2I2XB

Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
MLDFTEASLKKVLTRYNVALEKALTPEEAAEELYPKDELIYPIAKAIFEGEEDDVVEGLQAAIEAGKDPIDLIDDALMVGMGVVIRLYDEGVIFLPNVMMSADAMLEGIEYCKENSGATPKTKGTVVCHVAEGDVHDIGKNIVTALLRANGYNVVDLGRDVPAEEVLAAVQKEKPIMLTGTALMTTTMYAFKEVNDMLLENGIKIPFACGGGAVNQDFVSQFALGVYGEEAADAPKIADAIIAGTTDVTELREKFHKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase 1
publication title Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
pubmed doi rcsb
total genus 79
structure length 258
sequence length 258
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02310 B12-binding B12 binding domain
B PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 2i2xB01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 2i2xB02
2REQB 4HH0A 4HEHA 4REQA 1K98A 4HH3C 3REQB 6REQB 5REQA 2XIQA 1Y80A 1I9CA 1FMFA 1B1AA 4HH1A 3BULA 2YXBA 3KOZA 1K7YA 1BMTA 1REQA 4REQB 1CCWA 1ID8A 5REQB 1E1CA 4Q37A 3IV9A 1CB7A 3BICA 3KOWA 3KP1A 3IVAA 1REQB 3KOYA 7REQA 4JGIA 1BE1A 3KOXA 1E1CB 3WHPA 1XRSB 3EZXA 2I2XB 2REQA 5C8DA 3REQA 2XIJA 4R3UC 7REQB 6REQA
chains in the Genus database with same CATH superfamily
1ESMA 1PR2A 1A1VA 1OI2A 3TPCA 2H5IA 3SI7A 2BFEB 1I6LA 1UMBA 5ARCA 4E5VA 3ZWQA 5DISB 2X1LA 2ADFA 1B73A 4GFDA 4W5RA 2HDNB 1ZKMA 4L15A 3UK7A 1CF4A 3PDHA 2LDBA 1KAOA 3RT9A 2F1OA 3SKYA 1QHSA 2NYAA 1VCHA 5JEEA 2A7QA 4H6PA 4CTOA 3Q8LA 2V0GA 3IUYA 4NI5A 4B3SB 1P6QA 5K0JA 4KN5A 4MMZB 4JVOA 5EE5B 4RY0A 2PJDA 5IKOA 3TZBA 1PVOA 5FWNA 4UBJA 1QU2A 3PWZA 3GEPA 4NAVA 4QLOA 1Y7IA 3IB3A 4IRUB 2CJYA 2FN4A 5A1JA 3B1KA 4QFBA 2HR1A 4X63A 4EYKA 4O59O 5TXGA 3E05A 1RAEA 4Y2JA 5E6RA 5EE1A 4EHDA 4RFSB 3DE3X 4ZAVA 1XTSA 4RA9A 1JDTA 4DMGA 3T9CA 5INTA 3H1AA 3E9RA 5A5EA 1U9CA 1K3TA 2ORIA 1GGHA 3S44A 5AK5A 1I33A 3JYLA 2R7AA 5ADVA 1V5GA 5BN4A 4XWGA 5IHXA 3F5FA 4GX1A 2I1WA 5HFAA 4HLNA 3K70D 3BF7A 5IP5A 5EPEA 5AVKA 5L3SB 2O1XA 2FVXA 4JHLA 4YRPA 3SZMA 2W2OA 2CYAA 3JRXA 1SXGA 3NEYA 4NC9A 3SYMA 4EGJA 3H4TA 4MRVA 5IH7A 1SKAA 5TV2A 5EP2A 4HGNA 1SVSA 3V7WA 1OYYA 5K0TA 1DT5A 4YVFA 1SKYE 1NWHA 1QPBA 4EHLA 1QYIA 2HUPA 1W73A 4Q18A 5AVJA 4B6EA 1VP3A 4N5DA 4RD6A 4AO8A 1QQBA 3LV8A 5BSUA 4EI8A 4KTVE 1W44A 1USIA 4HH1A 1I4LD 4LNUA 3TQIA 5BNIA 1LWOA 3ROGA 3WBKA 3IFSA 1GQFA 3WLOA 1Z0KA 1JIKA 4IX9A 3R5SA 1HE3A 3DO5A 1LC3A 3LUAA 1S2LA 4P34A 3KEFA 1AQNA 1HMPA 2OV1A 4HDSB 2G80A 3H2GA 4KE7A 4TXNA 4BMZA 4D99A 5EJ9A 1MX9A 4GMHA 3RDPA 1IWBB 1XOIA 4JYBA 3O74A 2X9QA 2X1HA 3T7CA 4MW7A 4DLWA 5I47A 1A5TA 4LY6A 1QHHA 2JI8A 3Q2KA 4CQMB 3LPNA 5MFPA 2II6A 4RCZA 3BBLA 5AW7A 4MRAA 3HP4A 1DO2A 1WVIA 3L0YA 3T3PB 2YVQA 4KWEA 3HG7A 5C81A 4MV7A 1OH7A 2OZLB 1U28C 4UPVA 4EH1A 2AOXA 3EXEB 2ZVDA 2FSPA 1FFWA 4W5JA 4HQLA 3VX3A 1NUHA 2B83A 2P91A 2W43A 4G5QA 2G67A 2PWPA 1JG6A 2H2AA 1O1YA 1M0EA 3ESAA 1PLJA 2Q7OE 5LN1A 1MC5A 1Q3KA 2QTAA 4DHEA 5HP4A 4K9QA 4NCNA 1YFJA 4RQAA 3GVHA 1W29A 5SY4A 5AXBA 3F67A 5CT6A 5B4UA 3CVJA 4QBHA 4OJTA 3B8EA 5BN3A 3F0TA 2FWRA 1UMDA 4UFPA 2PBFA 3JV7A 1K68A 2SICE 2RI6A 3HFJA 3ST7A 2H31A 2FMUA 4WL0A 3D54D 2D8AA 4UUQA 1SBYA 1IY1A 821PA 2H1HA 3B48A 2DQKA 2WAXA 5BWCA 4Q3OA 1CUJA 2AJCA 3IE2A 2DT8A 3MFYA 4GZMA 4L5JA 4TVOA 5KINB 3IMEA 1H2FA 4AMBA 1VGVA 3LH5A 2GFQA 1GUDA 2H2IA 3U6BA 4OI1A 1P8AA 4FZJA 4OP3A 3RYHB 1Z0UA 1Q0QA 2FWAA 2HFJA 4D6XA 5BMOA 3OTWA 1ZUHA 4R3NA 5DTRA 5KQSA 1L5YA 1RXYA 3NM6B 3GLGB 4MKGA 1Q20A 1P7WA 5I8WA 2XUJA 5CH8A 1E94E 7GPBA 1ZA2A 4MX8A 3QU2A 3M4NA 1Y8ZA 1JJAA 3PIRA 1CRWG 3A6GA 1K63A 3UT6A 2CMHA 1D09A 1ZEMA 1RTTA 3HMQA 2VF2A 1EUCB 4YMIA 2NXEA 3C1UA 1FP6A 5FOQA 1GT6A 1ZJWA 1SMKA 2AX3A 4Q3AA 3BIXA 1UFOA 4IX1A 1CY0A 3SMVA 3ZHXA 1CB0A 1NUUA 3Q9LA 4F7WA 1FTGA 3V6MA 4INZA 1RXVA 2P9JA 2ZE6A 4P4UA 4BFYA 5LPNA 1UBMS 5AW1A 4BAZA 3M6VA 2QMOA 3E8SA 3NTVA 4GRAA 3D9QX 1Y1RA 2R8EA 3WK4A 1PP4A 3M34A 2OV6A 1OWNA 1XQXA 2PNFA 1C9NA 2WWHA 2J9GA 3AIMA 4V03A 2NU8A 4A1FA 2HL6A 3SNKA 3DA8A 1XU7A 3H17A 3L1UA 2NPIA 3T3DA 3D8NA 1Y1PA 3TGWA 5HQTA 1KTVA 2EFDB 1DB3A 2Q41A 1PW5A 2NG1A 2XA2A 4JOCA 3IR5A 1XP5A 3IULA 5JO9A 3ZI4A 4B8WA 1DTEA 4IMIB 4DAOA 2NXNA 2BJVA 4PZLA 4J1SA 1Q14A 1R9NA 3T3GA 1CYEA 1T2NA 