2I2XB

Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
MLDFTEASLKKVLTRYNVALEKALTPEEAAEELYPKDELIYPIAKAIFEGEEDDVVEGLQAAIEAGKDPIDLIDDALMVGMGVVIRLYDEGVIFLPNVMMSADAMLEGIEYCKENSGATPKTKGTVVCHVAEGDVHDIGKNIVTALLRANGYNVVDLGRDVPAEEVLAAVQKEKPIMLTGTALMTTTMYAFKEVNDMLLENGIKIPFACGGGAVNQDFVSQFALGVYGEEAADAPKIADAIIAGTTDVTELREKFHKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase 1
publication title Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
pubmed doi rcsb
molecule tags Transferase
total genus 79
structure length 258
sequence length 258
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 2i2xB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2i2xB02
3KOXA 1K7YA 4R3UC 3REQB 1I9CA 3BULA 2XIJA 4HH0A 1XRSB 4HH3C 3IV9A 1BMTA 1CCWA 1FMFA 3REQA 2YXBA 1CB7A 3BICA 1B1AA 1REQB 1E1CB 2REQB 7REQB 6REQB 5C8DA 1REQA 4REQB 1E1CA 3EZXA 1ID8A 2REQA 3WHPA 1K98A 7REQA 4JGIA 5REQB 6REQA 3KOWA 3IVAA 3KP1A 4REQA 1Y80A 4Q37A 2XIQA 4HH1A 3KOZA 2I2XB 3KOYA 4HEHA 5REQA 1BE1A
chains in the Genus database with same CATH superfamily
3A4IA 3HTXA 5EE5B 3IILA 3UUWA 4F38A 2JGEA 3U13A 1WMDA 1J49A 1X1QA 1XP8A 5FOSA 3B7PA 4YQYA 5LN1A 2RGUA 1CPYA 5C0OE 1ZIXA 5AVJA 3S2FA 3QZUA 1MJGM 3N6XA 3N2GA 4Y2RA 4IDNA 4B84A 4Y2VA 2O3JA 4DAOA 4RYLA 3K96A 2AR9A 5ALMA 2BSAA 2A7XA 2XGGA 4MVJP 2HRQA 3AW8A 1KI1A 1ZO8A 5TIIA 1AKRA 1T0PA 1KEUA 3GUVA 1DADA 2J3LA 3SZLA 3HPRA 4RSMA 4B76A 1N2JA 2O57A 1D9XA 3WLJA 3U26A 3X44A 2A57A 2PTHA 2EJVA 1Z82A 4D46A 6CHYA 4RZSA 3GAAA 1X1CA 3BWMA 5HRCA 1ZNYA 3LQFA 4FZ3A 1G66A 5ICEA 3OTOB 2GXSA 2VSYA 3DL0A 3DPIA 1IK6A 3DDNA 4NP6A 1M72A 4UBJA 5GOZA 4LECA 3E4DA 4AUKA 2CMFA 2FR8A 3AI2A 2ATIA 1DWUA 1NUTA 2NQ8A 2XAUA 3D8BA 4NBKA 1NX9A 3NHBA 5ALLA 2Z2XA 3LY8A 2KLHA 2NVBA 4ARSA 5J2UF 4ZCLA 2W0SA 1Z4NA 1BMQA 4LDQA 3OOWA 2I6XA 4DJTA 3O47A 1JMYA 3ZDXB 4LDAA 5K8UA 3C5EA 2O50A 3HBNA 1KP2A 1E6WA 4DIDA 1XQYA 2OD2A 4GPTA 4M1MA 2PM8A 2NYVA 3SLKA 1JR3D 1E9CA 4UBMA 3ZE6A 2IQ5A 4DDMA 5CA1F 3GK3A 3UY4A 4XGRA 4FMCB 4L3WA 1NBOA 3WK5A 1HDCA 2GT1A 2B4YA 1G4UR 4DKXA 4LF9B 3KUUA 1EAMA 1SJ9A 3OA0A 4W5QA 5EVCA 2XE7A 1S6YA 1QYWA 1ULSA 3NALA 2V8BA 3SIPA 3KWFA 4G1MB 4BVHA 2RAVA 1DAKA 3H5LA 1J23A 3FN4A 1X3LA 1XZKA 3LBFA 4WNYA 5ALQA 3N8IA 1BN7A 5JARA 3LLSA 5K8VA 4U7PB 3LLVA 1GGMA 1IUNA 3ILHA 2XTNA 4WFJA 3QEMB 4O4HF 3G8AA 4PPGA 3RGGA 3VYUB 3VU3A 3ZV6A 2J48A 3V34A 1T5SA 1XA3A 2QTLA 4P5EA 1FW6A 2CDCA 1TYBE 2OV1A 4QBGB 3DP9A 3OIGA 4RA9B 5EJIA 3DAHA 2HSDA 1ODJA 1QGZA 2VHCA 2YWJA 4PYQA 2UYCA 3RAJA 2H1IA 3GT0A 2XT9A 4D82A 3QFHA 4M0EA 1V7PC 2P4EA 3OT5A 3SEZA 5F23A 2YQZA 3GFTA 1C50A 3ETGA 3LL4A 3OOYA 4ZQIA 4JWKA 3ILXA 3B6MA 4X6XA 1EDEA 5CPBA 5KSYA 1QUEA 1C7ZA 4KQHA 5KYGA 5J2TA 1A9TA 3LFUA 1CIJA 3A9WA 3K0FB 3N3BC 4GO1A 4L16A 1PK9A 1UM8A 1IIBA 5ALFA 3KD3A 2NUAB 5ECDA 3SJUA 1M1XB 1E9EA 1QWOA 2OUIA 5ALJA 4DQXA 2CFRA 3H1BA 1ZAKA 2OFXA 2PO5A 3D4IA 1KE2A 3TD9A 3JQ9C 2FE4A 3WLHA 1GRNA 2GZ2A 1Z37A 1BFUA 2YCLA 3O1LA 4FFBA 4XX0A 3ROKA 1Z17A 2XGOA 4CIDA 2ZYHA 3V46A 1R0RE 5I7UA 1EHIA 4ZYVA 1BMFA 3E4CA 1U90A 4WOCA 3ETNA 3C16C 4OYRA 1K7XB 1TTPB 4HCJA 1L5LA 1U11A 4QRDA 2YC4C 3G9XA 3GLRA 3U3KA 5B4VA 3HCCA 3ZZMA 5IU6A 5BYKA 1YS6A 2FLWA 2V8OA 2RIPA 2XB9A 3WWEA 4DBZA 4NPCA 3R3XA 2N9UA 3C48A 3DO6A 1FJGB 2G6TA 1KOFA 2DPHA 3CB2A 3IFSA 5JS6A 1DUIA 3ML1A 1DE0A 1GA6A 1E2JA 2IXFA 3HVKA 4H6XA 5B55A 5CHEA 1DKRA 4DA4A 3EFHA 1RIIA 1JDNA 3O4HA 2P90A 2R66A 3QTTA 4GYWA 3QEBZ 3OTHA 3FOFC 1JAIA 2YY7A 4FIZA 1XP5A 1A9SA 5FD8A 4HNUA 4QJ5A 4LTDA 4F56A 3CE6A 2DJIA 2ENWA 2IEYA 2CBZA 2ZIFA 3K4PA 1FZTA 4RZHA 3B1ZA 3UCEA 1JAXA 4HMQA 4CT5A 4DILA 2VH2A 3ZTWA 4NBLA 2FJ0A 4JBYA 4YMVA 4IDFA 1GR0A 3E18A 3PTLA 1OTYA 1G5HA 4MGEA 5AVOA 2WC1A 2QRZA 4Q7MB 4AMBA 4CPDA 1HZZC 4X0EA 2V7PA 3KAPA 5EHGA 3FR7A 1S9DA 5I51A 6ADHA 4QM6A 1CR4A 2E6KA 2RK4A 4LZWA 4UMFA 2CK3D 1Z7GA 1D1TA 3EVDA 2DTXA 3QF4B 1ZD3A 2I29A 3I0ZA 4OUKX 1L7XA 3ZY3A 4A7PA 1DTWA 2A2ZA 1AKEA 4KHZA 3WRYA 1P4HA 1LI7A 1UINA 4G89A 4KWHA 2V5VA 3FCOA 3E9CA 1T5DX 5FQOA 5CXUA 4QELA 5FNVF 4BU0A 1T13A 3E3AA 1E3WA 2Q5LA 4FINA 5JANA 2HGSA 1N3IA 4NL4H 1ZJ5A 5BVGA 3KE8A 1JPJA 1ZCBA 3N2NA 3PBKA 4B09A 1XEXA 5B37A 4FJ0A 5J59A 1YASA 2ON6A 3PJGA 4WCFA 6GPBA 1N2IA 2O2ZA 1CEQA 3LY5A 2W6JA 3A1EA 1MF7A 3ZS9A 5KTOA 4CMEC 1KOGA 3AV3A 5IW8A 2MT9A 4JI3B 4R2LA 3LHDA 1L9XA 3E15A 4B7ZA 2ZRFA 4QXPA 4AY5A 3NH9A 4EJMA 2HQOA 3BQNB 3RYIA 2BEKA 1TA9A 4NENB 1ENYA 3UJ9A 4E11A 4R7ZA 2IBTA 3GEIA 3TPCA 3RRXA 1SKUA 1FDWA 3EAGA 3DE3X 1QQTA 4FOOA 3S4YA 2FDXA 1VL0A 4M87A 2R8YA 1BKSB 3VM6A 1E1KA 3OZIA 5CGZA 1GPJA 5K0SA 3SIWA 4DRYA 1QLJA 2RJNA 3HFGA 1KPGA 3PT5A 4QXQA 3DTNA 2ZANA 3SC2B 1DJOA 4QPCA 5G3YA 4Z49A 5K45A 4RY2A 4G5RA 4TKVA 3C6QA 1SXJA 4YJ3F 1V5FA 2C3PA 5KPDA 1MVOA 3WAGA 5T7BA 4LF8B 2IYTA 2ZWAA 1U7HA 1CQJB 4PRYA 5IP5A 3K70B 4OTZA 3L7BA 1VG8A 4YJGA 2AF3C 1KKMA 1ISSA 3EEFA 5ALGA 3LY7A 5SYMA 2HFKA 2QVZX 1GQSA 3CT4A 2IXAA 1VB5A 3HY4A 2GXQA 3KQQA 3JATA 4O4IF 1T43A 3D7LA 3G1WA 4GD3Q 3U4QA 3D59A 4C0HA 1JQDA 1AQLA 2CEAA 1T0IA 3OUTA 2ID9A 4BEVA 4ZZ3A 5H82A 2DY1A 3A6ZA 3TAXA 5DI9A 4XDGA 1J5XA 4P2BA 4G85A 1CEXA 1LRJA 1JLLB 3H5OA 3UMSA 3KYCA 1SCIA 