL2A 4KW7A 1QORA 3HABA 1CEEA 1N0UA 1I3OA 3PQ8A 4HLUA 4MV0A 4TKVB 1FFXB 1W93A 2Y1CA 3HSYA 1IONA 4M8LA 2N3ZA 3WNVA 2GFQA 3V1TC 4AXBA 1XK6A 4YMGA 8LDHA 4JSRA 4LWQA 5JPCA 1A7JA 2IUUA 2C58A 3LTEA 3R7WB 2JFXA 3AOEA 1E20A 1DEKA 4H3VA 1JKFA 4WRRA 1Z0SA 3CURA 3EXEA 1ENPA 1OXSC 1K2VN 4GXRA 3NHRA 2QEQA 4L1KA 1QO0A 3TUJC 2IX3A 3DEZA 4GMDA 4FOLA 1EP1B 4N6NA 3VHXA 2O2DA 4UD2A 3Q11A 1OLOA 1DL5A 3WOVA 2PUGA 2CXTA 3RGGA 1CHDA 4BLWA 3OOYA 1T6NA 1CVRA 3WLJA 5HFJA 1YQDA 1QH1B 1TO2E 3OU7A 5FA5A 4N3BA 4JZYA 3DOEA 4HN4B 3UAGA 3WLTA 6Q21A 1JHRA 2BGRA 4QGSA 5DGTA 2JC3A 5DVZA 4Z7JA 1VGVA 2AX3A 1IFXA 4IZHA 5KWIA 3N7AA 3N9IA 1JPUA 4KIUA 1MGPA 3HVIA 1NLMA 5J1SB 1E2QA 3IULA 2GARA 1VFPA 4MHTA 1J9EA 2DYKA 2PMCA 2IXFA 2YCBA 1MRNA 2NT4A 2JIBA 5FF9A 5F4ZA 2IWRA 4Y2SA 4YRGA 3FNBA 5JD6A 4ZIRB 4LXQA 4N5LA 2I7DA 2CL7X 2BHLA 1GTZA 1CFZA 3N87A 5FO0A 5JJ5A 1DX4A 3R3JA 2DLNA 3C3XA 1OX4A 3H16A 1ZX1A 2MYNA 4TTRA 1HEIA 1RWWA 1RYDA 2JIZA 3HVKA 3CKYA 5FFNA 1ZOLA 5GZ3A 3AJ9A 1Q11A 2ZRPA 3KD2A 3L5KA 1DIAA 1ATIA 4JQOA 4ECEA 3R23A 1P3JA