1AHIA 4EB8A 2ETVA 3PDJA 1BVHA 4J2HA 3CBGA 5AI0A 3K6SA 4RK0A 1F4PA 1DRJA 1QQAA 1QIKA 2OAGA 2PUWA 2ZRPA 2EJUA 1EFCA 2O2YA 5J2UA 4C4PA 5G0UA 3ZU6A 2XWQA 4X3OA 1W48A 1YB4A 3ER8A 4EKIA 3AIOA 5H9WA 4D9EA 1ZNQO 5EQTA 2O8EA 4NK5A 2OXEA 3MVEA 3QXGA 4QXRA 2WNIA 2H4JA 4KUGA 2ON6A 4RF5A 1P4GA 4MR8A 4EOGA 5LQRA 4FPXA 5FWYA 1XMQB 1Z82A 4HNRA 4RHUA 4E6PA 1G5TA 2P9QA 4YMHA 3SSAA 1PJRA 1VB3A 4KVZA 5JALA 1XG5A 3TNFA 4ASUD 3LZDA 1RPNA 3K0EA 2QUBA 3HB5X 5FHQA 1N0VC 1Q2XA 2CVFA 4N3BA 1THGA 2E49A 4FR0A 1OAKA 3QU4A 2IOFA 3QFCA 4P7JA 3H84A 2IWHA 1JEDA 1UP7A 3JQCA 1AQ6A 1WF6A 1PUIA 2FFJA 2RHCA 3CRVA 4DSUA 1BS9A 5KSYA 5CURA 4A6PA 4ZFNA 4BQEA 2W70A 2QQGA 4KYVA 1DLIA 3N8IA 5C34B 5JCJD 3CN7A 3Q7IA 1ABEA 4ATNA 4F4JA 2D0PB 3TLKA 2VKTA 2P6MA 3Q1LA 1MO4A 3L7YA 3O9ZA 1EPUA 3D02A 3IBYA 4UVDA 5AJZA 3CE6A 2OYRA 4ZYVA 4RKEA 3CZQA 1T8PA 4CV0A 2M1ZA 1LS6A 2JVIA 1C7JA 1SBZA 1O9GA 5TF4A 3AEXA 3HDQA 4O4IA 2DF8A 1HQDA 4EVIA 3RABA 1VDZA 4GSYA 1VE3A 4PYQA 4EI7A 3BH6A 2FX2A 3UJ7A 1RM5A 2JB9A 4J0CA 1GZ7A 4KKVA 1Z6AA 4XM0A 2FQQA 1SU6A 1ZWKA 4PYIA 2V4UA 3PF8A 1XMVA 3II6X 3MMXA 3ZDXB 2ZK7A 4N3AA 2DZDA 2GD0A 3SR4A 1VDMA 1CF2O 3BILA 3IQXA 4OAQA 1TRHA 1KC3A 1T9ZA 1JA0A 4UDNA 3V5NA 1WU7A 4R1PA 3GNLA 3QEMB 4DIMA 1TTHA 2F43B 3WLRA 1EAYA 3U44A 1BHSA 2BEVA 4C08A 3V8NA 1KDPA 1L4NA 2UVPA 3FZYA 4ZQFA 2AJ8A 2QP9X 2CFIA 3LBHA 1I9CA 1EFTA 3AF4A 2QYSA 4UATA 4I14A 2I65A 3FDJA 1EVJA 2IFTA 1ZM4A 1H4TA 2OBMA 4DUGD 4YHBA 4JLKA 3CW8X 3KLBA 4Y2SA 2BKAA 5I9TA 4WNIA 1LV8A 2NSDA 3LUKA 1O97D 4NU5A 2PPVA 1POXA 4TUYA 4CIXA 3O8QB 4RZXA 3NH6A 1K0UA 2VLBA 3IP6A 8GPBA 4L07A 3HKEB 4ZAWA 3UB3A 4DWJA 5ED4A 5CJPA 1JX6A 2ZSIA 1QO7A 2FLVA 3OOHA 4TKLA 3JQBA 1T9CA 4Y1EA 5BVHA 3UB4A 3QA9A 2RAVA 4UEWA 4DXDA 2PGAA 4C07A 5IM4F 1YQWA 1SCNE 2QAGB 4UHBA 4C5CA 1KO1A 4B45A 3B9BA 1MF7A 2I29A 2ODQA 1E6MA 2WU3A 4KC0A 5I3CA 4KV7A 4KACA 2FEOA 1J9EA 3GA5A 3CEHA 1ZQ1A 2BD0A 2RH8A 2VS1A 3TEMA 2ZKIA 5J1TB 4BMVA 1PR1A 3PP8A 5HZMA 3ND9A 5DK6A 4LTDA 2YWHA 3HY3A 1ULBA 2QTWB 3KXIA 2Z5GA 4OHCA 1A76A 3RYTC 1CS0B 5B7NA 4XH9B 3RK4A 1FL9A 2KLBA 4R1MA 1NUTA 4LJLA 4JGIA 4X7MA 1E2QA 2V0NA 1JR3E 5B6JA 1Q77A 1RE1A 5SY6A 4EX6A 3NIFB 1K7EB 3DFZA 4J75A 4BE4A 1Y4UA 3ZE7A 2V8OA 1LBTA 2PL3A 1WW8A 1DEKA 3HFRA 1II0A 2XKJE 1DSSG 4GZ6A 1N1MA 1L8OA 4LXQA 3AOGA 2I78A 2VT7A 4R1SA 1AT1A 2IUTA 1EHIA 1ONPA 1MIOA 2PX2A 3CZMA 3M2TA 4S1OA 4GGPA 2K6GA 5LA6A 3UJ6A 3GP8A 3T5PA 3AO0B 1YVEI 2BP7B 4INJA 4KZPA 1N5OX 3GT7A 1G1MA 4C76A 2JJQA 2NSLA 4EB6B 5C8VA 1P6XA 1UXOA 1YBAA 2OP0A 1I7SB 1I3MA 1QX4A 1E3DA 5L8VA 3KQOA 1Z36A 3OLXA 5EIAA 4QUHA 5CM9C 3V4SA 1DO0A 4PLTA 2XAUA 1MB2A 1WMSA 2J3MA 2WLTA 5H3CA 4BAGA 1P60A 3I2YX 4V02A 5JAIA 1E69A 1FDRA 3OCUA 1Q21A 3MUOA 3K0BA 4XR9A 2XYHA 4IJ5A 3NX4A 4ZAFA 2Q7XA 1OKKA 3RFCA 5IJ0B 4QICA 2DFVA 1X8JA 1YJ5A 2IZ7A 3SXPA 3TEJA 4MWZA 4NCAA 4MI6A 4QUAA 3P9IA 2Q27A 3C85A 4KYTA 4P58A 4A23A 4BX0A 3PENA 1E5QA 1A77A 2HXSA 3N8HA 1XVTA 4XI9A 4DA4A 2EKPA 4ARBA 4I19A 1OF1A 3SC2B 3CA8A 3H83A 4FEYA 3VH4A 1QO0D 4QRDA 2YIJA 5G53C 2PMDA 1TU0A 4EQ6A 5EGNA 1W53A 5TS3A 1VZ3A 1MC4A 5JXJA 1L7DA 1AURA 1RABA 3GRZA 3OMXA 4XW2A 1BCSB 1QH8B 1AQJA 4EO4A 2WDZA 1K7XB 3R0ZA 1U5BB 1ODCA 4LE1A 1W8DA 2WSLA 5F33A 2JJ2D 2O2ZA 3D64A 3G1WA 2E3JA 4JP3A 4HH4A 2FZLA 3AUXA 1RC1A 2D5LA 1W2WB 1Z6ZA 3QEOA 3MQ2A 3NYWA 1TM3E 2X8JA 3R7NA 2QIPA 5EJ5A 2IPNA 1TQDA 5KU1A 4LZWA 1CUSA 5ALIA 1MVNA 1SUEA 4EY5A 3P97A 1HT1E 2DQSA 3T61A 1ZWLA 4W9NA 1JDJA 1V4BA 3WGMA 4LSGA 4KEAA 1JIJA 3MJSA 3ABIA 1RTKA 4ZCRA 1Q6YA 1RXWA 2WD7B 4ARSA 1AGXA 1RRCA 4RESA 1LSSA 2HXGA 4MUAA 2I8CA 4WBNA 3P9CA 4ML3A 2B37A 1EVEA 1QXSA 3U39A 2NO0A 4R1LA 1KH3A 4WGGA 5FP0A 2FZWA 4RTNA 1YNSA 4BX2A 5FBKA 1M1ZA 5HK8A 4DY6A 2YZKA 1C1HA 4S1TA 2HCTA 5TGZA 5KSOA 1U3WA 3TIXB 1KFKB 4N12A 1N4AA 3VR3A 3SFTA 4LXGA 1T8WA 1C30A 4GHWA 1RRGA 1TEHA 3KHSA 5EZYA 3IR6A 3LNCA 1BQEA 5ESWA 1DQPA 1X8KA 2QLLA 3T7SA 1MT3A 3RRBA 1UBOS 3F6RA 2J9YB 4KQIA 1YQXA 3FPKA 2NSJA 2B7BA 2BDUA 3BL5A 4CGYA 5I7UA 2JW5A 2P62A 3CRW1 3OEED 3W8NA 4DM3A 3KCQA 1M8JA 2CSUA 1W36B 2BSAA 1QBKC 4NFSA 1JHVA 1EDDA 1VG8A 2JK1A 2WQZA 2VWQA 3AERA 3HZZA 4BJ6A 1E0KA 1E2DA 