4Z4CA 5GY7A 4M46A 1AMNA 4R6WA 4FCCA 3R0ZA 3DDOA 1P0QA 4NDAA 1MO5A 1SVMA 2EKLA 2YFKA 3ICWA 5KCMA 5C81A 5JWOA 3PQ3A 3KRTA 4ZTZB 3SKYA 2ZSDA 1PKXA 1F8FA 2X5KO 2PYZA 4WE3A 4CTNA 1QG4A 3DEHA 5IDYA 4KWIA 4OFXA 2WTUA 1Q16A 4EW2A 3EIFA 2WF7A 4MRMB 2YRFA 2PAAA 4I9NA 3KQYA 5DISB 1B76A 3U56A 5K0EA 2HMYB 3ZDYB 4F11A 1KHTA 2QMZA 1TECE 3FR8A 5E1BA 2O8DA 3IHTA 4UBLA 3G7NA 4IQGA 4ZHQB 4DSUA 3GFVA 5FA8A 4TRMA 1QNFA 3BH6A 2B5WA 3DBOB 3HEBA 5BN4A 1R0BA 1DL5A 1Z28A 4M37A 4MGZR 3QUAA 2LP4Y 5HZHA 4QDZA 3B1XA 1PQ4A 4YRBA 1EXMA 4RENA 3L04A 4R5HA 4AXXA 2JGMA 4RVCA 4F9EA 5L7TA 3NJ8A 1FZQA 3T9FA 4BVAA 3N75A 5TARA 3PEYA 2VOJA 4J0JA 4RGQA 2DHQA 3RI3A 1WWKA 2APJA 4BFUA 3P0EA 5LYJA 2PBZA 3RUEA 4RHEA 3S99A 1K9VF 4QBKA 2ODNA 5A4FS 4RK1A 1OVMA 4G0WA 1JHRA 1V6CA 5DX0A 3RFCA 1Q0RA 2SBTA 2DGDA 3UT0A 4WW0A 5JS1A 2GZDA 2H08A 1OIXA 2IK8A 4RACA 3RUHA 4IIJF 1B42A 2VL7A 4D4MA 3HUEA 3K0BA 4IIYA 3X1ZA 4B85A 4EJFA 1WVGA 3AU9A 3AZOA 3OQNA 4OFZA 4JUDX 2AFHA 2NVOA 3RLIA 5EINA 2CJWB 4WGFA 3V2IA 2ODPA 3H42B 4PYRA 2J0UB 1DRJA 4E94A 2XIJA 3OP4A 1QKKA 3IXLA 1BQ4A 2VXCA 5I7WA 4DRXA 4AMUA 4PCUA 3A70A 3WLOA 2X40A 5CLGA 4N03A 1OFVA 2IHNA 4MV8A 1SU8A 1DRVA 3ZNNA 3PNOA 3SC3A 3PGKA 4LOKA 4WOPA 1YZYA 1ISRA 1YR1A 1QAQA 1UPCA 3W5VA 5K8IA 2R86A 1DQRA 1VTKA 1QP8A 1L4HA 4H7EA 4O08A 2P65A 1E6UA 2QM0A 5KPJA 1R2QA 2PBRA 1K6XA 4P81A 4WKOA 3W2GA 3ZVKA 1AY0A 4KN5A 1H4TA 2GX6A 4XR4A 1WTAA 3EEIA 3U1VA 1A8SA 3QQ5A 4GKAA 2BFBA 4OJMX 2QTVB 3QHAA 4UVDA 5DW0A 1GU7A 1V6AA 3AERA 3IP1A 3SHVA 3OE7D 1CLUA 3MUNA 3WWDA 4BCBA 2JG3A 1WHSB 8ADHA 4GRDA 4HX9A 3GPLA 1KDZA 2JIOA 4RADA 2PL3A 4L8YA 2RG7A 1WF3A 4GLFA 2CUKA 5JAZA 4HDKB 4X1KA 3KKNA 1EDOA 3OIWA 4IDAA 2ZE6A 3QK7A 3WLQA 1US8A 2L42A 3AHHA 3NRJA 2KE5A 4JYMA 2R87A 4IGEA 2QX7A 4N5MA 4HLCA 1R4MB 3N7TA 2Z6AA 5EIOA 3BAZA 3PT9A 5FL3A 3CZ5A 3H9BA 5JMWA 5KOJA 2PUGA 5D7BA 3WLEA 2A4KA 2ZSEA 1J2TA 4UM8B 2CZGA 1T3GA 4DE5A 1MJ5A 4KSYA 4L6CA 2I91A 5EHNA 5IWCA 3MD0A 2OZEA 1EZZA 4HEJA 5ARCA 2C61A 2TMYA 3IP7A 5A1TA 4IIXA 3P52A 4M54A 5CDTA 4MQFB 1SCAA 3AY0A 3GJSA 3K8OE 2EFHB 2ERCA 1WUKS 9LDBA 1EB8A 5IDWA 3R6TA 4CQJA 4DV1B 4FLEA 4NE7A 5GMOA 4CE6A 2QX6A 4G1EB 3RV3A 2AF4C 3ZTTA 3F6BX 2P62A 3L8HA 3BXPA 1ZUIA 3GRUA 4QRIA 2DKNA 1J21A 4XIFA 3I5XA 1SG6A 1NFQA 2FA9A 3ZGNA 3ZHUA 3LECA 3KEQA 1CP3A 1PU2A 2HN9A 3DQPA 3M6IA 4MROA 4OK6A 1ADJA 1BHSA 2QD1A 2P6UA 4QPDA 4UDXX 2O59A 1NLFA 2O06A 4RTNA 2AD5A 1KK1A 5DBEX 2FF5A 1D0SA 5F5LA 1RXCA 1JEYB 1NMQA 1FDVA 5BPFA 5E2AA 1L7RA 3PJRA 1H6AA 5HGXA 5FOQA 4GL2A 3WWZA 1ZHHA 2IH2A 5EIHA 3VR6H 1XQ1A 2O1SA 1VP9A 1QHHA 1E94E 2CXXA 4OX9Y 4L5IA 4QDOA 3EGCA 4GP7A 5LQSA 2PD3A 2V7QA 3AB7A 3FWPA 3KWMA 4DYDA 4B3MB 1DZIA 2IEDA 3PEVA 4GI7A 1KYWA 4KQWA 4QXRA 4E5SA 3GLFA 5IAEA 3JYHA 3HZZA 2CB9A 2CL6X 3EFOB 1KYXA 2DUJA 3HLYA 1TKBA 3C7TA 4HN4B 2P9QA 4C08A 5IEJA 1U0EA 3OZBA 1YDEA 5AK0A 1NMYA 3A28A 1W7AA 1QSGA 3H2BA 4MJXA 4LRWA 4GOLD 2TMDA 1WXHA 4KFSA 1RWKA 3EFBA 3QYJA 1PVOA 2D5IA 4UUQA 2Y9PB 3CUKA 3Q9SA 4HNVA 4J1TA 3U3ZA 4E4TA 1WEKA 3AQ4A 2D0IA 1R50A 1AZLA 1WKBA 2YZMA 2JGDB 3ORHA 2EHDA 3V2GA 4WKGA 4V0QA 1B3RA 2H4YA 1DJQA 3FSEA 5CA0F 2OSVA 2VK2A 4V24A 1IULA 1PDVA 1ZIDA 3D2LA 3PRJA 1T6NA 1R0LA 2ZW9A 3BXEA 3GWZA 2YHAA 1AK1A 4WZAB 2OB1A 1YO6A 2E2WA 4C07A 3VKFA 5B3AA 1L8AA 2EL9A 2W93A 3IMEA 1LVUA 4K1LA 2XJ9A 4BNVA 2BH9A 1W6RA 2AKAB 2Y27A 3FTDA 3OBBA 3OCXA 4MW6A 1PGJA 4I2VA 1OZHA 3ICPA 5AD1A 3ZD9A 1SBTA 2X9VA 2YZ2A 4QWWA 3EQ6A 1SV1A 1VE3A 3KALA 2WA1A 3A05A 3JD2A 4GT1A 4MR7B 4BLSA 1I2AA 4J0IA 4RJLA 4DDUA 2ZB8A 4Z99A 2PVPA 2DCMA 4PNHA 3AOEC 4OQQA 1AUXA 1T9HA 1IN8A 4Q3LA 1O58A 5LMUB 2VNHA 5JAMA 3JASB 3N3AC 2I1VB 2JKYA 3S1AB 2JGLA 3ESYA 1EXNA 2W83A 5LQUA 1DUVG 2BTQB 2PRSA 1QDUA 4RJJA 1RYNA 4P3NA 1SKBA 3BH0A 3K6RA 3W4IA 4N3GA 2HPAA 3FPBA 3P0HA 1L7NA 4NATA 4TN1A 4D9GA 2PJRA 4LSZA 1RU3A 1YDGA 1NQXA 3ADKA 5CIYA 1O4VA 4QEDA 4YCSA 4J3NA 5A6SB 4CWAA 4YCLA 4TKLA 1A27A 3GCWA 2GSWA 1Q44A 1W4AA 2PTGA 4J0CA 1II8A 4V0MA 4TZKA 4G97A 1FRFS 1M7GA 1GIAA 4ALJA 5LP6F 5BOVA 4MVJI 3JQAD 1OLUB 5FPPA 5TGZA 2V3CC 5JW6A 1KYZA 3AQIA 3RH0A 1Y6ZA 5EFOA 5JSZB 4O63O 4A8JA 3FUWA 5CMLA 3ZHSA 3VNVA 1GYRA 1ILWA 1Y8CA 4UUPA 2BEVA 5CHYA 3HV2A 4ZRDA 4DDVA 1YHYA 1IE3A 1GZDA 2Y1LA 4P3YA 2P5YA 4Z9YA 4TSFD 5IUJC 1C7RA 3I34X 2PT7A 1XC7A 1AM4D 4YJDA 5IAAA 4D1YA 1XV5A 2DWOA 4ZAGA 4QDJA 4LY6A 3GL9A 5DJ5A 1QLWA 1UOQA 3BK7A 4KITB 4DA7A 4XWGA 3RJMA 4B79A 1HRKA 1KDPA 1UKAA 3FJYA 3PLNA 4NBUA 5JPIA 4EZEA 1Q14A 3CH7A 2FP4A 4X8HA 5JY6A 1RM0A 3GXOA 4Z5XA 3R9XA 1Z5PA 4RJKA 1M33A 3O75A 2MSLA 2HLHA 2W6JD 5HMLA 3WFIA 5L6MB 4BC0A 1NI3A 3H3FA 3ENZA 2B1JA 4YFYA 3RANA 4RK0A 3RVSA 1DJLA 5FJIA 3ZZ1A 4LQCA 4DQ0A 4XDHA 1KQNA 3OJLA 4JBXA 1VSBA 1M6NA 2NZYA 2Z8YA 2BVNA 3L49A 2HF7A 3ORYA 4GFDA 4H1UA 5HDBB 3JQ7A 2F8MA 3R5KA 3W5HA 3NOXA 5EHQA 2A5FA 5EXXA 1U28C 3HU2A 2JBHA 4GMKA 4HDCA 4O1HA 4OQDA 3NCTA 3V4ZA 5D3MA 4HJXA 1CX9B 2A9QA 3AW9A 4RVHA 3W5SA 1XFAA 4I4TA 4F72A 3Q3IA 5DNCA 3V33A 2K2QB 1J9ZA 1FFBA 2AUNA 3FCUB 1A2KC 2OXRA 2OFPA 3A14A 3QI2A 1QH9A 3RSZA 1K7YA 5AHWA 3SC6A 5IZ4A 4HLDA 1SCUA 4FLMA 3C8DA 5EE0A 3AY7A 2HU7A 2BEUA 4YUVA 1Z63A 4LJ4A 3HVRA 1DCTA 1N32B 4JN6B 5LNK6 3ICVA 1COWD 1I1QB 1PTKA 1M34B 2O20A 1NN5A 3BMQA 2Q3EA 3BD9A 4PXYA 3WBKA 4IJKA 1KK0A 3NB0A 4XD7A 2YOGA 5K4GA 1L5HB 1IOLA 2IIQA 3BTVA 2XYPA 1SC3A 3AGQA 1T9KA 4PIMA 3DYVA 1NVDA 1K5PA 3NNNA 4U2DA 5FBHA 4CV0A 3ZLJA 4ZU3A 4R8LA 1HKUA 1NLUA 2QL6A 5LBUA 3ACBA 3IB3A 1DQNA 2WHEA 3VV3A 3X1XA 1XEFA 4KR6A 4BNHA 3FNBA 3SR4A 3O74A 1V16A 4LOIA 1VDMA 1R9NA 2XRFA 1T2DA 3DCJA 3EOAI 4LE2A 3FBTA 2JKZA 2QVBA 3GG9A 4PC3A 1VJ5A 3N2GB 4G0NA 1K75A 3LW8A 1NW7A 2IGBA 2OBBA 1Z07A 2FPMA 3NDJA 5I9TA 3RVKA 4EDHA 1FLNA 4HDMA 4LHEA 4AULA 3LRTA 4XAQA 2XYQA 1TYDE 2EGHA 3HJHA 3L7NA 5DNDA 3DOCA 4F04A 4OYLA 4JCOA 4WD3A 5AVSA 3LT4A 2TMKA 4XJVA 2ZUDA 4R9NA 3AM1A 4GYYA 3W6ZA 2PZKA 4P0TA 4MK4A 5CVTA 1C14A 4C3UA 3SC4A 1NXOA 3IULA 4OHZA 2NUTB 1S9HA 1L7PA 3H20A 1ZUD1 3MB8A 2J70A 2FW0A 2V9PA 2GCGA 4IBOA 4BX2A 1RE0A 3O38A 3KQHA 5K3FA 3H9UA 4X8MA 5CDFE 3NDRA 2XRZA 2A1IA 2ZJBA 1J42A 4RHXA 3NGMA 3DVSX 2EFEB 1FMFA 1LSUA 3TLJA 1FU7A 4D0GA 4WXMA 1S7CA 2YUIA 2VEDA 3VNQA 2B61A 4IJUA 3RG2A 3BKWA 2PGAA 2C7QA 1HKHA 4EGCB 4JVNA 3EZXA 3QY9A 4Q7LA 4WJKB 3IAUA 4FOPA 5H5JA 4CMCA 3ZIDA 1FEZA 3E9QA 3OIDA 1P8AA 1Y3BE 3NAQA 4QX6A 2VTKA 4DLRA 3G7UA 1YL5A 1YOBA 3HKDB 4QDKA 3ZW8A 1PG0A 2JVIA 3I4LA 4PPFA 4EJSA 3QMWA 2IUFA 4TS1A 3KU4A 1I5EA 3TCNA 2G0NA 5BNWA 4ZQEA 5K6AA 2OR3A 3IX7A 3MS7A 2PSDA 3ZDZB 1H2RS 2Q5OA 2EXXA 3BXOA 3ZWKA 2AEMA 3L6UA 4LBYA 4UAGA 5FUBA 1AKYA 3CF4G 1QP7A 1E32A 2G1UA 4FD2A 1W85A 4RKWA 3L1HA 1JR3E 4I9GA 3DWGA 1UBRS 5FOWA 1J00A 1XT6A 4M60A 2RAFA 4TVOA 5FJJA 1LVGA 1N5MA 1SPXA 4D45A 3RFUA 5FL7D 1M2WA 4IOJA 3EUFA 2CW5A 4FBLA 1LSJA 4K88A 2OO3A 5J2TB 4X41A 5JTTA 5E0KB 5AOCA 3BZBA 4NMWA 4X60A 4M0LA 1AQIA 2XF8A 4O1MA 5IAJA 2O8VA 3Q5GA 4ZIRA 2OZVA 4J7UA 4HATA 1VBNA 2DPMA 3FFTA 4EHDA 3V9PA 1TQ6A 2ONCA 1KO5A 2PQ6A 3SF0A 2G9UA 4PZYA 2V98A 3GFOA 1WXDA 2D1QA 4D8XA 1BU5A 3AESA 4OB8A 2IWRA 1TO2E 4XX0B 5H4GA 1NNUA 4CFZA 3CS3A 3WGZA 2EKDA 1M8JA 2FWJA 2PQ2A 3ADCA 2IVFA 2QE7A 1R0CA 5L4NA 3KJQA 4TV9F 1MV5A 4LBWA 5FQNA 4JHXA 4QYTA 2AS0A 5IKPA 4ZI5A 4GICA 3SBXA 3UG6A 4LXUA 4F3KA 3T5AA 1CYEA 1RQRA 2X77A 1NR7A 1F5SA 1E0SA 3U17A 4UKDA 5J1SB 3BE8A 2R5NA 4FMDF 5JSFA 2Q2OA 5DBFA 5F1OA 2OO5C 3OLCX 1TVKA 2JF0A 4YP7A 4ZEXA 1IK4A 2CLCX 1W2GA 2ROQA 3G0BA 3FG9A 5AUOB 2RFLA 2W7TA 5FWXA 1Y6FA 1JDBB 4JQYA 4GM4A 4F3NA 4WK4B 4CM6A 4AZ3B 1K3FA 4C88A 2H0QA 1I6KA 3KT3A 2ZRLA 1JJVA 3FRJA 3L1VA 3WWPA 2H2FA 4OSOA 1VKNA 4XIIA 2P2YA 2J41A 2JJQA 1BXRA 3D6AA 3EUAA 3ZGYA 3HYLA 4MS4B 3P8ZA 4AG6A 1PBTA 2YZKA 3HXPA 4RK4A 4MRPA 4LX0A 3VNRA 2FN4A 1G59A 4ATNA 3JZIA 4G3XA 1LBQA 2WEKA 4KO1S 3F46A 4GIBA 2N46A 2X8JA 1SUBA 2F43A 3HXKA 1YRBA 3KYDB 3R3ZA 4G0ZA 4QODA 3K05A 3TLMA 1EDZA 3G8BA 4TSKA 2BIFA 4MINA 2RHGB 1PSDA 4EX6A 4EKEA 1DTWB 1YS2X 3COJA 3HEMA 1UP6A 4V1CB 2FQWA 1KZ4A 3IMKA 4Q6BA 1RLJA 2V7QD 4JK3A 1UOPA 3ESZA 1E3WB 4RJTA 1XOIA 5BVGB 4KFRA 1T29A 1AU9A 2I71A 4NCXA 2WU0A 1HFKA 2UYQA 5EUQB 4G67A 4KG7A 4PRZA 4H6PA 4NOKA 2OT3B 4C6SA 5IAGA 3GFRA 3EXEB 5M3BA 4XUGB 2QI9F 5DLYA 2I1QA 4DQKA 1C4OA 2A9OA 4QC2A 5EYPA 3GUYA 1WSBA 5CFNA 3HR8A 5J23A 3TEJA 4H6VA 1BFDA 5JCJA 4MWEA 1YI8A 4M89A 2H5JA 3OKAA 3M34A 4IEFB 3FZEA 5KJ6A 3PUYA 2X13A 3UMGA 2RHBA 4W99A 4M1YA 3OLWA 3BAFA 1BH6A 3COPA 1YOVA 1DSSG 1V8DA 4KDCA 1JQKA 5BRNA 4ZYZA 4C5BA 2WP8J 2I6QA 4GI5A 5AJHA 5GZ3A 1IQ0A 3QVGA 4MW2A 1LI5A 1VKHA 1KEEA 1Y1QA 1HYQA 2VG8A 2H4ZA 5JEEA 4ENRA 1BVYF 1RADA 3L7JA 4TKVB 2D4HA 5IJAA 3C3YA 3G0HA 4EMUA 4AKSA 4X6LA 1N7JA 2L82A 4FNMA 4FXPA 4OV6B 1AGNA 4XR9A 1RHKA 2DPXA 3IALA 5EVJA 4Y2QA 4YJGB 1WZUA 2B36A 3DZIA 1CY8A 1QH1B 2C9OA 1LC3A 1X39A 4N7RA 4Q9DA 2QPOA 3VUEA 3AH8A 4PX9A 3TMAA 5B2EA 2DFTA 3KYIB 4I5GA 3JATB 1F8GA 1M2GA 2YRWA 3C4VA 3NZEA 4G5GA 2R44A 5FBQB 2HZBA 4DV7B 2C2BA 1TF7A 3U4QB 3EEBA 1RXEA 3O1IC 3OUUA 2ZPUA 4WZAE 3TAHA 4CMJA 3I5YA 2J31A 3FRIA 5A04A 4PINA 1D1PA 4JS0A 4YAGA 1XBTA 1GGKA 2D2IA 2FEOA 5IMBA 3G2JA 2QRNA 1P72A 2FMFA 2WD9A 3NWPA 1G7SA 1OILA 2DCUA 1ZOIA 4MUJA 4O0MA 3KYCB 3B12A 4UCXA 1Q0SA 1EH5A 1Y4ZA 1WMAA 3I4CA 4O29A 3UWOA 2B8NA 3NEPX 4JXKA 2CV1A 1ABFA 4IL5A 5KKNB 1E3QA 1LW7A 3FD8A 1AHNA 1KA9H 3PHCA 4KU4A 3K9NA 3WWCA 4YCDA 1HE8B 5CVCA 1RM4A 3BJDA 2ZBUA 1T0JB 1QB7A 5ALIA 2IXEA 1P1BA 3TLZA 4ZI7A 4TYNA 3CC8A 1MW8X 2JAQA 2HR1A 4GBMA 1WEHA 1B0ZA 2BJHA 2VHYA 3H05A 4MQBA 4PS0A 3W34A 2F6RA 4AJ4A 2HCBA 1GV0A 3B53X 3QMPA 2QTRA 1I4DD 3IT0A 3IHKA 4LXTA 4GC5A 4FI3C 4Q7KA 3ZX5A 2WG2A 4YUZA 4WCFC 1YJQA 1JKFA 3K20A 2FQQA 2G9VA 4Q19A 2H9YA 3LOPA 5BSTA 2Y4NA 3F97A 3MBIA 4P4SA 4Y6GB 5DYNA 5TQ0A 4ER5A 3K70C 1IVSA 5TQJA 1FXUA 1OXVA 4CKCA 2XECA 5AKZA 1Z3IX 4MVJF 3K32A 4KEAA 5E3IA 4QBFA 4LJ8A 3E7PA 1NE2A 3IOYA 4DEYA 2VTEA 2VDKB 2FX3A 2XRYA 2HDOA 2NXJA 2HA6A 1HEUA 1G41A 2C58A 3KSZO 4C05A 4YMLA 5CEJA 5J4VA 4LQDA 1LF5A 3BXFA 2BFWA 1XXLA 2FWNA 1SKQA 1KQOA 3ICCA 4LJ5A 5ES3A 4IHQA 1DFIA 4OHXA 3CUVA 2Q1TA 4Q00A 2A7QA 3OKPA 4W8OA 1A4RA 1E2GA 1I6WA 2AFHB 2I9PA 1GSAA 1XFDA 1SXJC 1X8XA 1POWA 3K8YA 3RC2A 3RTCA 3ZNOA 2UKDA 4R51A 3LUJA 3CVVA 4EKDA 1OCEA 2PGIA 5IAOA 1W5SA 2KMLA 2IIBA 1A97A 1HF3A 1DEHA 2GCOA 3GRRA 3JV7A 3NR2A 4QEKA 1J8FA 1CS0A 3HDJA 1O3YA 3F6EX 2R11A 2BHLA 1JP7A 1IQPA 1NBWB 1HLDA 