2I3DA 2LP4Y 1U3DA 3DT6A 3PFNA 3QZUA 2IZ5A 3SYRA 4XWYA 4Y2TA 1L5FA 2C03A 3FLAA 4PNHA 3T4EA 4URZR 2PJZA 1MO6A 1IK6A 5AW3A 5HKBA 3RNOA 1Y8QB 1EXMA 2WY2D 4BU0A 4EF4A 5AI8A 2AZXA 5GOTA 3Q8KA 4TTRA 4WUTA 3W7AA 3SVLA 1R88A 2Z6UA 2WOOA 1N2JA 5IDQA 1SXJE 3L06A 3QUQA 3L41A 1T5BA 2JF0A 1L7VC 1TXGA 1PGJA 2QR2A 2R96A 3EDRA 3O75A 3PUHA 1FFGA 4IG4A 3TQFA 4AIIA 5K8LA 3ZLJA 4YRKA 4DR7B 2BFMA 4Q05A 4MRPA 2P6PA 1T5SA 2J6IA 3I6MA 3PQ7A 2KJQA 1XA3A 3FFBA 4ZKEA 3V9AA 3VNQA 2F17A 3VHXA 2GEBA 1ZLXA 4NE7A 1SK9A 1QHIA 2FJUA 5BORA 5KYUB 1NBIA 2OESA 4KQXA 4B73A 1QRTA 3PX2A 4J3FA 3KZOA 1DAKA 1NNLA 1GGNA 1OXUA 3T41A 5DM60 3RWMB 2RGYA 2VI5A 3N28A 1B8UA 4F11A 3RFXA 1AMNA 1N6OA 1Y4ZA 4EJMA 1KJQA 4YH1A 1FBTA 1QANA 2H1RA 4ZCMA 2R97A 3U31A 1O89A 2PDAA 3BL6A 2QVYX 3HYRA 4CDMA 4BE7B 4X24A 1F12A 3T5CA 4M22A 1XU4A 2NUBA 2QT9A 3E82A 1C4OA 2HLPA 1KSFX 3ECSA 1FFXA 3Q88A 4ER3A 2V98A 4B7ZA 1P44A 1DUIA 4N6NA 4OL0A 4JUIA 1Z73A 3KS9A 3VI4B 2VJOA 2X1MA 2ZBDA 4N4AA 4AN1A 3IOYA 4NBSA 3QTTA 3X2FA 2I6UA 2J0VA 2OXCA 4QU0A 1II8B 3SHQA 2YV1A 1JLLB 3BWMA 1G7CA 1U8YA 5GJCA 4Z1OA 5A05A 1U8FO 1CKEA 1XX6A 2BTQB 4XJVA 1E2BA 1KS9A 1T4MA 1J7KA 2WW8A 1TKBA 2IP1A 2X9NA 3AVPA 4CMEA 5DNYB 3EWAA 3UJ3X 4UMFA 4QM7A 1QC5A 1T4GA 2SKEA 1KKUA 3G2IA 1E9DA 3MM4A 2PZEA 3PKIA 4CZ2A 4DMMA 2Z04A 4RTQA 4PX9A 1C0IA 1CNMA 2GBCA 2QYHA 3KLNA 4ND1A 2A9PA 4W6ZA 1EJBA 1YASA 3KPWA 2DRIA 5E1MA 1DAHA 3JALB 5CX1A 1SBCA 3ESXA 3MMPA 5LQSA 3UHOA 1DZIA 3AIKA 4BVEA 1GILA 1P1BA 3CZ5A 4ARCA 1QE0A 5EMJA 3R3WA 3RQSA 1CUFA 1SO8A 1YZYA 1UIRA 1W5TA 2Y77A 4MUEA 1AF4A 5JD3A 1OKKD 2H0QA 1VIDA 2VF4X 4D5EA 4J4TA 1UEJA 2WHRA 1ZEJA 2HV8A 3ZDYB 4CEHA 4M0EA 3DEZA 3RJTA 5BNWA 4LDQA 2W2KA 4KR6A 5H81A 4CM5A 1A7JA 4ETMA 3FUXA 3Q10A 4C87A 1X92A 4FMDF 3MS2A 1HURA 5CFMA 4GX5A 1DEAA 3A37A 4IJVA 1R74A 4J8PA 3UT5B 1Z62A 4J2TA 2QN8A 3B70A 2XXBA 2XT6A 1N2CA 2AF4C 1Q12A 3GP3A 1PEDA 2W7TA 1DINA 3KHUA 1Y0BA 2JGFA 2Z4RA 2NYVA 1XDWA 3TL2A 1C7RA 1VGQA 2HLDA 3ADOA 4OFXA 3QWHA 1M8PA 4AKTA 4ENSA 4R4JA 1S4MA 4HG2A 2CWWA 2YN4A 3A70A 3DW1X 5TMPA 2XQKA 1T15A 3RTGA 1A8QA 2Z8ZA 3GARA 5FF9A 1PTKA 5IT4A 1GFZA 1R0RE 3EZ9A 1W4BA 5K8JB 1ZIPA 2PYDA 1BS1A 4JR1A 5DGXA 4HMOA 1JPUA 2OCXA 2Q4RA 2P2SA 3EYAA 3VJKA 1KEKA 3BMCB 1DRVA 5AIBA 2HY7A 4DV4B 4ND8A 1TEXA 4YJ2F 2O52A 3RFUA 1XCOA 4DMCA 5KOHA 5CEJA 1K8ZB 1I1NA 3TVDA 3T3HA 3AJEA 5I8ZA 4XVRA 5TGTA 3NTRA 1S96A 3EZ7A 5G41A 2CXXA 4TTQA 3K1TA 2KM1A 2X6RA 1KZ9A 3W34A 5C4MA 3UGJA 3KSZO 1IM8A 4GRIA 3RO7A 1MX3A 5FULA 5DV9A 1H1LA 5I7FA 3ASYA 1EZ4A 4K28A 5KJFA 1EEHA 4JS0A 1ZW1A 2OBNA 5CUQA 1AN0A 5FTKA 3ZHUA 3LP6A 5KDDA 1GTRA 1Z6PA 4QELA 3VA7A 2X19A 3WJAA 4A8TA 4ZVSA 3VPDA 5FLEX 4CLOB 5H0IA 4O4LB 4DMRA 3TG8A 2H17A 3C6XA 2BHRA 3GZNA 1R5NA 1UWCA 1SKBA 4LV6A 5D00A 4S04A 3ZK7A 1F51E 3HN7A 1YZKA 3AB7A 3DF7A 4YAEA 1PR0A 4EVQA 2G4VA 3IVMA 4A73A 3BTOA 4I46A 5K6AC 1MB9A 1PFVA 1DC6A 2REQA 1V43A 2Y6UA 2YRFA 3E1GA 3G82C 5AXCA 4FKBA 3K2IA 1V3UA 2ACEA 1M2WA 2PU7A 1V95A 1VA4A 3VDNB 3ZKWA 1P45A 2Q1TA 4WNAB 4D46A 3W77A 2ZATA 3H6KA 1U63A 4EZBA 3RANA 1GAJA 2VYCA 4MIYA 5JSFA 2QRHA 2XCUA 3HFSA 1C9YA 2B82A 4PQFA 3O1LA 1KZYC 1CG6A 3PPVA 3GLGE 3NR2A 2G7ZA 4XIJA 2CXNA 4RV5A 4BWGA 1YR3A 4Z3OA 3K5IA 1W8IA 4LRXA 3KM0A 1J33A 1Q1QA 3DV0B 4QFCA 5P21A 1C3OB 1D4AA 2QR5A 3H4MA 3WGYA 3WYEA 2C82A 5KUTA 3P9SA 2QI9F 1ZG3A 3DDNA 4ZVQA 4CUZA 2VDMB 5JW6A 3CSUA 3NC0C 3R3YA 3AX6A 4PQGA 3OZ7A 1NQAO 5KKNB 3CLRC 3NHKA 2FLKA 1ODSA 1V2HE 1CJBA 1KXZA 2IC5A 3OHPA 2HPAA 4HT3B 5K6AA 2XB9A 1NR5A 3N6RA 3LHIA 4TS3A 5AJWA 3WQSB 3W5AA 5IZCC 3WB1A 3C70A 3QITA 4BB5A 4U6NA 5F52A 4ZEOA 1SXIA 5SV2A 1P2VA 4DRXB 1CERA 4GRDA 1KZ7B 1U3UA 1WB6A 3WLNA 3WNZA 1QZXA 4DZZA 5KS2A 2IA5A 3EVZA 4MW9A 4NENA 3GLKA 3QIVA 5EMLA 2Q9UA 5H3HA 4EG3A 2GCPA 5CBKA 3QKRB 4JR2A 5E1BA 2VRCD 1RYDA 3KEGA 2H9YA 3PV0A 5F3WB 1UPFA 1GNVA 4FB5A 1GJRA 1VPLA 2DXIA 2N0SA 1U8EA 3LBAA 1KDYA 2FW7A 3KQUA 3QFFA 1L7XA 3LA6A 2VYND 4I1YA 3WK7A 2WSMA 3GGPA 1JR2A 4PO1A 3I4LA 3CINA 3H2SA 4GMKA 4I1RA 2H8KA 4BJ3A 1EBUA 1MRNA 1EJ0A 3GY0A 1GKYA 1NQOA 1PNOA 1U94A 3EEIA 3ETDA 3K5HA 2WTEA 4ZO4A 3RT1A 2LVBA 3GVPA 1QMGA 2EKZA 2PZ8A 