1WDMA 3OOEA 3V7YA 2VBGA 1E7MA 4G4IA 4ARAA 4DOMA 3W4JA 2WIFA 1OFGA 4U4AA 2AZXA 3B6EA 2QSZA 2FLKA 3KB1A 3OTGA 3PHJA 4PSUA 1RR6A 4L5YA 3BVPA 4AJOA 3C1AA 2ZJ6A 4F9TA 1BEUB 2JD2A 1O5IA 1E6LA 2YDXA 4IPTA 4JT4A 4NAUA 4BMSA 4FZVA 4R31A 1E1QA 1AQYA 3FVVA 3RIGA 1N2CA 2EV9A 2IYZA 3KUCA 4B9EA 3IL2A 1TQHA 2GTHA 3AEUA 3KXPA 1EXVA 1P4AA 1J9EA 3L8YA 4BFTA 3LXXA 4HMOA 2CFOA 4D3FA 5JD4A 2E21A 3ZGOA 1NURA 2JKVA 1KP3A 2F17A 3OJFA 1Y1TA 4WZBA 1CQXA 2FXIA 3RFTA 4ZCIA 1GTRA 5E38A 2OV8A 3QUCA 3RFFA 1YD7A 1T36A 3FNIA 3LM8A 4UU8A 5A0FA 3CUTA 4G0YA 4PG7A 4YO7A 2JHFA 5CLLA 4C1BA 1FLVA 2IHZA 3NNDA 4X1KB 1DUSA 2IHYA 1W94A 3E7DA 1IBMB 4TS9A 1US8B 4O4JA 4JEHA 5AVVA 2P3SA 3DMHA 2GERA 2ZXFA 5EKSA 4CZ2A 2DR3A 1VE5A 4QAQA 5IXJA 1Z18A 2HBRA 1M34E 4MEJA 1TU4A 4J1QA 4L4YA 1BGWA 4Q7QA 4Q12A 2GBFA 4EUKA 1P61B 2ECOA 2QT1A 3PDCA 3G8YA 5EUMA 3B3GA 4GMFA 4I8DA 4JHLA 4ZPXA 2WIBA 3JVDA 4Z8YA 5KTPA 1QE5A 5SY4A 3PSAA 4B3JA 1SVWA 1U3FA 2ZJ3A 3C5WP 4H0NA 1CY6A 1P5HA 1T5IA 3OEHA 4GS5A 1LLDA 1SZPA 2ZRNA 4IH1A 4IHJA 1R9MA 3TKLA 3VHQA 3ZCRA 3ZWCA 4AVYA 2VZ9A 4L5BA 3GUZA 4XSHA 3LT0A 4DM7A 1GZ6A 1AKUA 3RRJA 4E5KA 4J4BA 1YXMA 2Q5QA 1V0JA 2BJVA 2ADOA 1GQYA 3QG5A 1TAUA 1U4SA 1J7JA 3B2EA 3HVJA 5ICFA 3HJFA 2P2DA 3AO0B 5DE3A 4CTMA 5A4KA 1OOEA 4JMPA 3ZC3A 5CDYA 1OASA 1TM3E 3SM9A 3LC1O 3VV2A 2NXNA 2CXUA 2QJOA 3U09A 2Q29A 1YKGA 4LE0A 4WWHA 3AIMA 4BIMA 4DMGA 2SCUB 2M98A 4LK3A 4MW5A 1X1DA 3VOTA 2FFJA 1PR6A 3FSGD 1BSVA 1E2MA 3R7LA 3TRHA 3SY8A 5JADA 4Y1RA 1WXFA 3EPLA 3AHJA 2Z2ZA 1CUCA 3PQ2A 4FFLA 2ZLBA 1QHHB 2E4ZA 4Q3OA 4D97A 3I5MA 1U7OA 4LJKA 1C41A 4JQOA 1PWEA 3LC2O 2CVZA 4MKFA 1N2EA 1ABEA 3IA7A 5ARDA 1JR6A 1HA3A 2X4DA 2XMDA 4TLDA 4OI1A 3RCBA 3RK4A 3AJRA 3HA7A 3KIPA 4AN0A 3HDVA 4FMBB 1HOXA 2JGKA 2KQUA 1FE8A 2C9BA 1E7RA 5KI6A 1J8DA 1L0BA 1P2UA 2AB0A 4UM5A 4XB6B 1CUFA 1ISIA 2QAGB 2Z2KA 4KN6A 4US2R 1K92A 1YONA 5C34B 4MVJG 2B37A 4TWAA 1OQAA 3UJDA 3BGSA 4QT4A 1ODKA 2B7BA 3IT1A 4M83A 1JQLB 1GAJA 3VTAA 2VJOA 2NACA 4FLFA 1YS4A 3IMGA 3RJ9A 3BFKA 4JYBA 2NAPA 3UHFA 4BQNA 1Y3CE 4YQZA 3NVDA 1Z2DA 1RC1A 5IM4A 4LJ7A 4XIGS 1A4IA 2JCVA 4E2ZA 3O0TA 6PFKA 2JASA 3W04A 3LUDA 1UTUA 1SQFA 1E79A 1IRXA 1M6EX 1NN1A 4UVGA 3UFBA 4Y2JA 1W6UA 2A30A 4OGFA 3F74A 3PUJA 1B4DA 1FNCA 2CJPA 3HNRA 4AXBA 3E05A 3EVNA 1SMKA 1BDIA 2BN4A 1I4EB 3G68A 3BN3A 4GUAA 1KRHA 2JLBA 3DLPX 4LHSA 3LWNA 2XITA 1DAGA 4OXYA 4PTLA 4QOIA 4TKMA 3WTBA 4KJXA 1H2BA 2QMYA 1JKJA 4OOEA 4P84A 3TWOA 1X1EA 2R7LA 3HDGA 4C6TB 4EHFA 5C5CA 1IY1A 3I6QA 3C70A 4EAQA 2GOYA 2WVAA 1YZNA 3HI6A 4LWPA 4Z2AA 4Z0PA 1JTFA 3A0UA 2O3RA 2QY9A 3CF2A 2CNDA 2DHRA 2I65A 2YVLA 4YY3B 3BXXA 4IRMA 1PJAA 3NAMA 4FDMA 2OHHA 3JPYA 3RARA 3CINA 1XDWA 5ECYA 4MYHA 1QIFA 3LYAA 3GJQA 3ZV7A 1I8TA 2XMSA 3NPMA 3G8DA 2VSXA 3GN1A 5B3KA 2CDRA 2IGTA 1GT91 1OGJA 1EMDA 1I13A 3KC2A 3ICQB 2BW0A 4BJ1A 3AEYA 1EDDA 1S2IA 4ES6A 4H1WA 3OCUA 3Q5EA 3RO7A 4EO7A 4A8JB 3L0ZA 4DIMA 1Y6QA 3AVQA 3SD7A 4EB6A 4AY2A 2BEVB 3IXMA 1WW8A 1NUAA 4XFKA 1PVDA 4I3GA 5ELLA 4XOUA 1PR4A 3E22A 3NHKA 2BF7A 4P4TA 3FYUA 4NNOA 1T5TA 5FOVA 4DPLA 3DC7A 2OCLA 4ZI2A 1UF9A 1QDEA 3TVDA 2PFKA 3PD7A 4MIYA 3FDJA 4ZK6A 2Q7OE 1SQ0A 4JA2A 4QQ8A 1CUXA 3QVWA 3MS2A 3GQBB 4MYCA 1AQNA 3OG9A 2ZSJA 5KAMA 3FIUA 5JH7F 3EBOA 3TQQA 1P17A 1FLDA 1LPNA 1N3BA 4RMJA 5E9JA 3VZCA 1KIFA 5BPHA 4MUNA 3IP9A 1XMXA 1YMVA 3DB2A 2IPNA 1KKUA 3GW8A 1ID1A 3QXSA 4C78A 3STXA 4BZXA 1QCCA 1N78A 4X97A 4FDLA 3I04M 4UDYX 1U8CB 2ZXUA 3DLCA 3JQ7B 5JCJD 2P27A 5DW3A 1AK2A 1IC6A 1EINA 4HD8A 4TV8A 1GPDG 3CVJA 1Z34A 2H17A 4ZZ2A 1RMYA 2QX8A 4I66A 1WXXA 5TEVA 3SQDA 1M3SA 4YRNA 5JNWA 3K1TA 3M6XA 5D3MB 1CHDA 4DT1A 3RAGA 3U4AA 1DG1G 1OAOC 1CP2A 4I4TB 4R1MA 1SB8A 1CU1A 1FFCA 2JGIA 4LJAA 1VSUA 2RBEA 1GOTA 5K8CA 1U3CA 3DAGA 1PBNA 1DC8A 3DV9A 3NORA 1I0ZA 3KHKA 3FF1A 4JR1A 1EKXA 5JZ9A 3IUMA 2BKLA 1S1MA 1VOTA 1U8UA 1VMAA 3O9ZA 4A03A 4MQUA 3OZEA 1PL8A 3A8TA 1RLTA 4QLOA 1DRKA 3WNBA 5C8VA 1ND5A 3RC9A 4N6GA 2ZIXA 2YH2A 4WQMA 1TZKA 1UCFA 1UK9A 1FRNA 2FSVA 1G42A 3G0DA 3I9KA 3FUTA 1SEPA 1TT5A 2AWOA 3L92A 4I5IA 4EB3A 3IEMA 3WJAA 3MJTA 2VAWA 2WA2A 3NH6A 1Y8RB 3NONA 5DVZA 5CB4F 3O2SB 4C2BA 2AN5A 4XWWA 1U31A 4YYEA 1TF2A 2LE0A 1PNVA 3H87A 1W96A 1KH3A 3WGHA 2IH4A 3MWFA 2YZNA 1V16B 1RCTE 3WSTA 1Q92A 1T4GA 3DJYA 1BYIA 1SXJE 3DT6A 3T1TA 4R8KA 1U2SA 1UBNA 1YIOA 3G2KA 1FJHA 2JLUA 3QJGA 1DC7A 3QY0A 4GSLA 4HDMB 4HGOA 4M99A 5TV2A 3HCNA 3ZY6A 4YMHA 4HRYA 3ZE7A 2Y0BA 4PU0A 5A5GA 1ZMRA 2OOSA 4YA6A 3IDOA 5DXJA 4HRVA 5IASA 1GTSA 1Z39A 4IWXA 1EIWA 2P9FA 2ZRKA 2QRMA 4MYDA 3R6DA 1NW6A 1Z4IA 2IZ1A 2RI1A 4UREA 1HOTA 2HYIC 1ZLXA 2QVGA 1EX6A 1OBHA 4REQB 1V43A 1P0PA 1P9WA 3L77A 2VFAA 2V3VA 3D3EA 5LMNB 4RCVA 1QWSA 4WKCA 4GI1A 2DM6A 2HRDA 4BWGA 2XKKA 3K3PA 2F90A 4WPGA 1I14A 2JAUA 1Y8AA 2GK7A 2JFFA 2WUEA 3IAS1 5K3FB 1T2AA 3KQPA 3WMGA 4E5UA 2FH5B 1TNDA 2WUGA 5BQFA 1KTIA 4HB4A 1QOPB 2YN2A 4OPMA 3PUXA 1JJAA 3BK1A 5CT8A 4CLXA 3I9LA 4N7BA 3T7TA 3ZWOA 3ZD7A 3NV7A 4NZZA 1D1SA 3PC2A 1FUKA 5AVYA 3E8XA 4JT2A 1IN7A 2GM5A 2P4HX 1K8QA 2JPDA 1QK5A 2IZ5A 3MN1A 1N33B 4YHHB 4XGKA 2C4HA 3ETLA 4P3PA 5C8DA 3A6EA 4QA9A 5B12A 1HM5A 1E9BA 4MUAA 2Q0SA 4JEUA 5D1NA 3PGJA 2R1TA 3TGLA 