2QU7A 1JKJA 2G9QA 3N0WA 4GWGA 2Z8YA 2XZLA 5ITWA 3FHTA 2F1KA 1APBA 1IBLB 3V4LA 1S89A 2EGHA 2H3EA 2P0AA 3CJTA 3MWLA 4NZPA 3Q98A 2BGJA 2IK8A 1U7DA 1MENA 4B44A 2WWXA 5DCYA 4TVBA 4AJPA 2O5VA 4TMZA 4TYMA 2PFSA 3WL7A 5F76A 3H5WA 3L8EA 2FPPB 1QGZA 3IUQA 3KT8A 4ZVUA 3T6KA 3KYDB 3E7WA 3QLUA 2WICA 1JIUA 2I33A 4LOIA 4Y2VA 2E6UX 4R9UC 4BV3A 4EGAA 4UJ3A 3WL3A 4FNGA 3TUIC 2RC6A 3L8DA 2NTJA 4YPVA 3HZOA 2NZXA 4DKJA 3OIVA 4MIOA 2ZWMA 1N0UA 5I5EA 2FPIA 2GN4A 1XE3A 4BAUA 4JP8A 1V47A 4KV9A 3VR2D 2R7KA 3FPSA 3BK1A 1BROA 4IOLA 4NH4A 1YONA 1X15A 1A8UA 3DFUA 3D8UA 1JHQA 3IC5A 5G2OA 5JNWA 1OREA 3BORA 3GGJA 4JVNA 3PJRA 1FS4A 2VBGA 3VTZA 3SN6A 1C2YA 4D9NA 3LIPA 4IGKA 4PO9A 4K9KA 4DPLA 5JTTA 8ADHA 1PJQA 4B33A 3IUSA 1QZZA 3FUVA 3WMRA 1ZLYA 2JHFA 4X92A 4EJ0A 2DY1A 1JHPA 3GQBB 1EIZA 5KYYB 4MCAA 1OFHA 1AKTA 3B1XA 4KKXB 4YLEA 1VXRA 4UTXA 3EXHC 4FBLA 1E8MA 2G8NA 1J09A 2P4HX 3QM1A 1ZD1A 4JP1A 5U4QA 2PUJA 4IEIA 2YQZA 2FPWA 4P3NA 1V39A 3BHJA 4BNZA 1EJ6A 4GYYA 4PYNA 4U7HA 3VDRA 1RBMA 2VJKA 5GAJA 3ZWKA 1J6UA 1ULAA 4IDEA 1UQRA 4A15A 1PZFA 3EIOA 5K0NA 1TFUA 3HI6A 3RHZA 1T9GS 4QUGA 3NIWA 1RJDA 4B76A 5WRFA 2F2TA 4B6JA 3REGA 2PGOA 2YV5A 1OPXA 1HT2E 2JIZD 4LGMA 1PKEA 2G9VA 2JLCA 4LPSA 3C7AA 1KMHA 2XOKD 3ZWMA 3B7PA 3KFLA 2WMDA 3H13A 2PH7A 4JLDA 5KTPA 3SS8A 3TQCA 2RHMA 2OO5A 5BWMA 3VHLB 2CV0A 1B00A 5CB0A 1OY1A 4NFYA 3ELWA 5A2QA 5LUAA 1KVUA 1QK4A 2B4RO 1MQAA 3SDBA 1XJ0A 2YL2A 3FKSA 1RQNA 2Q1UA 3F9RA 1XLWA 4PYKA 3ZDFA 1A2BA 3J7AC 4RS4A 2H4HA 3O4FA 4TXJA 4LCEA 1WS6A 3DMTC 1L5MA 3QLJA 3SQMA 1GL7A 2VJBA 3AJ8A 3NWBA 4IDBA 1W52X 4PICA 4PC7A 2UUCB 3KSMA 4NYJR 1LRKA 2NUTA 4BN0A 3WLJA 1CEXA 3JAWB 2JNWA 4QNNA 2C29D 2W8ZA 1JLHA 3CT6A 3QXHA 4B40A 3JZAA 4ZVMA 1ZNWA 1PQUA 1KNQA 2C94A 1KJJA 3HKBB 4PZEA 3N2KA 1Z68A 3MCAA 3UOWA 3WOVA 3MWJA 4MUBA 3AJDA 2XWBF 3I2JA 3UA4A 2QDKA 4F38A 4PZDA 1TUBB 1NURA 2P4EA 1UWLA 2XYPA 3HM2A 1YZGA 4H1UA 3WV4A 1XTIA 2D0OB 3LS2A 2AHRA 1Q74A 3QKSA 2R84A 4S1PA 3B20A 2BTOA 1ZK0A 3HVJA 3KKZA 2I3BA 1L8QA 4MQ4A 4QO7A 4B8ZA 5B64A 4GE0A 5GOZA 2VDKB 3CRZA 1ZGAA 4JJKA 1FDVA 2JCYA 4L8GA 4XQ0A 1FJHA 4I3HA 1Y6GA 1MBZA 2HJHA 3GLIB 1F8YA 3BSFA 1BA3A 1C29B 1FTNA 2IQIA 3JPWA 4PPYA 3TM4A 5CCBA 5CB4A 4GIBA 2V3VA 4YRNA 1VECA 2H5LA 3E7PA 1X8LA 4J9UE 3RF6A 5AKLA 5IAEA 5K0ZA 1A96A 4IKPA 4RJJA 4WQMA 1NF8A 2OCYC 4PO8A 4PZZA 1S02A 4CKBB 2BT4A 3CRMA 2BY4A 1FFEA 2X0JA 3I5MA 4X1YA 3MXTA 3ZCVA 1VJ5A 1CP3A 2FUCA 2H6EA 4XIGS 2J3QA 3ZGZA 1ZIXA 5ALHA 3O0TA 1MTZA 3ZCUA 3OTGA 1LEHA 2CCGA 3QG1A 3QPBA 1ISMA 2C97A 4BRUA 4MARA 1O0BA 3BB4A 1RU3A 3AHGA 1YFKA 4XQCA 4DR2B 1FFCA 2OK7A 1NIJA 3EEOA 3GUHA 4IQ8A 1S2OA 4LK2A 5CRIA 1P4RA 3OBIA 4FFVA 4N8SA 3I8SA 4U7TB 1LTQA 3NOVA 3U7IA 4Y3UA 3WB2A 3P5SA 1GDTA 1Z0DA 1XTUA 1VMDA 2DHQA 4NBKA 3UK2A 4B74A 4KIWA 3ZE9A 3EISA 2E4AA 1E1KA 1PTJC 1GAWA 1M9NA 3I01M 1Z88A 5AXDA 3QYJA 2V55B 3C3KA 2NUPA 3LX4A 3PHBE 1QKJA 5GQSA 1HYQA 3VNAA 1D04A 1R12A 3HXLA 3DM9B 3KUXA 4ZO6A 5P8WA 1V1JA 4RHTA 5AW0A 1FXSA 4HWGA 3MTIA 1KFEB 4L02A 1TMKA 3DP7A 4ND2A 1JG1A 1Z4LA 3BDVA 2LKCA 1DQYA 4FU0A 3S2EA 1U0GA 1WZCA 3P32A 1QRAA 5AH0A 2AZTA 5J4YA 5L3QB 5E3IA 5ILOA 3P4UA 3DBVO 2O8VA 4TN1A 2BCGY 2HPHA 5JDCC 1AC5A 2Z6AA 1PHPA 2HB6A 3DJYA 3OZUA 4OX9B 3CLKA 1RWNA 1BAPA 4X91A 2FW0A 1PFYA 3GBSA 4UAGA 5TE9A 3FY4A 3LQQA 3KHKA 2FN9A 3MB5A 5MF6A 4XX1A 1KVTA 2C77A 4MQEA 1AX9A 2BUCA 1TTQB 3AC0A 1IIBA 4G0WA 1A2QA 2VQDA 1TKAA 4WZAB 3GHYA 1T10A 4O02B 3ADBA 1LTKA 1PFWA 3ZW8A 3G6KA 2H2GA 5A9SA 1Y80A 2JA1A 3IPXA 2ZCUA 3LYHA 1P1JA 3NXSA 4P22A 1CQJB 1D2GA 4D96A 5TSDA 3MTQA 2AN3A 4OB7A 3EJ6A 1FDIA 2QK4A 1XV5A 3GPCA 4IIYA 5JY6A 2C3UA 3VO9A 4C14A 5K20A 4EHKA 2VZEA 5DCLA 3ACBA 1D6NA 1YMUA 3AQIA 3LVBA 4H3SA 4HXFB 4YWJA 2QGNA 2B8WA 1TYZA 1WXGA 3LX8A 4X00A 4HZIA 4PQEA 5B3JC 2WFMA 4FGWA 3WKBA 3DR3A 3PR2B 2PE5A 4E5SA 3HSYA 1RJ9A 4EY7A 5BV7A 2GDJA 3ZVMA 1AHHA 4B34A 3LQKA 4CF5A 1F9AA 1FNCA 2GX6A 4KOEC 4UHKA 3KKEA 3R9KA 2DUWA 4PN3A 2ZT7A 5AW8A 1E2KA 3LA8A 4FSDA 2BHSA 3WTBA 5C52B 3GCGA 4Z4FA 2VO1A 3CT4A 3CR8A 2RGEA 3GWZA 4FXOA 4JWTA 5TF0A 2MT9A 3SHTA 1U81A 4QBFA 3RREA 4JP2A 4KLRA 4KRYA 1L4KA 3TSOA 2WWFA 1ZK3A 2MINB 3AV0B 5DLEA 2O2SA 4Z3DA 3FKSD 3U09A 1HYEA 3AEQB 4WPGA 2OCKA 1ZSYA 4NYIR 2YJ3A 4EITA 2NPOA 2BBOA 1JQAA 3FN4A 3HADA 3OU2A 1Z3IX 1XCPA 1A4UA 1GITA 4M8NE 4XFKA 3K70C 2C5GA 2EWVA 2X4LA 3BCSA 3DO8A 3GLHA 5EVCA 4F60A 4HNTA 4LHSA 1RT9A 3IVXA 1JH8A 2HK8A 4I9NA 5TQ2A 221PA 5IF9A 3SCZA 4IW3B 1T36A 1IRIA 1SCQA 4OHXA 2EEZA 1VC2A 1XEAA 2DY0A 4WE3A 4KPUB 5FPHA 1FRQA 3IV6A 4QSHA 1Z0AA 4DYDA 3VH1A 2O8FA 2OYCA 3HJHA 1RS0A 1JQBA 3UHAA 4MQ6A 3L07A 5CXQA 5KNBH 5BWBA 3T06B 4GR4A 1OC2A 1Z6GA 2G63A 3IEXA 2GF2A 3RVJA 1VRCA 4WOJA 1OAOC 1V2ZA 5JSQA 4ND6A 1E99A 1V6CA 3GRFA 4M38A 5D5QA 2X15A 3C3YA 5FBHA 5I9IA 2OE2A 3C7DB 2PKXA 1YQGA 4JLNA 3Q0IA 4MVJH 3AFOA 2XUFA 4AZWA 3HM9A 2BHTA 3BXOA 2XTZA 3C5WP 3ZY2A 4JENA 3AU8A 3DBRB 3E3OA 2IP4A 3AG5A 1OU0A 3HJFA 3JD2A 1JIIA 1WIWA 3KTOA 3AR8A 1TVKA 1TYDE 4OREX 3ZHVA 4CM6A 4IGFA 1UJ5A 3CPHA 2R6AA 3I5UA 3PA6A 2ZFUA 3QPUA 3N7TA 1ISJA 2PBIA 5FTLA 1YJQA 1M5TA 3FGZA 3NHSA 4EG0A 3MPOA 4KODA 1G7TA 4BO3A 2OPBA 4IQGA 4IRMA 1V8DA 1ZGBA 2I7CA 2OD9A 4DGQA 1D6MA 3K2EA 1LWNA 3S1AB 5CA1F 3VZDA 2AQHA 2A1UA 4X71A 1E6CA 3WXMA 1E3IA 2VZLA 4X1OA 1S8NA 1JQ5A 4QDUA 3ZZ1A 5K8IA 4OAOA 2VHVA 4BNNA 1R0SA 2PRJA 3EJWA 5G4KB 4RF3A 1I0ZA 1MQ9A 1X1RA 4UUNA 1FP4B 2D54A 3UMSA 4E1AA 5HZGA 3PWSA 1ILEA 2XUIA 2WE8A 5BURA 3R0QA 3LUJA 4FHDA 2GWHA 3NRCA 3ZG6A 1USVA 3K8OE 1EU1A 4CMGA 4X8MA 1QWSA 3QBEA 3AR4A 1KY3A 3MCWA 2ZBPA 3QW2A 1QQ5A 1X87A 4YIKA 3T1QA 4LISA 4YQYA 1SCAA 4CF6A 5JC8A 1Z5WA 1OX4A 4L4RA 2ZAYA 4G89A 1Z22A 4MW0A 4PAQA 4BO2A 3LPLA 1XC7A 2FP4B 4Z49A 1QCDA 4XUCA 1Q7TA 1VBFA 3E5MA 1K5PA 5EXEA 3EMVA 4RSHA 4LYHA 2HQSA 3N6VA 4OGFA 1KI8A 4X7BA 2O2JA 4LK3A 1RI4A 4V39A 3MOIA 3EVCA 3VYVA 3C3EA 1BU8A 2C00A 4XIFA 3ZHSA 3F5DA 4D98A 2PUHA 3O3CA 3RIMA 1O2DA 2GCEA 3K0KA 3NYQA 2ZTSA 1XA4A 4YMVA 4N5NA 4FZVA 4PHFA 2RJNA 1HTWA 1G4AE 2RAUA 3C15C 4LY9A 1YE5A 2FNAA 4N0MA 4L4XA 1LVUA 3BK7A 4GBJA 2REBA 1HDEA 4TMWA 4AUNA 4HQ6A 1OWMA 3THXB 1YRBA 4JUBA 3VKGA 4R7TA 2HPVA 2JKZA 1GIAA 3TLBA 4A2PA 2PUCA 4LYEA 4BO0A 3WSWA 1Z8NA 5I4IA 2VTBA 5L9AA 4UZFA 2WAAA 1E7RA 4K0KB 6CHYA 3IP8A 1CQXA 1XAGA 1NXVA 3VISA 4QVGA 4YUZA 4Z9BA 1QK5A 4L3VA 4F0JA 1WKCA 1HZZA 2CXHA 4N7BA 1LVGA 1ZOOA 4OK5A 1Q7CA 1IJFA 4OM8A 4W1RA 3L7MA 4CMIA 2C9YA 4HQFA 1V7QA 1OFVA 1G6KA 1ZN9A 2IYSA 2PSEA 1G21B 3CEMA 4JJAA 4PIMA 4DLXA 5JVDA 5A0VA 4UNQA 1FFSA 4MUXA 4QAJA 4RJKA 4IDFA 1K6XA 1GQ2A 5AOAA 1YGYA 3WXBA 3LY9A 1VIYA 3D81A 4IZHA 4NICA 1YCHA 1UJMA 1KYXA 2J0SA 2FZ5A 2W6IA 3KTFA 3PXGA 5AM1A 5ECDA 4X1KA 1CQZA 5CVTA 3TZHA 1K0FA 3FXAA 1WPGA 2BFNA 2H51A 3DCYA 1KQPA 2KYRA 1AUXA 5FT9A 4GNRA 2J5KA 3U13A 3WBJA 3G6WA 3HJRA 1IZ7A 5MN6A 5LZ2A 3HK2A 4KVAA 4O2BB 1A8HA 1FQOA 2P9CA 2VDVE 2PG3A 4IF6A 1Z8DA 3DE5X 1V8FA 2YXDA 1FLDA 5F73A 1M33A 5BSRA 4IGIA 3ZQKA 2G7MC 2I8LA 1KZGB 2KQUA 5GP1A 5EJ6A 1Y1KE 4MDEA 4EQ6B 4Q4AB 1M1YA 3V80A 2FQ1A 3PFHA 3V55A 1U9IC 3ZWDA 3DNPA 1C3JA 3HGMA 5MFZA 3TUJC 4HPWA 4FLMA 5JZ9A 1W30A 3AVTA 4UDYX 5TMDA 2A0FA 1HE8B 3G7NA 5K2MA 2PCJA 4F71A 2HD4A 5LDHA 4R69A 3UPTA 4IGAA 3CTMA 5JH7A 1YI1A 1JDBC 3X44A 2GARA 4G0YA 1CETA 3H5NA 4NBTA 4OQDA 1TYAE 2ZI3A 4XA8A 5FA6A 1Y6JA 5HS4A 2AOWA 3KUKA 5K09A 1WM1A 4G8CA 5HDBB 2BFFB 3G2QA 3G8BA 3W2EA 2P0YA 3ETLA 2C9CA 3OCWA 2Y68A 4C6SA 2IS4A 1XEWY 1AS3A 4RHCA 4B7CA 1I4OA 3LPMA 4AJHA 4CKEB 5K3BA 4F3TA 1TEVA 2PO7A 3ZTTA 1BH2A 3JQGB 4MK4A 4HTFB 2J9FA 1ODJA 3RPEA 3P9QA 4BS9A 1DCTA 1TECE 4QTUB 1BVRA 2WBLC 3PPIA 1WCIA 3PXEA 1TRKA 4E32A 3H2ZA 4AD8A 3I2GA 1BX0A 2OWDA 2SKDA 1NRJB 2H16A 1MGOA 1WHTA 2YMLA 4Y8VA 1X14A 4UE2A 1R2QA 4UM9D 5BPFA 4QHTA 4PZYA 1C30B 4P81A 4P4SB 5I7WA 4YPFA 5EJMA 1BZYA 1JEQB 3FLEA 1H9BA 1PR6A 5HJEA 4FI3F 2ATCA 1SVNA 1KGSA 4YRQA 1A9PA 2BOVA 5FNZA 1QDEA 3GGCA 4RLQA 4RJTA 2G09A 4B87A 1UBTS 3N58A 3WZ2A 1O9HA 2D7CA 1RYMA 3L02A 4GMGA 4LYJA 1EK1A 1G4UR 4S1WA 4HDMA 1N25A 4L6AA 4M0DA 3V1MA 4Z4CA 2A1IA 1T8SA 4QUIA 4ZU1X 3ENQA 1H2WA 2XNCA 3D3NA 4YJKA 3RJZA 3W5DA 1QCYA 4DDWA 4RPLA 2VAMA 1DWPA 2CYCA 4Z8XA 1IOWA 1WHSB 4HQNA 5FX2A 5IBRA 2UZ3A 5L6LB 1O97C 2P35A 4YV0A 4F9TA 2F1HA 3H1EA 3M49A 4ITRC 1AMOA 3K05A 4G4JA 1FLVA 1Z39A 2X8WA 3NBFA 4L76A 1Q1GA 1TLTA 2BI4A 