3GZNA 1VHDA 4Y6LA 3ZJVA 4W5NA 2PPVA 2VN8A 3PQ4A 1V96A 2J7KA 3G2OA 4MNTA 1ZGHA 2WTMA 3I8SA 1E58A 2EU8A 1W29A 2HMAA 2QTFA 1ADGA 2W71A 3I2HA 3ME5A 1P1FA 4RSHA 4WMLA 3T7CA 2Y66A 4Z54A 5BYAA 2FVYA 2W43A 2Y2VA 2GYYA 4IIBA 2VF8A 1W85B 2PG3A 1XZLA 5K4HA 2PLNA 2AIRA 4IDOA 2C2ZA 1T0BA 2NV0A 3THWA 2Z0MA 2PLRA 2W6NA 1KBQA 4W5RA 1FFSA 3F6SA 3UOWA 2IF2A 4DSTA 2G9QA 1F1JA 4NECA 4A10A 2VNAA 3QELA 3SXJA 4KXVA 5B6JA 5H4HA 2QP9X 2CSUA 3EXHA 5A71A 1KJ8A 1E1QD 3SYTA 1Z6YA 2J9FA 4JLJA 5L45A 1ORHA 2AFHE 3BHNA 5J1TB 4ZIRB 4RULA 2SHKA 4BNLA 2ZRDA 4Y6PA 3KHUA 3MLEA 2WM3A 3AEZA 1ZP6A 4JI4B 3HKCA 5JLAA 2WJJA 5EZ5A 3AKZA 4ACBA 3OQVA 1H2FA 2ODTX 2W4MA 3ZE0B 1WCWA 1U0OC 3AESB 1C3EA 3INRA 3PX3A 4CLOA 4TT3A 1GYQA 4D4HA 2QTZA 2L0XA 4D81A 2GSDA 1C0IA 1FC0A 1R0ZA 1SM4A 5T8KA 1VKRA 1FCJA 1Q74A 1NF9A 2YWRA 3U81A 1MXHA 5KYWB 5AYVA 4EG5A 1U0GA 5P21A 2BBOA 4E5PA 5JHHB 1KDYA 4MRAA 5KJFA 3OESA 4LV6A 3D1LA 4XWYA 4E46A 5IXSA 5ALZA 3FUCA 5F3RA 4QO8A 5FWAA 3NX4A 4N40A 3DTVA 3OLQA 4UULA 5HE8A 1GEEA 1PS8A 1YZ3A 3BOSA 3KE9A 4DC0A 5AW2A 3FMOB 2ZQZA 3CUYA 2GJ4A 3MGGA 2O6HA 3CSUA 4FE7A 1JI0A 2IZZA 4GOXA 4LVNA 3WK9A 5B3JC 2GFIA 4WFQA 5KQRA 1KC1A 4UMEA 4HSEA 4A92A 5THXA 1JNYA 4HLUA 1Y9JA 3SMQA 3OJXA 4RIIA 1F17A 1Z7YA 3I62A 1U6KA 3A6KA 3WA7A 3EMKA 2Q8PA 1KDTA 1Z3CA 3ISVA 3MYYA 3VBEA 4N0EA 5CNMA 1TF5A 2FLVA 4KE6A 5D6OA 5ALTA 4N7JA 1Z2AA 1E6CA 3ENVA 3DBIA 4X71A 2CLLB 4TPKA 1YA8A 2OLKA 4EJSC 1WPQA 5IULC 1LTQA 4Y0AA 1CF9A 2B0CA 4P3KA 2X8JB 5K6AC 2OA0A 2XIQA 4GAEA 3LHIA 3ZOZA 4RA6B 3WIOA 1XCMA 1YRLA 1VYTA 1MFZA 1XZDA 1R6TA 2OGSA 2WVHA 3ESQA 3ZJ5A 1WMFA 1PUJA 1KEVA 3I9OA 3SYRA 4WLUA 4DCSA 2Z3WA 3D6MA 5DXFA 1AZTA 3B8EA 2QMUA 2ZB4A 2WG1A 2WTXA 2XUGA 3GLVA 3O3NB 3N0XA 1XHFA 2VSNA 2Y76A 3NM5A 3OZ7A 1GPLA 1YJAA 4QUDA 3MBOA 5E4FA 3U7QA 4CMKA 2D0DA 2D3WA 3THOA 4IF4A 3AJAA 3OJOA 1FNNA 4HPWA 1SCDA 4HZGA 4LYYA 4X61A 1MHTA 2VJKA 3W05A 1J56A 4UVHA 1K68A 1Y9AA 4RTSA 2ZCVA 5C7IO 3QVJA 4GVXA 4CV2A 4W82A 3OM1A 2GD0A 5EYPB 4NYMR 2V6FA 3FCYA 3UYLA 1A50B 3IT3A 1QHYA 3LFHA 4LMRA 1DAMA 3PC3A 3P27A 3Q8LA 3GBSA 1S3FA 4N3CA 1ZRNA 4ZQBA 1J7KA 5KWIA 3UJ3X 4M9UA 2RARA 3E9RA 4FFMA 4CQLB 1QGED 1YOVB 1DTSA 5KQSA 1GITA 1AKMA 4U1RA 3JWIA 3RJZA 3AY3A 5AVRA 1P2VA 4WI1A 2AC7A 3QVGB 4ZOBA 3T5CA 4D3XA 3LTEA 4ZYXA 4MLCA 4F91B 1TUBA 3OY2A 4HVAA 3C5CA 4MUYA 4O4LB 1T2CA 2D00A 1HDGO 3TLYA 1N6PA 2C99A 2YINC 4CCWA 3RYCA 5CR9A 1XZJA 3CNHA 2XUPA 3CZCA 3WE7A 1EP2B 5JTUA 1T2UA 4UW9A 1M6VA 3UJNA 3RAFC 2A67A 2R1UA 2Y6UA 1NV9A 3AF5A 1N5KA 3LA6A 2BI8A 2VI5A 3OA2A 3CCCA 4KXMA 1G21A 1LD3A 2WHXA 2YFYA 3NBZC 1AGYA 2I6GA 2LCQA 3W1WA 4CMHA 1Z6TA 2Q28A 1JH8A 4PSKA 5IJWA 2P0AA 2PR2A 3B1YA 2XB2A 5CVJA 5D5PA 4L8VA 1DEXA 2KWIA 4DG5A 4B47A 2O54A 3NC1C 1CUEA 2HNKA 2JARA 3DVLA 1ES9A 3U4IA 4K6GA 4RGBA 3UK6A 3H7AA 1OD6A 1RS0A 2E4WA 1E4EA 5K3OA 1GCUA 2SECE 3W77A 1KYYA 5MGNA 1SUSA 1N6NA 4B45A 4J0HA 4Z51A 2HK7A 3DD1A 2QRKA 3WISA 5AKXA 3U3RA 2ZT7A 4XWAA 4ZTBA 2C4TA 2FG6C 3ZIAA 1JVSA 1EWTA 4CCAA 2Y67A 2I1WA 3OZCA 1A9QA 4P98A 2O5VA 1YJ8A 4PTZA 3WXBA 4F2GA 3UHOA 4ESVA 1XB2A 2HLDA 2WOOA 3C74A 1XZPA 2HU8A 3EVFA 4ZI7B 2W4IA 1NX6A 4L5CA 4Q9HA 1W9MA 1AO3A 3D7NA 3NRBA 2RH4A 4JU9A 4YJ2A 4D25A 1KZ9A 3FHLA 2KHZA 1CEYA 1W581 3R8CA 3O7WA 4J03A 3NS7A 1AF7A 1IPFA 4MKXA 4CF6A 1JQJC 4IS2A 4LMBA 4TMFA 4D7AA 1SHJA 1QFSA 1ZL0A 2JAXA 1L1QA 2PX0A 4LI3X 3F8SA 4FPXA 1N7IA 3SBDA 3OFJA 4NCIA 1DAOA 2H52A 3SZOA 1UMCA 5BWOA 1YZTA 4G4JA 1WV0A 5K6TA 2DWPA 4BC1A 4P4SB 5DK6A 3AEQA 1XAHA 3RVDA 2KSQA 3EY4A 2GFQA 2YNMD 1U8FO 4J94A 5G1OA 5JZBA 4BQRA 4CKCB 1Q20A 4BNDA 3VR6A 4V0ME 3BUSA 4MW1A 2P3QA 5KNDA 2PK3A 4IG9A 1OFUX 1IJFA 4OXRA 3PNVA 2O8NA 3K4HA 3F4LA 1KYVA 3PPYA 4H35A 4MO9A 1CZLA 1W35A 2FZVA 2YOFA 4NF2A 4UFPA 3OO0A 4I1YA 2OORC 2ZBPA 3IVMA 3IE1A 1QVRA 2AHOA 3FPJA 3R0QA 1A2BA 2GJKA 3FMVA 1IYZA 3IAM6 2JGFA 4B4VA 1E2DA 5EQTA 4PQRA 1QM5A 1Q83A 2FPRA 4A0FA 4BKPA 1FSZA 3MB5A 4N5DA 3WFJA 3C6KA 4H7JA 2QRLA 3OWXA 3KLNA 1E2BA 5DLPA 3QV2A 3RUFA 1IEQA 1ZH0A 2B8WA 3UKOA 1FMJA 3W5IA 2OBMA 2OC4A 1JEEA 3KUDA 5EIEA 3M8KA 1ZVJA 2VDWA 1JHDA 1CS0B 2Z1NA 4FUQA 4I1SA 1T1EA 1GNPA 1G1AA 4CQNA 4KRFA 1UBFA 5A03A 4FS8A 1EE2A 5C35A 5BV1A 3UICA 5DM60 4PPQA 2ZDGA 3B51X 3WP1B 3DD5A 1ATIA 1JQEA 2QB5A 2H29A 1XYGA 2RBKA 4O0LA 2K7FA 3WL8A 1AXEA 1K63A 5EWMA 2XBUA 3HO1A 3BJZA 1OX6A 3IJ5A 1N2CB 1NVBA 2CZCA 3T1HB 4AWXA 2B21A 1U0SY 1X7DA 4QARA 4XQ9A 4LWZA 1VC2A 4WZBB 1DBIA 5AJVB 3IP8A 2NZJA 2X9NA 2OM2A 3GEMA 1FFYA 5BW8A 4DBLE 3V1KA 2H2AA 2C4WA 3TD6A 3Q11A 2WDZA 5AQ1A 2ZSAA 5BUCA 5EEGA 2OQ2A 4O4JB 1XPUA 3WZ2A 2BDTA 2WYOA 3U4HA 3TIIA 3K2EA 4CIXA 4XWOA 1UDWA 3EC7A 4KMRA 3E9MA 2CNWA 1BFKA 3DV0A 4C0XA 3O8BA 4X3CA 1FA9A 4LVUA 5ALPA 4ZVOA 2HV9A 4PIVA 2CDAA 5CD1A 1T9AA 4HHEA 1PK8A 1DP4A 3ZDFA 4W5JA 3ECAA 2BFEA 2PKQP 3PQEA 4RF2A 4XIJA 4CL0A 1TQDA 3IQDB 2FZGA 2QRPA 1RKVA 3RABA 4M4SA 3TR5A 2Z95A 4FBMA 4DMLA 3JQEA 4YCJA 4YLYA 4Q16A 4IHJB 1U1FA 5K4AA 2J9XB 3VZQA 2JLXA 1QDLB 2CF6A 2FRVA 3ZZUA 4FN5A 4HQRA 5AVKA 2F7SA 2IEGA 1DO8A 1X2EA 2VQDA 3TRJA 2YMPA 4UE3S 4OK5A 1MV8A 1PUXA 4I50B 4JELA 1IM8A 1C5KA 3IPYA 2ZCJA 4B6OA 1O6ZA 2FUEA 4BEBA 2XKAA 2BFFB 1MPXA 3F6RA 