2BR3A 1R5BA 3BJRA 2Q7DA 1J00A 4MMXB 2D06A 4DPMA 5IBCA 3FIUA 4W99A 1N2ZA 1YVDA 2ZZMA 5F2NA 3A4VA 3KC2A 1OR8A 4GOOD 1AJEA 1SIWA 2VXCA 3QFHA 1V37A 1AVTA 1M2VA 4FMCB 4P53A 3OZTA 3S3TA 1HZJA 4ARZA 3I1JA 2ZJAA 4G4IA 4Q1BA 2WB4A 1N2SA 2VG8A 4GKVA 2WMYA 4HQRA 3IE0A 1ZIYA 2HC9A 2UUBB 3VKVA 2Z09A 3OQJA 5C4GB 1SXPA 2GS9A 1DELA 4KMRA 3OSUA 3U3KA 1KJZA 3WDLA 1AA9A 2P7HA 3A36A 3IAM6 3E81A 1Z47A 4RQTA 1QRSA 1CUAA 5FPKA 4L51A 1KE1A 3X3HA 3TI7A 1JT2A 4XZ3A 5BQPA 3T4UA 2XGGA 4KXXA 5KOJB 1JI0A 5AVXA 1NJ5A 1WLSA 4Q03A 1B6RA 3CCCA 1X7ZA 1QKKA 1LU9A 2X58A 1CR4A 1SY7A 2HI0A 5ICGA 1ZIDA 2YICA 3EUWA 2WJZB 5EXTA 3NWOA 4YDSA 3UXEA 5T6BA 3LO5A 5KNCD 4K6HA 3TD2A 1D2CA 1QDLB 1LDYA 5G3YA 2FKNA 4RGVA 4DLVA 3QYFA 1DV2A 3RC3A 4LJRA 5EWMA 5DCUA 3F7MA 3KDPA 2ZDQA 2NVUA 2RB4A 1W5EA 1W94A 3C8DA 3FW1A 3IJEB 5CYOA 2XDAA 3FH0A 4MI9A 3Q5DA 4FDAA 1GZHB 3WL6A 3QVWA 2NQ8A 2FK7A 3LJKA 2EG5A 3FPGA 3Q72A 4C30A 5A03A 1TKRA 3R2JA 1FMCA 1TM1E 3O4JA 4R40A 3PUWA 3QMMA 3K16A 1P5JA 2A5GA 3JVEA 3KOZA 3VZPA 4MP3A 1ORDA 3W6UA 5HSGA 3C41J 3LBYA 1ZITA 4OSOA 1D2MA 5TY0A 1IPHA 1ZPDA 2FGKA 2PLRA 4DQLA 1P1IA 1NUSA 3HR7A 2X5NA 2QRMA 5M04A 3EA5A 3KOXA 1X9GA 2WWIA 1FP2A 2NSYA 4Q1AA 5FWXA 2ZIWB 1UXKA 3WLAA 2D00A 3O2NA 3ZI0A 3T5BA 4DWVA 1HNZB 2R8PA 1M1NB 1LBIA 1OSNA 3A58B 5GZ1A 3PXAA 2BYTA 1QGYA 3DD5A 2GZ2A 3DBHA 4G5RA 1JAZA 3IS3A 4OHUA 1KZ6A 2JGNA 3EE6A 3E48A 1WDLA 3LT1A 4OHZA 1ZVQA 1MLDA 5CD9A 5AUNB 5KYWB 4I50A 4C05A 2O8FB 3EFOA 1F2UB 5EHNA 2MIIA 2XJ4A 2P5SA 4URFA 2HA0A 1U31A 2EKQA 1KY2A 3E0QA 4QA9A 4EKDA 2EKDA 4EW1A 3HWX1 4HVTA 4TKZA 3M3DA 3CLUD 3UHFA 3ZQ6A 1R15A 1USUA 4I08A 3BE5A 1ELOA 3CF0A 3G0DA 4P82A 3TGPA 5CB6A 1SFRA 2FG7C 2CB9A 3RSSA 3WKCA 1CW2B 1GHTA 4B9EA 1SC3A 2BI7A 2JCBA 4O4LF 2QG6A 4QOGA 3UMFA 2G83A 4WBXC 2F6RA 5B6PA 3AF3A 1UBNA 4IDHA 4Q4HB 5THXA 1HYGA 3TCKA 1BX3A 3GLIE 1K98A 4G8JA 3Q2OA 4ZODA 4PEVA 3R7FA 4KNYA 3ZJ5A 2OCIA 1SG9A 3KUCA 4E3ZA 3CX6A 4L5BA 4I9GA 4D4KA 4E0BA 1F1JA 2BFAA 2Q0SA 4YRFA 4YJGA 1UR5A 2I3AA 1O7JA 3H8VA 2ADMA 4WCDA 1I5OA 2BHNA 7REQA 4AJNA 2IIVA 4KQKA 3NS7A 4BFUA 1JTEA 4QXOA 2QRVB 2VRWA 4UU1A 2ZRHA 3TLXA 5C1DA 1FSPA 5KOIA 1I80A 1Y82A 2I7TA 4HZGA 3RHFA 4MVJI 2AMFA 3GLFB 2IYYA 3JWPA 5DTQA 4BQQA 2W83A 4DR6B 3DG9A 4YUXA 3M6IA 2M6LA 3A32A 4UQPA 1SHKA 4CKCA 1QHXA 2H1LA 4AB1A 4OLBA 1NMSA 1A9XB 3R24A 1QWOA 1ZD3A 1H1LB 2AMVA 2ESRA 3I83A 4MP8A 4PYRA 1ESNA 2PTHA 4A8JA 4B3RB 1VCIA 5TVKA 2AE2A 2FZ4A 1P1KA 4BKQA 4DCOA 1IBRA 3M5WA 4M7PA 1DKNA 2MSCB 4HV4A 3KP1A 4LYYA 2PMCA 1BO6A 2HZBA 4OMUA 2QNIA 5DN9A 4RANA 3VPHA 3NFRA 3ESBA 1EFDN 5HF5A 1E1YA 5K8TA 4F6LA 4V0RA 2XTMA 2NAFA 5DHAA 3GIDA 4MS1B 1IDOA 1G8PA 1MC8A 2REQB 4DLKA 4KK3A 3H0KA 1T4CB 1E3LA 5C8ZA 3SS9X 2FRVA 1AKMA 3MRVA 1NASA 1PFKA 4XXHA 1BMQA 2Q4DA 4B81A 4W5WA 4ZGGA 2DKNA 3U5ZB 1KPIA 4NMMA 3ZHYA 1KAQA 1NQXA 1PYDA 3HR4A 3Q0TA 5CTJA 3WWDA 1GTL1 1CNEA 1WXXA 2XRFA 3GNTA 3LC0A 4DANA 1E4VA 1WDWB 3CWCA 2QTVB 4LWZA 4ZARA 3ET4A 4WZAE 3TO5A 2PRYA 2GJKA 3W5UA 2VDNB 3I12A 3SU8A 3ZZ0A 1DFHA 1XLTC 3SF8A 3WNQA 3JYPA 1OIWA 3DAHA 3OZSA 2FOIA 2GA8A 2AOTA 1OT3A 2IV2X 5DNWA 1UJ6A 4X95A 3MLAA 3M33A 3RBAA 2JGLA 2V9CA 3T54A 4C7VA 3G5UA 1SUCA 3U56A 1ORHA 5DGIA 3WQBA 1BDHA 2BN4A 3JQAA 2QPOA 3I53A 3BGVA 4UMDA 4CVNA 3P0JA 2I2CA 3W8DA 3DKKA 1LPPA 2ZTVA 3HBAA 3LK7A 4KPFC 3UUGA 5HKKD 1A8IA 5B7PA 4ABTA 4CM8A 3IELA 2UVQA 4RC9A 4ROSA 4WEOA 5AVYA 2HADA 1RMQA 4QLAA 5CCXA 4XR4A 1FJXA 4KN6A 2PVPA 2I2WA 2WPDA 1GQRA 1GR1A 5ERYA 3IURA 4C89A 1SGWA 3EAQA 5LQKA 3RM3A 2IHJA 4JU8A 4URXR 3NHFA 1MJ5A 5C2JB 2VTKA 1J1ZA 4JB8A 4YACA 1B43A 3VDMA 3PNBA 3ZPXA 4C2AA 4DIOA 4B2YA 2NO5A 3U61B 4AICA 1II9A 5EY5B 1ZM3A 5LR6A 1FDUA 3U60B 4WXPA 2X3UA 4H1TA 4MAAA 3ESYA 2IKSA 2Y2UA 1CNFA 3PNPA 1IE3A 1ZQ9A 4CTNA 1IK4A 4LIPD 1GRVA 3GAZA 4OBBA 2B0CA 1FTYA 4GSKA 4RV4A 3U4AA 5K2OA 5IC6A 3A2NA 2BDTA 2DGDA 2VUIB 2XMCA 4OK6A 2ZE5A 2NYUA 2PWZA 3TJRA 1PT5A 3OQIB 4DCMA 5C51B 2ODNA 4WLNA 4DARA 4HR7A 1MXHA 5F23A 2OV4A 4EUEA 2ZEJA 4B83A 1RKVA 2TSYB 3K9NA 1U0FA 1XZ8A 1F8UA 2I5PO 5ITSA 1EP1B 4R68A 3TJMA 1Q95A 1BS2A 1QQ6A 4RTKA 3H2HA 5A5DA 4JODA 1P5FA 5LOVB 1B1AA 4EJSA 1JWBB 4BXOA 4XLTA 1NVDA 3LUBA 1L6RA 1VLQA 1VLMA 4IFEA 4Q16A 1GDHA 4IDGA 2IYQA 1QV9A 3NVAA 4Q3NA 3C4QA 3I73A 4JBYA 1E4OA 5D6NA 3A6PC 4XPIB 2YHIB 4KX5A 4KDFA 1R37A 3MSXA 3OCJA 3TLMA 4EKGA 5IJZA 4L0CA 3ZY3A 1WETA 4GOJA 5EJFA 3A05A 1LA2A 3DFMA 5BRAA 4DL9A 3O0DA 5U1PA 3I5YA 3C6QA 1IHXA 1YS9A 1LBSA 1Y1QA 1K9VF 1ZK4A 1JUDA 2FPSA 2JZNA 5M29A 1PQ4A 1UBKS 2GN6A 5FBRB 5SYAA 3S2SA 3AHFA 5C46F 4Z7NB 3BFPA 3R5HA 1P1CA 3B3AA 5L95A 4OATA 3ICQB 3U48A 5BVGB 3NHPA 1UMCA 4FSXA 4Q1DA 5SZHB 3BT7A 1NTRA 4Z1MD 3ZU5A 2AGVA 1H8HA 3ITKA 4L5AA 3ZE2B 4ALNA 4DYHA 4F5WA 4BX8A 5C3UA 1QFXA 2C96A 3M6UA 3WIEA 5JZBA 3GOQA 3W2GA 4WWHA 2QJRA 2JHCA 5JQGA 4IOJA 5BQ3A 4GPTA 2QUIA 3I05A 3RD5A 1WVGA 2ENUA 1XCBA 4L0MA 3GUYA 5F7JA 5CLJA 5K03A 1XZDA 4XVUA 2E4WA 2HGSA 1D1PA 1QBGA 3PXDA 3N6XA 4GI2A 4IVNA 3TX2A 3GJXC 5EJ4A 1I2MA 2ST1A 4P7GA 3SAJA 3F8SA 3OFVA 4PG7A 2QQFA 3SHVA 4PGAA 5IW8A 5F5LA 4RLHA 3K9CA 1Y5MA 1TJPB 2AKEA 4M6WB 3WE7A 5B6IA 1SPBS 1X1BA 2VK1A 4FS3A 5FQNA 1T0IA 3NAMA 2FPGA 3GGSA 1OYVA 2DLCX 5C7YA 5FNVA 2H48A 2AG1A 2XWSA 3JQPA 2ZBQA 4AZ0B 3ZIAA 1LJLA 3CKMA 4HX9A 2VA8A 2PZFA 1FRNA 2DAPA 4Y9TA 3HXQA 1Y3HA 2CXTA 4FMBB 2BIFA 1KAEA 1TFRA 3KKKA 5IZ4A 5AVSA 4XAQA 2CLSA 2O1SA 3G9ZA 4F06A 2C3OA 4OX9Y 2HXYA 4N18A 2QUAA 1GKIA 5DO9A 1ZI9A 4UU7A 3QNMA 1KOGA 1X7YB 2MSWA 2W22A 2P65A 1O5IA 3QUSA 1ICEA 3TM5A 2Y1XA 3F4KA 4K03A 3KR0A 1G41A 3DXZA 3KT6A 4UTNA 2IHYA 2OCLA 1SUFA 3L1IA 3ABQB 3L6DA 1KMCA 3WGKA 3FCXA 1ENYA 3UMMA 4YP6A 1M8KA 2MSDB 3B85A 1I5EA 2QNBA 4KQ1A 4ZJUA 5BYAA 5A4AA 2ZPUA 1U0RA 1GZUA 4WN9A 4YXWD 4NARA 4P86A 5G0VA 2OV2A 3FRHA 2R6FA 2GRAA 2I4MA 2YFQA 3L6BA 4AG5A 4E94A 1E4YA 4CI9A 4BV2A 3R3XA 2BGNA 1T6NA 1P7YA 3BKXA 2V1UA 1JHMA 1XDBA 1G21E 2WF8A 3CLTD 5JOQA 1FF9A 5FO0A 1GCAA 3IQZA 4MIEA 4IZIA 2YZ2A 2CLKB 4H1VA 5FTMA 5CLIA 5KTSA 5KYXB 4MWEA 4IF4A 1AS0A 2Z2KA 1IXRC 2WF7A 4X1YB 3HE3A 3BULA 3KJQA 1TA9A 3QWAA 1XNQB 1KRHA 3A4YA 4MWGA 1W4CA 4NJEA 4YROA 1NU6A 3HV0A 3L2OB 1V11A 4C7JA 4QUKA 1G55A 5KKCA 3R9WA 2XYGA 3H19A 1W2GA 2F59A 3IRUA 4L5IA 4WAUA 2G1UA 2WC1A 4YRZA 1KBZA 1ZAYA 1WUHS 3PTLA 2ISSD 2Z6VA 1GZSA 1D03A 3CNLA 4BLRA 2CHFA 3OCXA 5A9RA 1YT5A 3FFAA 3K09A 3NGXA 4RMNA 2X0IA 5AHOA 1U9JA 2GPBA 5CT9A 2W6JD 3QHPA 4GQIA 5AUOB 3DHEA 4F3CA 3GLIA 1ATIA 3D4BA 4WKPA 3GLTA 2IIBA 3GVXA 1X39A 1YB7A 3I9V6 5JD4A 3TG2A 8LDHA 3DZFA 4PC6A 4FHZA 1F14A 5JEDA 1TO2E 3AM4A 1Q0UA 2GJSA 4N7JA 4RVOA 1EHCA 2EEPA 4NCKA 1ZD2P 3PR1A 5CXUA 3GZ4A 3HCPA 1NGSA 2AG8A 3I2HA 2ATXA 3R6TA 1FP7A 2PANA 4XGQA 1QMPA 3OJLA 4WLOA 1E9CA 1OXVA 2FF5A 2V5AA 1IG0A 3JYOA 2IYNA 2QG4A 4TV9B 3T1NA 5KNLA 1TADA 2O54A 2ZWPA 3NQ41 2EW8A 4TKUA 5L3RA 2J9ZB 4IQ4A 5DI3A 4Z9YA 2TS1A 3RIEA 5B7QA 2EX4A 3DZJA 3IUPA 1NLFA 2XE7A 2ZSDA 4LBWA 4A6DA 1WAMA 2ZITA 3P26A 3SEFA 3SIRA 3V2IA 4D6YA 3LRPA 2O7QA 3A3OA 3L8HA 1QSAA 3QE3A 3EASA 3CUVA 1DC8A 4PRZA 3JQ7B 3U7JA 4F46A 4YCMA 1QQ7A 3ETHA 1ECFA 1GPJA 4RK6A 5DGCA 4MGYR 2W8BA 2ZSAA 4AJ9A 2OMKA 5ES3A 1S7GA 4NBRA 2E4UA 5AUQA 4DNFA 5JV5A 2IKQA 4PG5A 4WFKA 4Z53A 2LZ0A 4DQDA 1YU6A 4XCQA 4DTIA 5ECGC 3AI2A 2GEVA 2VK4A 3IUMA 4D0GA 4EAAA 4B4OA 1ATZA 2YZGA 2NZWA 3W9UA 3ZE0B 4D8XA 4DR4B 5GINE 3M1IA 5ALXA 1ADGA 1HSZA 1U2DC 2X14A 3H86A 4MUFA 4OIMA 4IHJA 2YYYA 4BGVA 3SE7A 3NHAA 2ZRIA 4UVEA 3OY2A 5IJAA 3OI7A 5D3MB 1H8HD 3R6GA 4TQAA 4Y9SA 3Q6IA 3DH0A 1WQ3A 1D4OA 4BYMA 1AF7A 3A6KA 4ENTA 3SP1A 3RVSA 3E1KA 3FKQA 1KI7A 1GNTA 3KWFA 4EDHA 4F9EA 2KPOA 4J0EA 4C78A 4PAGA 1J2EA 4L1KA 4L7VA 2PX3A 2UDPA 2CJWA 5JZOA 1HFWA 1WVMA 3OBBA 2EP7A 1NLMA 3EDCA 1T9KA 2FPKA 1OTXA 1DWUA 2R6GA 1CSEE 1JFTA 2IYFA 4K6MA 4H6XA 3GV0A 2GB4A 4FWBA 4CHGA 1BD3A 3LKZA 3TXAA 4Q4JA 4EI2A 3DONA 3NHWA 1V71A 5M7EA 2RGAA 2D5AA 1SQGA 2HMVA 4ROTA 1T8UA 1XHFA 2OD7A 3SYLA 1YJBA 4R83A 4A0QA 1QTQA 2R8ZA 1L5HB 3STTA 1KU0A 3BUSA 1GARA 3UNXA 4EK9A 2AK2A 3FDZA 4CFYA 5IDVA 4BQPA 2ODBA 4OH7A 1Y9DA 4BZPA 4F2HA 3EGCA 2JLQA 2C5BA 4U3JB 3RUFA 1DAPA 2P9EA 5DZSA 4B0PA 2H7CA 2B9VA 1AS2A 2QN1A 4TYPA 5AYVA 3IBCA 4XX0A 3VU9A 3HJGA 4CCYA 1QYDA 3H5AA 4ZDKA 1HT0A 5LQUA 1NMEA 3U7FB 3SD7A 3W3AA 1VLJA 3HNRA 1PK9A 3A9CA 3T7DA 2DLDA 2JLSA 1RQPA 2BCEA 3V4ZA 3MT0A 4XDZA 3BFVA 3ZS9A 