1JQAA 1XVIA 1ENZA 5BV2P 1ZHOA 4D4KA 2RGRA 5K2MA 4PXAA 2CUNA 2ZRMA 3AJ9A 3WLTA 2E9SA 3BCHA 3U7IA 1VJRA 1OZ0A 5K01A 5CK4A 5ALHA 4B33A 2Q5FA 3EIEA 4QHYA 3W06A 3RVRA 3O26A 5F2EA 5E2IA 4REOA 4L0QA 3LDAA 2ZYUX 4JX8A 5EZYA 3FGZA 2GQ0A 1NGSA 2P9HA 2QIPA 2W58A 1GPKA 1IN6A 3TRFA 1IXKA 3FYTA 3NW9A 4HNQA 1AKNA 1YRWA 1UK7A 4EMTA 1PJBA 4CM5A 4KZPA 2YJ5A 5BNZA 3WDLA 3Q8WA 4BVKA 1JS1X 5CIQA 1M1YA 4DMMA 4E5YA 5H81A 5U4QA 3LPDA 2XD4A 3RADC 4UD6A 4QGAA 2EYQA 3DKKA 5F1PA 3GMTA 3CJTA 3CURA 1ORRA 3PV0A 1X1TA 1HV8A 4QEZA 3K4QA 1KJWA 2P78A 2P6PA 2GVDC 3AUAA 4MRRA 2YJ6A 3RR2A 4C0BA 3K72B 3F78A 4EP1A 1A9ZA 3IXQA 2ZIGA 3WL6A 1BE1A 2B9EA 2BUCA 2YICA 3PIIA 1P4RA 1E0KA 1WW2A 5AVQA 2R8OA 4B43A 4JYAB 5MGBA 3W4KA 4EG0A 3NBKA 1CUZA 3V8QA 5G40A 2ZROA 4TT3D 2X1LA 1KJZA 2PWYA 4MOWA 3BIJA 3I6BA 1XJ0A 9ATCA 3BB1A 4BP9A 5KX5F 3RRFA 3W1EA 5TMDA 4NQRA 3T3EA 4GLOA 2C5EA 5IDXA 5TS2A 5DGDA 4OJNA 2VF7A 1H6BA 4OB6A 2JHAA 3R7BA 2ZRGA 1PDOA 2B2XA 1B00A 3P2JA 3GCXA 3Q3EA 1JKJB 4RYDA 2C59A 4C29A 3GNTA 2A35A 3DTVD 3SE7A 5F9MA 2XUJA 5FR2A 1NJ5A 4C3VA 1F3LA 3T9BA 3KQMA 1H4VB 4PRLA 2IXBA 1SOUA 4DUGA 1VL2A 3D2CA 3OQJA 4IGAA 4YAJA 4ZOLF 3EIXA 3PHBE 1G18A 4YCBA 3GHYA 2BGTA 4XM0A 5D86A 1A0OA 2MJLA 2FEMA 2Y71A 5BV8A 3HZHA 3GEBA 3I3SR 3OM8A 4JJFA 2GZHA 2YXBA 2OVBA 1VCOA 5HDQA 821PA 1D8AA 4CGYA 1S2MA 1ZKDA 3A6GA 1L8LA 1VB3A 3H6HA 4OHFA 3UOGA 1OYOA 3BMCA 2XUOA 4R8VA 3U39A 3OEEA 4ARZB 4E32A 4HADA 5CA1A 3R5TA 3JD3A 1DKNA 1RXUA 4BASA 2XWBF 3EC1A 2DFLA 3BGVA 3ZLBA 3DA8A 2HXYA 3DMDA 4YMSA 3W6PA 3W3AA 1E9FA 1JEAA 4UM7A 1MJFA 1XE3A 4PICA 4V0LA 1HYEA 1ZSVA 1E64A 2XCLA 3E22B 3ROZA 3FYUB 1M2EA 4M1KA 4EO4A 3PFGA 3GPIA 1E3TA 1GPMA 1MPTA 1C9YA 1X14A 3EXIA 4OHOA 3CCFA 3TZBA 4BE7B 4LS3A 1BHO1 4BLWA 3GGGA 1UXJA 1ZG3A 4TMTA 1SCQA 1PR9A 2LV8A 3AR4A 3RK0A 2V7EA 3SNHA 1RBZA 1C9MA 5IHXA 2ZI6A 1NM5A 1PSWA 3NIWA 3K1AB 3EDYA 4ND6A 2KLBA 2P6MA 3C3WA 3HCPA 4IXMA 4J7AA 3FFAA 4BYMA 2FWPA 5LOVF 4ND2A 2C0CA 4G56A 4I3FA 5FHRA 4UEKA 3WQHA 3OPQA 2XLBA 5EE3A 4BS9A 4KWEA 3QH4A 4GXTA 4MP6A 4TV8B 2FTKE 3KJZA 3WL4A 4AJPA 1C3XA 4M1OA 3ITNA 3MUFA 4JC8A 4BUJA 4NBVA 4DT1B 4LYDA 3IEPA 2MSEB 1BCSA 4LY3A 5E4YA 2GYUA 2HXGA 4TQ9A 1PEAA 5A2GA 1HFEL 3VDQA 7ABPA 5ER6A 4DVGA 1CEEA 2RK3A 4ZCTA 3A37A 3VU9B 1Z35A 2NZXA 3OLYA 3TSOA 1A3CA 4R0VA 3OZGA 1EFRA 1JIQA 2QN9A 2J45A 4IDPA 4NKRA 4NJEA 4EH1A 5TF4A 1V4BA 3DFIA 5L3QB 4ZOAA 2Y1WA 4NJMA 1U9JA 4YR9A 1YT5A 1H5NA 1JWBB 1PV2A 4KX3A 3NHJA 4NQZA 2RCYA 5F12A 5AW4A 1I10A 2ZIXB 4D8TA 3BQ9A 2A5DA 2F3TA 4BNFA 3IOMA 1KAEA 3FTFA 4RHYA 1TT5B 3Q10A 3KVYA 4GPZA 4QFCA 5SICE 3VH2A 2V1XA 1RQXA 4MB2A 2XKJE 5K99A 3DUWA 5J4HA 4AQYB 1D4ZA 421PA 1G8GA 2GDJA 4L4SA 4MMZB 1D03A 1T9GR 4FFSA 4BV2A 1Z4OA 3P4UA 3H1AA 1U2PA 2ZS8A 4KAAA 3CU5A 3RM3A 1I7QB 1Z0IA 3I1YA 3KLOA 4Y30A 4MYSA 3ENNA 1SWVA 2FX5A 4D41A 3ZHXA 3Q88A 5C7YA 4O3MA 3MQFA 1SCKA 4QYWA 2WUFA 2MMCA 5HUJA 4K0KB 3ZIAD 3UWMA 4B3SB 3H5AA 3UVEA 1UK8A 2Z6VA 1Z8FA 3Q15C 3T0IA 1YQGA 1IMJA 3JR7A 1I33A 4LNUA 5LMZA 3MCZA 4TVBA 5BSRA 4M0FA 1RP1A 4LDZA 2HLDD 2QD2A 1Y1LA 2J0EA 3PRKE 3RS2A 1GDHA 4W8HA 3FCAA 1Q0UA 1E60A 4HXEB 4RU1A 1A7JA 4RANA 3WLPA 4F21A 2FETA 5LQCA 4EX7A 2R85A 3MEQA 1K7EB 5IC4A 4XSVA 3HJNA 2BM0A 1Q7EA 3TTWA 4YRJA 4YGYA 5FNVA 4C9BA 3LP6A 1N0HA 1CW2B 2HM7A 4GR5A 4R2JA 9GPBA 4JR2A 3V6MA 1GL6A 4JV5B 3EOZA 3ELDA 1CRLA 3A9RA 4ZD6A 4J07A 2FFBA 4HN9A 2UU9B 1XVTA 2DBYA 2YFHA 4C7JA 4PBRA 5I9MA 3WK8A 4K26A 1I1NA 3THXA 3UWSA 1GGHA 1TM7E 4U02A 5JJBA 3MRVA 1F4VA 1P31A 3X2SA 3HM9A 1CE8A 3UTCA 1ORTA 2QGFA 3KOOA 1R4NA 2JCBA 5HQ3A 5FPHA 3KSAC 1Y4AE 1POXA 1QU3A 4DV2B 2QJFA 2OQRA 4J2OA 4ZZ1A 1JZTA 3BHJA 3KQKA 3UOAB 3N5CA 3O2QB 4HV4A 3PEEA 5DPMA 5A7FA 4OKNA 2L19A 3MIIA 4PY2A 1SBQA 2PMCA 2OB2A 2PXAA 3KO8A 4GR4A 4KX5A 1J4AA 16PKA 4DMCA 4EHLA 1F8UA 3EEOA 3KKPA 2VHVA 1YR8A 3MRTA 4LW8A 1OZGA 2C07A 5CFOA 3TW8A 3V7NA 2FWRA 5KU1A 1BIFA 2IYEA 4YJ3A 1E98A 1LV7A 3GUCA 1XU9A 2X6QA 4IGFA 4L2IB 5IPFA 1M0EA 4WKBA 1XVAA 3CEAA 2X3YA 2OFWA 2YVAA 4XVHA 5K05A 1MIHA 3BGOS 5J2UA 4QUJA 3THWB 3A1WA 3I53A 5EZQA 3TFWA 1DIBA 1TCVA 1TC2A 5LD2B 3I0MA 1ZR4A 1ULHA 4OHBA 4O4IA 4TUYF 2EYUA 2VCHA 3EJ6A 4ENWA 4XRRA 2PH7A 1XJCA 2P75A 1T6XA 3DZGA 3EXHB 3SGLA 1C1DA 3ZU3A 4EA8A 3FETA 2AMLA 1DKUA 1B1CA 2PZLA 1UQRA 1ZH4A 4ND7A 4ITVA 1B8PA 1P77A 3HKCB 3ETJA 2NLOA 5FFMA 4A6PA 4BUCA 1O54A 3T7IA 1J0BA 4JBIA 1PG5A 2W2KA 4J75A 4MICA 4UMDA 4BQIA 4CLOB 1V8OA 2PMEA 3DOIA 2JEYA 2Y4OA 3A4MA 3BWEA 5KYNA 1JHVA 3VC7A 3AZPA 1H69A 2QG6A 3DDHA 1Q6ZA 4FCTA 2WZCA 3NC0C 1J09A 3CIOA 2OGUA 1A7UA 3TIGA 3F7NA 4F60A 4FE3A 1JG6A 4P38A 2C2OA 2V7XA 4KK4A 3IO3A 2CNWD 1KU0A 1GN9A 5CTAA 2ATEA 1PG2A 3ORFA 4TT8A 3UA4A 4MQ5A 1N2CE 1SHTX 4XI9A 4Z0HO 5INTA 2XUZA 4YI3A 5EP2A 2FMTA 3DTVB 2VJBA 4EKYA 3WGJA 7YASA 1LS1A 2YOHA 4D9HA 4DCPA 4A6XA 4F1WA 4GGMX 1YZGA 4WZBE 3TSWA 3ZWQA 4YP0A 2GR9A 1NXXA 1PQUA 3IPAA 1W8IA 1KPHA 1G63A 2G63A 3G2IA 4RDCA 4NS1A 4DHEA 5THQA 1VPTA 3OO1A 4KDFA 2D0OB 1Z6GA 2HNBA 4XW2A 1IY9A 3GBVA 3RYFA 1Z13A 3VNSA 2EJCA 1BU8A 2PUVA 2PZEA 4WECA 1KQFA 1W8DA 2PXXA 4Q1EA 2OHXA 1JG3A 3BHMA 5I9SA 3V8VA 4K87A 1WKVA 3NKFA 3NXKA 1P4SA 1FVHA 1HE3A 5J4YA 4IIJA 5JQGA 4QGSA 4Y1GA 3QE3A 2LVBA 5IVDA 4DR6B 2EKZA 3HCDA 4N3NA 3O8OA 3BD8A 3GJ8A 3QU4A 2KX7A 3EH1A 1CRPA 4NCBA 3BRSA 3H3XA 4XYLA 5HKOA 1Q22A 2YWHA 4JBHA 2C84A 5F64A 3C3CA 1NOIA 2Y1CA 3Q87B 1INLA 5KAPA 4A27A 1NR5A 5A9SB 5I5EA 3QWIA 3RYTC 1G0OA 4DMRA 4BUZA 5DLQC 1RWPA 3RS5A 4HEA6 3U7QB 3KBBA 2AJBA 1QVZA 4INOA 5BUSA 3RNOA 4RIEA 4ALKA 3DLBA 4AUNA 2IU3A 3C8UA 3KR9A 5FFNA 3IEVA 4QVIA 4S1PA 4H08A 1CNMA 1NVEA 3DAFA 2ZBVA 3E48A 4QTTB 4UATA 1MQ8B 4FSDA 4XDYA 5ALEA 2AJCA 4YRGA 5JT1A 2Q7XA 4DZRA 1CQIA 1G5TA 4Q24A 1GQOA 1W5EA 1TJPB 1F2VA 5D8DA 1LBTA 1J2YA 4FKMA 5T4EA 2PZBA 4MI6A 4CLHA 3X1MA 5JAOA 4FGZA 1GTJ1 3I04A 5FAXA 3O31A 4WADA 1LLFA 2QT9A 4WRRA 1ULTA 2ONZA 2MINA 3LNTA 1WVIA 4MVCA 1DRWA 2UZ3A 3GRFA 1M6VB 4RJ2A 4F5EA 3C3BA 1FJ2A 1IH8A 4RCYA 4JQCA 4B2YA 1ZKMA 2GAOA 1Y82A 2LWIA 5F2OA 2P41A 4IP0A 1G21B 1FOEB 3UQYS 4BLPA 1SVIA 3SI7A 2EL7A 1NAHA 4ZAWA 2QG4A 2GDZA 5A3JA 2PGLA 2V3WA 3KVVA 4EB0A 3HYRA 4P82A 5AKIA 3F0TA 2PLAA 3L40A 4GDMA 1Y3DE 4CR6A 1CYDA 5H02A 5HG0A 5NLLA 5KYXA 3GROA 4RPJA 4DUGD 3GT4A 3JW8A 4INJA 1F7VA 5EMHA 2Y1GA 3U49A 3EEYA 4IVNA 3I01M 1A2QA 1WUJS 3L02A 4L74A 5HHTA 5LYJF 2EATA 3LO8A 3MQ4A 4NYJQ 5E7IA 2LKDA 3PENA 1FFAA 2XTZA 4FJ2A 3B1VA 5IVHA 4F5ZA 1D2EA 3L0IB 4LY0A 5ADVA 3OZSA 3TOZA 1SQ6A 3QVXA 4UNPA 3RBXA 4HRAA 3BE4A 1ZYUA 4RKQA 2PD4A 2KYRA 3QX7A 2UVPA 2D2FA 4K6MA 4Q21A 4GPBA 3HJCA 3DZJA 5JNRA 3QUQA 4YJ2B 3C4QA 1ZOPA 5DWQA 2D7JA 2QM7A 4L8FA 5MN4A 1JW9B 1PQPA 2Y1FA 4CTKA 2Q3FA 1BCRB 4BO5A 4EIWA 3PNBA 2XXJA 3KOMA 1PL0A 5DM0A 2GPWA 3DQQA 1UP7A 5EHIA 3JQ8A 1Z8DA 3DDCA 4TN5A 3NEYA 4X90A 1ZEJA 3GI1A 1J20A 2I6SA 3QW2A 5JCZA 2GASA 1EUQA 1UMCB 1F3OA 3AJDA 1IBCA 4Y1FA 4IJ6A 4GZ3A 3AEQB 5FI5A 1QF7A 1ORDA 4WY2A 1ZUHA 5EFZA 3X1YA 2ONYA 4L6AA 4FKBA 2R7NA 5FI0B 3SG0A 4CDRA 1H0KA 2VSOA 1GRVA 1U2DA 3LY9A 1FUUA 4OQZA 2H57A 3QOXA 1ZGGA 4ZO9A 3ETEA 2X5JO 1UJCA 5ALOA 3V9AA 2OE2A 2QVLA 4G09A 1KAOA 3ESXA 3QWHA 2YYAA 4JVSB 4RGYA 1R8XA 4MSUA 1XZNA 3JWJA 4MI1A 1ULUA 4ZGBA 1BDBA 3TNFA 5B2FA 2NTYC 5EP4A 2X9GA 5TVGA 5A4MS 2ZR8A 4L02A 3QHPA 4NOLA 3T3PB 4DPKA 2ACWA 4CIVA 1VJ0A 1P6UA 3OJEA 3ZW7A 1GG8A 5EL0A 2ZT8A 2PMDA 1YRYE 2OLJA 3W78A 3DTYA 2IYXA 2IVZA 4M1WA 2AZMA 2FJUA 2NSYA 3UZUA 2ZI5A 1UT6A 2VNKA 3GCGA 3QP9A 4GGPA 4HAXA 3WXMA 3AUYA 4B81A 3H5TA 2Q8QA 4JB0A 4A6DA 3PYMA 5A0VA 1Y33E 3ZVRA 1EFRD 4PCVA 4UNRA 1YZFA 1GY8A 3CW2A 5DEOA 3MGKA 1DOZA 3I39X 1NZJA 1BO6A 3WRXC 4PPNA 1XTQA 1PW7A 1I7SB 2F1OA 2XWJI 3KT8A 3Q3HA 3T52A 1DCMA 3PSHA 5CW2A 5EWMB 4EY6A 2XZLA 2I1LA 1LXCA 2EZ9A 3E7WA 1ECFA 2WHRA 4R2MA 3VTKA 5TX7A 2WWXA 2HDWA 1MD9A 4OX9B 1M6WA 5C31A 3SOZA 2N42A 3HKBB 2FHPA 2OXTA 4RSRA 5DHFA 4U7GA 2L2QA 5LBTA 1I5OA 3E0QA 3L8EA 3L0BA 3QITA 4LGMA 3KWJA 1TUEA 2FPWA 2PYDA 5AKYA 1FXSA 4EYOA 1TU3A 4E7PA 2V7UA 3TRKA 1ZOOA 4OQXA 1KH1A 4D2IA 1W76A 1L5ZA 4GWKA 2E85A 2GS9A 3GZ4A 2C03A 5ALRA 3IDZA 3EGXA 3EPPA 2Z5GA 4DMUB 5LP6A 1IN5A 2BGJA 4OHRA 3DL4A 3DV0B 3T41A 4DIUA 2HV8A 4KYIB 4DNOA 2XRMA 1XDDA 3F6CA 4IFBA 4PHHA 4RK6A 3U60B 5FB3A 4EG6A 3H8WA 4B3BA 5K0BA 1B7GO 1KC3A 1PLKA 1VP3A 4BX9A 4MRVA 1OUMA 3TF5A 4A5OA 2GK6A 2IUEA 1H1LA 5AJXA 3RDPA 2BMAA 3T7RA 2JJ1A 4MYRA 2FGJA 1IOWA 2F8TA 5BUQA 1CRQA 1WCYA 3B9RA 3HBMA 4PSDA 3RC7A 3SHTA 3KJGA 3V4VB 4BMVA 4H7HA 4ZYYA 3MOGA 3TJRA 4BVJA 4DR4B 4LFBB 5LSAA 2C29D 1KMQA 1XL1A 1FJXA 2H1RA 1VJTA 2GD2A 3K8ZA 5EIXA 1HDZA 2CNLA 4LC9A 4NBRA 2G7ZA 1KOLA 1G4AE 2R9VA 3HCFA 1ODFA 2CXQA 4HYYA 4AUEA 2RHTA 4YPFA 1UZ3A 1E5QA 1XZIA 2W4QA 1I6LA 3PB3A 3R1IA 4K5QA 2VYNA 2VWPA 1QTEA 3VC2A 4OG2A 1T0HB 3OCYA 3QOYA 1F4LA 1CY4A 3W6UA 2MOKA 2ZBFA 4A91A 3P97A 3E3OA 5C80A 4ZDJA 2K87A 5B4UA 2DULA 3L4EA 4GR9A 1ZPDA 2NSHA 1DWPA 3IUYA 1HT0A 2BGIA 1TA0A 5L3ZA 2C7PA 5COAA 3OE5A 4PYNA 4TXLA 1QTRA 1WG8A 1D5CA 4BZQA 2FWBA 4NLLA 5EZYB 1CQPA 1QR2A 4C0SA 4ZMSA 2R6R1 3ET5A 5FEUA 1KETA 3H8JA 3O94A 4YV1A 5DMXA 2PZGA 4U5QA 3AEKA 1G16A 3EA4A 2GHTA 3NTVA 4C76A 3K5WA 4CCYB 5K9ZA 1TPYA 3RHZA 5A3VA 2QN3A 3M1AA 1EUYA 2G83A 3ZXUB 4KBGA 5JHGB 3HEAA 1YKFA 1M1YB 4BU1A 3VYSB 5HJEA 2C7VA 3JQRA 3UH0A 1AT1A 2XDYA 2ZITA 1ZGCA 2OO7A 1Y37A 4M0CA 1I7NA 5ICMA 1A2OA 3BIFA 4CL8A 4B32A 1FDSA 2PRIA 2RCNA 3DVQX 2QROA 1QC5A 3CRW1 2I7XA 4F8YA 5JISA 1YZHA 1JJIA 4JI1B 1KMMA 3NOVA 4MXDA 3E58A 2W48A 2QNBA 1NKTA 3IOBA 1V7CA 3LI2A 1G3QA 1JSLA 3C1OA 2SNIE 4BRWA 2QMQA 4YMTA 3GJZA 3QTBA 4B48A 3ULKA 3KAJA 3KPWA 3FMGA 5JJCA 1NL3A 1DPGA 1NFRA 1KI6A 1SLYA 4CLRA 1QCDA 3OQOA 2NSDA 3LGAA 3H4IA 2ZPAA 3K0EA 2B4RO 3VC1A 1PWYE 5K0NA 4J0KA 3QE4A 2ZT5A 3NASA 3NYRA 4BP8A 1KGSA 1AS2A 1SOWA 1V3VA 1JLKA 3M4XA 3QU9A 1M0TA 2C2WA 3V2HA 1FTSA 1YK1A 3S7TA 3FB1A 2OENG 2IP1A 3UN1A 2NTJA 1Q5PA 4QPPA 4BOYA 3AVXA 1RYZA 4RORA 1Z4LA 1ZI6A 2YHUA 4L4RA 3ZKWA 4RHTA 4D74A 4EY3A 4DF3A 4YMGA 3KJFA 3G9UA 3JXEA 3P9ZA 3RSSA 2J4FA 5DTMA 2HL6A 4RTMA 1XMSA 5IZCC 1OREA 2XA9A 4LXYA 5TEWA 2QK4A 4JA0A 1L5MA 1P80A 2VYFA 3CGGA 4Q7EA 4MWBA 5J2UB 1S1CA 3B2QA 3D1JA 2CLMB 2W6CX 5SZHB 4DVJA 4G9GA 1BVHA 3FLMA 4ON9A 3OZTA 5B1IA 1DMRA 3WHKA 4PYJA 2VTBA 3ONVA 1BGVA 3DULA 4IMPA 3I28A 4YWJA 3F3MA 3PG5A 1NW5A 1MA0A 2ZU0C 5CA1B 1V2GA 1VHJA 4EA9A 5BWCA 2BFCA 2HRCA 1WRBA 2WJVA 4WSOA 4DWOA 1E4YA 4JI2B 2YHIA 2Z1DA 2ZXEA 1MAVA 1FUEA 1ODCA 1K97A 3OOSA 3QSGA 4AS2A 5FPSA 3M89A 2C5BA 1OIWA 4CN9A 2EJUA 4FK8A 4JYPA 3ZD6A 2H85A 3C39A 1CIPA 2RGNA 3CKKA 4RS3A 5KTNA 3CB4A 3D4PA 1U1EA 3H18A 2Q4TA 4O4HB 2ZYGA 1LFDB 3PPWA 3AG5A 3EXIB 3UW3A 1XYYA 3AR3A 3DE4X 3IQXA 4Q0MA 4ENPA 2ZVQX 2CMKA 1KJNA 5JJLA 3ORQA 3GHHA 3I23A 3R7SA 4DCCA 4ZGWA 4MGIR 1V35A 2GPTA 1I2CA 5SY9A 3H4MA 4B6JA 1N0UA 2W2MA 1NQTA 3G5MA 4F1KA 5DGTA 1P6XA 8OHMA 3WLAA 4HDSA 1CVIA 3I1FA 1XQ9A 4YALA 3GRKA 2OESA 5CUQA 5FLXA 2UYYA 3KG2A 1PQWA 3IR7A 2FUG6 5EZ6B 1V1MA 2C20A 3K9GA 3WKEA 4I55A 3ANYB 2QG9A 1JEDA 1FP1D 2FZKA 4WINA 5DN9A 1JXOA 3JYPA 3AONB 2H63A 1PEKE 3ECCA 3QBTA 5B1HA 2YV4A 3U3JA 3WB0A 1D6NA 2FV8A 5BW6B 2KS6A 4BO7A 1LDBA 3LE8A 2G4VA 4FD3A 1R0YA 3TI7A 3GLGB 1MAUA 3G17A 2IHKA 4I81A 3BWDD 3T9AA 1E9AA 4Q9LA 4MQ6A 2HWXA 2ASEA 3W8DA 5FKJA 1M2FA 2A8YA 4CR7A 4IH9A 2V5UA 4KCGA 2X2PA 4LI0A 4NJEB 3QFTA 4TV9A 3WY9A 4RH0A 4BO1A 1M10A 2Y99A 3LSYA 1CS4C 2QD4A 2YMMA 1R0WA 4UDNA 4FSHA 4NJMB 1JHYA 1B15A 1VJCA 2AVDA 1RDFA 3PPVA 3NM4A 4KFTA 1YVRA 1U5BB 5DRTA 1ZX1A 3KZ1E 4O8ZA 4YN3A 4YP5A 4URXR 1SD5A 1T8RA 1OXMA 4J3FA 3M2TA 3WS7A 4AICA 3PU6A 3OIUA 2QA5A 1Z47A 4JFRA 5AXBA 4EKIA 1IDOA 3UV3A 2AFRA 2E55A 1O96A 2E4UA 5BSKA 2V0CA 3D1VA 2GN9A 2ILTA 3LP8A 3OFKA 4A2WA 5D6NA 2QENA 1P9LA 1SIUA 2ZIWB 3FCXA 3TTUA 1RLOA 3RT7A 4EZIA 3NYWA 4BY9E 3CIFA 3KEMA 1XVUA 2VJYA 1FTWA 2HHAA 3L7KA 4NZNA 1XPRA 1LQTA 2VTDA 5F33A 1MENA 1D6MA 4PM4A 5JI3E 3ED1A 2FZCA 4JWTA 4B5LA 4LNUB 2G1KA 4CM4A 1Z5GA 5BQ3A 5F2NA 1G21E 1UZMA 1G55A 3S3TA 2GXAA 4F5YA 3OPNA 5BORA 4I9HA 4D96A 2LW7A 3AWDA 2X86A 5TMEA 4QXAA 1SULA 2PUJA 3HDYA 4ZVKA 3WAKA 4Z3OA 1E5DA 1U0NA 4FYYA 1F38A 1N36B 4CDMA 3PITA 3ZQ4A 1KTVA 5FNVB 3FCEA 2XE4A 3E5RA 5T3YA 4GOKA 4Y7CA 2PH1A 2WT9A 4OATA 1NM5C 5KTYA 1E6KA 2JHCA 3MYRA 4GP6A 4HAZA 4HDRA 2O2IA 1RWQA 5C4GB 3RD5A 5IDVA 3BWBA 3T35A 3ZOKA 5G0VA 4D4JA 2QRHA 1EG7A 1WB9A 1PS9A 1U04A 4HNHA 1JB9A 4BTVA 3KQVA 1ODLA 3THXB 1WBBA 2INGX 3K7EA 4MIEA 4NXNB 4UPDA 4GG1A 4RVOA 4N49A 3ZDBA 4ND8A 1SUWA 2FMIA 4QUIA 1Y1KE 1SD1A 3KOYA 3NLLA 2HXSA 3PCXA 5I7HA 3FHTA 2IIVA 4AIRA 2IY7A 5HQ3B 4G26A 3K9FC 2P6NA 3M6FA 4MAMA 1AZSC 1KR5A 1E99A 1HK7A 1L4GA 4DXHA 1Y7PA 3CNBA 3CZ4A 1EFVB 1OXXK 4FHDA 3U3OA 4DSNA 3PXDA 4YGXB 4XLLA 3C7KA 1S01A 3HB4X 4QOSA 1JMVA 4RVSA 3G5UA 2X3FA 4RO0A 4YEDA 1YB4A 3W8EA 6REQB 2XEXA 5HJ7A 1BHQ1 4IFEA 2PZ8A 1XMQB 1NTRA 1IZYA 3JWHA 4X64B 3JSXA 3HR7A 4X91A 2B1RA 3T0FA 2PL5A 4DUYB 1MABB 2JAPA 2ZWIA 3CPHA 4W6ZA 2F62A 5IVIA 1G6HA 2Z5LA 3GRZA 2NG1A 2Y77A 1SZCA 1WDTA 5REQA 4Y2GA 3EW9A 1UC9A 1YDFA 4UUMA 1SB9A 5B2ZA 4E12A 2B3TA 4O4IB 3RIHA 5H70A 3TB4A 3KPJA 1D2HA 3AINA 3AVUA 2OG1A 5EXEA 1J70A 2H5LA 1RXYA 2WWVD 2WWYA 1C1DB 5EMJA 2P9GA 4CG1A 5EJGA 4MS1A 3UYKA 1Q2XA 3HBFA 3KKQA 3VU0A 1FNSA 2ATVA 2AXEA 3ZEAA 2PVCA 1TTTA 4II3A 3DSRA 1UKEA 4UBKA 1QQ7A 4Z4GA 2W8ZA 1JR4A 4MP3A 5HWSA 1FVOA 3LXUX 2I2WA 4QGFA 2VAXA 4L0MA 4CKZA 4H60A 4J0FA 3WYAA 1JTVA 1I7DA 5B1EA 5BURA 4K6HA 1C3OB 1CZKA 2QW1A 1FYXA 3GP5A 4LCBA 3FX2A 3NT5A 1NLMA 2PEYA 5DHTA 2H2GA 4OP2A 4XJSA 2IFTA 4EHJA 4OL9A 2OVFA 3CKLA 1LLUA 4G81A 4B6GA 2O7VA 2D5BA 4XZ3A 3O5AA 2IX3A 1DC4A 2VHWA 5TRTA 3TIVA 3G85A 4G2NA 2CLEB 3EGVA 2X8WA 1LDEA 1ENOA 4WZZA 5IKOA 1DBQA 1UEJA 4ZHSA 6AT1A 5AVXA 1A76A 1NC3A 1UIRA 1ZU5A 4M8IA 4U2BA 1H93A 3EXFA 4TLEA 3DR3A 4IIVA 4ALIA 3SQWA 4DIFA 2ZYWX 2ZE5A 4BN0A 5ARBA 2ADMA 4E70A 2FF7A 4MVJA 3MJ4A 5EE9A 3SX2A 3I73A 1CETA 1GVNB 3DWEX 4AYWA 1EFDN 3IBYA 2FFHA 4BO3A 5DNYB 1NYRA 1DG3A 2CNNA 4W63A 3RYFB 4C7VA 3LTNC 4K2AA 4N82A 1TD9A 3PYLA 3P96A 3HU5A 3W7VA 1H6DA 4ZQHA 2VYND 2CJXA 4JLAA 4XUDA 3T4XA 2EEZA 1TIPA 3LUCA 3M83A 1E3EA 4IIJB 1KFJB 2OFOA 4YASA 4BV8A 4ML3A 2B0JA 4GX1A 3O8OB 4EVRA 3BDVA 4LCEA 4PFKA 4EY7A 2JJ8A 3HS3A 4ESEA 1BX1A 4L08A 4LVOA 5TB5A 3STVA 5LJIA 2ZUWA 2H9IA 4MDFA 2VJPA 1FP7A 1WZIA 4CYMA 3LPAA 3P9XA 4F2WA 4QKQA 1CDEA 5I6DA 2ZBQA 1KZ1A 2ACKA 1RZRA 5A1JA 2C04A 4RF3A 4YCNA 4YR7A 5EAIA 4NK5A 5CXXA 1DIRA 5B6IA 4N0MA 1G17A 1JQ5A 4DEXA 4QNRA 5K0CA 2Y0EA 2AV6A 1RPZA 1RPJA 4L0CA 4NMLA 4MDEA 3F5QA 5CFPA 1CF4A 4K28A 3WSVA 5HKAA 5DTRA 1C2YA 1RWMA 1VYUA 4PZZA 4DR1B 3K5HA 5BY2A 5FXMA 4W9MC 4M7OA 1VMDA 1CQIB 3DE1X 1E9RA 2X23A 4ZP1A 3C5VA 4INPA 2BEJA 5AI8A 2R5FA 2A92A 5DEIA 4AZSA 2V0GA 1XPJA 2VDOB 5AHXA 3ECSA 3GELA 4P4NA 2OAEA 2GAIA 2PIDA 5HM6A 1UL1X 1Z0UA 3S68A 3L7MA 3D6TB 4Y2UA 4ACAA 3LK6A 3OM9A 4CUJA 4M9QA 1Q7RA 1IHYA 3FTPA 1W25A 4R7TA 4BVGA 2MINB 3GNSA 4CQMD 1DTEA 1L8OA 3B70A 3FPAA 1TUIA 4BO0A 4AKGA 2VCYA 1VBFA 1M1YE 1U3TA 4IW3B 4J7XA 3CWZA 3DG9A 2IBSA 3JZMA 5LFAA 2B99A 4GX5A 3VO1A 5KWVA 3TFQA 2IHTA 1BROA 3H4VA 3NOQA 5TT1A 2IC5A 3VVBA 1TLTA 3I2FA 1A1VA 4KQGA 1FFGA 2A4MA 3PDUA 2P77A 1E5TA 3GLSA 1CF2O 3PA8A 1S2NA 2E48A 2R3SA 3FTNA 4IIFA 3R7DA 1VPWA 3RSHA 2GHIA 5DM2A 1I4WA 3O4FA 4WT7A 1NVXQ 2Q3LA 1X9GA 4DCMA 4IH4A 2GETA 4IQ8A 5KYXB 4XYMA 4KE8A 2E49A 4E6EA 1H2ZA 3DHWC 3EIQA 4D0RA 3CRQA 4KIUA 4B6FA 3IDFA 1FVFA 3LCCA 4G0MA 3RV4A 2BGNA 3E2PA 3H17A 1H2AS 2FPGA 1A5SB 3C0KA 5LQRA 4IGKA 1L1RA 4OB7A 2VK8A 4EFLA 3PFHA 5KVQA 4EJ6A 2CHUA 4EWLA 1NXVA 1R5OA 3ICOA 2M32A 3NIDB 1X8JA 4Y0NA 3F3SA 5JIBA