2DG2A 2A3RA 4Y2HA 3KSBC 2B30A 2C7OA 4KLZA 4QGAA 4LMPA 5FPSA 4FN4A 1OXTA 3D3WA 4JI1B 3W9SA 2AMYA 5G4LA 1TCCA 2OQIA 4QYIA 1PUJA 3L0BA 5F77A 1F60A 4JSTA 2B5WA 2Y1FA 2E18A 4TUYF 1FZTA 4KFUA 4C88A 1LB1B 1S7CA 4CM3A 4M9XA 1E3WB 4GPAA 1C1DA 4MH0R 4HGOA 1LTHR 2WWVD 3M81A 4N1AA 2REOA 5DNUA 1C9EA 1NY5A 1UKEA 2XCIA 1PEKE 2E0IA 1KDTA 3EAFA 2WIBA 3A1UA 4HN2A 5K8VA 4WFQA 3VMFA 1YJCA 3RJ5A 1JQDA 2VPWA 1KDRA 2EBWA 4C4OA 2X2EA 5LDGA 2BGKA 2MSLA 3OPMA 4S0ZA 2WV9A 5K05A 4D9JA 5EMNA 4PX2A 4DIKA 4K88A 8AT1A 1XYVA 4FEEA 4HDCA 4QUBA 5FWAA 1X7WB 1YI8A 3F2VA 1LS1A 2CLOB 5KYNA 4GYWA 3MD0A 3V1YA 1Y3BE 3NH9A 2GBIA 3GGGA 5K3FB 4LE2A 4AXXA 3LQRA 1V7ZA 1RWQA 1DX6A 1FZQA 4HCJA 1YOVB 5F5XA 3ZE8A 1CJVC 4IO1A 4GM0A 2QKYA 3MIIA 1IZYA 3B2NA 3K72B 1G20B 2LWIA 1KQNA 1SD5A 1TAHA 4CG0A 2PKCA 4ID9A 2JFUA 2FWPA 2VDQB 2V45A 3VSBA 1QF6A 1BMFD 4MYHA 5D86A 5KWSA 4CETA 2V6GA 4WCFC 3Q12A 5CX4A 3BD9A 2LKDA 1SV1A 3QF7A 4N49A 5ERGB 5LA6F 3TVTA 3ZNQA 4B1FA 5JS1A 3QUAA 4XD7D 4LZAA 3O93A 1Z06A 2ZS9A 2AOUB 4PFSA 3KJHA 1E9FA 2YWEA 3QLUC 4BGIA 3D0RA 5ED0A 3U7HB 3I2KA 3LKBA 1NXSA 2V74B 4B5LA 3A9SA 3M3PA 2B1RA 4C4ZA 1MQ8B 2L2QA 1UDXA 4XDYA 2IP2A 4BWYA 5JFOA 3EHEA 1KEEB 4LXYA 4QOSA 1YU9A 4WW0A 1JR6A 1YA6A 4QGGA 5IF3A 2WFAA 1Y63A 2B35A 2X0NA 4O2BF 5FI1B 2GOYA 3SZUA 1W19A 1AQIA 2WF5A 3PQEA 5AKGA 1UFVA 1UTUA 2CVQA 2P9FA 3R5TA 3G1TA 3ROMA 2VATA 3EC1A 3TQQA 1GQSA 3L79A 2GDZA 3L43A 3IDQA 2FMKA 4ZK2A 1JHRA 1KPGA 5IK2A 2FEKA 2ILVA 5CW2A 4NV0A 4UCWA 1V35A 2VP3A 2XVMA 3E22A 1EP2B 4XWAA 5DYTA 2Q4OA 3G0HA 1T2DA 4JN6B 1V41E 3JAKB 3Q4GA 1U0SY 4ZVRA 4E22A 2AXEA 2RCNA 3DAOA 3QF4B 2GAAA 3GJ8A 3ETNA 4MB0A 1WKBA 2CLCX 3PHGA 4KQEA 4ENQA 2VLIA 1A9SA 3EXG2 3GLFE 4CMIB 5DTMA 1P1FA 2J08A 2ZIVB 3KBBA 5AKZA 2IY9A 5H3LA 3ZW7A 2DFNA 3OE7D 3GFTA 4D92A 5ICMA 5U9CA 3EZ2A 2R6DA 4OXKA 3K1YA 4CU5A 3MB8A 1GNSA 3D1JA 1BJRE 1RXSA 3C3CA 3MWDB 4LDAA 4UVIA 1F7UA 1JT9A 1AGPA 3NAZA 4TXLA 4HUTA 3RADC 2AOVA 3M9WA 3BIJA 2EATA 4OQFA 3T7IA 2R1VA 1Z2DA 4OP1A 2ZBGA 1GKUB 1EFRA 4RELA 5LQDA 4LZNA 3G85A 3IMFA 5CJ2A 1CRQA 1JFVA 2H1WA 3QX8A 4X6YA 3TZEA 3DP9A 4XGNA 2UUPA 3VPBA 4LDPA 1WLYA 3X0DA 4LDJA 1U04A 2W2LA 3S81A 1OLXA 2OCAA 4H15A 3RROA 1Q84A 4YUVA 1XCMA 4KQHA 4HVLA 1B7GO 5JSKA 2AQKA 4X8QA 2CL5A 2JBWA 5C31A 3R7WA 3W78A 1MP0A 2B7CA 2GPAA 3GEHA 4L0DA 4AZSA 5AQEA 5BPHA 4AUEA 3VBEA 3DLBA 1GUYA 4C22A 4G0ZA 3RIYA 2VDPB 1NIPA 2V65A 4DLUA 5ICEA 3QUCA 3K70B 4QJIA 4YRBA 1YTLA 2EZUA 4WXEA 5CH5A 5JADA 3HGTA 4HF7A 1HQCA 1FTWA 2FRXA 1HF3A 4NIMA 4TYYA 2VK8A 5IT0A 2YTZA 4W5OA 1JIVA 1CJCA 1VGRA 3ZJYA 4Z99A 4ILEA 5CLLA 1VPWA 1Z5ZA 1EWYA 4MPDA 3ICPA 5DLQC 2V7BA 2ZRJA 3K0AA 1KEUA 2XDQB 4TT3A 1NF2A 3BICA 4Y30A 3RLFA 2GWRA 5FV4A 1K88A 2Q1WA 4XB1A 2VUSA 2Y76A 4IFBA 3PUYA 3D5QA 2WA2A 4RVHA 2F62A 2O07A 3EC7A 1SNYA 4WESA 4B6RA 5KYTA 1BEUB 2J0UA 2WHPB 3LUHA 3L4BA 4GX0A 3VTFA 4ZKDA 4ED9A 1OILA 3KO8A 3KVNA 4ENPA 4R8SA 1LDMA 2RGXA 3CB4A 3NT2A 1IPEA 2AFIB 2JEOA 3I9V1 4HEA1 4WLFA 3I5AA 4HNVA 4YREA 5JMOA 1IUNA 1G3QA 3D1LA 2AK3A 2VWGA 5BN5B 1YFLA 1XAJA 1RZRD 5JROA 2B21A 4C6TA 1QAQA 5E6SB 5JZMA 5L51A 4Z54A 5DGTA 1XTPA 2IYOA 3S2GA 1Z5UA 2J59A 4ECAA 2M6KA 1Z4IA 3FR7A 4A5SA 4MS3A 4WERA 2ZI5A 5DNEA 1AZTA 1NBMA 3N7AA 2PYIA 2ZQ5A 3LBFA 1Z5NA 1DIAA 2J07A 4IGEA 4H7IA 4MV9A 4UVHA 1I14A 1C1XA 1RYYA 2WVAA 4OQNA 2YMMA 8ABPA 1X94A 4PTLA 3TKLA 3EWSA 1EQ2A 1RQLA 2Y71A 1NXPA 2CYBA 3DOIA 5KSPA 3WRWA 1FE8A 2R8XA 1W85A 2PQMA 4UARA 1VPDA 3W05A 4CEIB 2Z1NA 3DEKA 2YWBA 3ILVA 3R5KA 1KP3A 1JSZA 4TT8A 2R5FA 4K2AA 4LHZA 1HDYA 2DBVO 4WUVA 3WC4A 4LFAB 1EE9A 2HWXA 2E1RA 2RI1A 4AY5A 1CUEA 5LLDA 1MJGM 4UEOA 2AVNA 2I54A 4M37A 1XZMA 3FHOA 1ZK1A 3ASUA 3N0VA 3DFIA 2I34A 5HVNA 3REQA 3RAFC 1TUIA 1MAVA 2QTRA 3TR0A 3U4GA 3FOCA 2OLJA 1GGJA 1JB1A 4ZYZA 2R8BA 3HJNA 4LE0A 3G2HA 3E7XA 1LK0A 2AT1A 2C88A 4JKIA 2VYQA 3A9UA 1XCGB 3MJDA 4AQ7A 2FQWA 4QZVA 2Y1EA 4HYQA 1BGVA 3M4YA 1DBWA 5JMPA 2R5NA 1TZJA 1JJVA 1ZNXA 3D6VA 4YCBA 1PK8A 2M9MA 3EZGA 3L8ZA 2NT4A 1UPXA 2Q2OA 3OOSA 3ILSA 2D1TA 1DOAA 3OZFA 1X1DA 2H5JA 4RS3A 2QU8A 5AJVB 3JYQA 3PR3A 4L5YA 2Z8YM 1NE7A 1RXIA 3AJAA 2GBLC 5AHRA 1QPZA 1DL5A 3OM0A 3H9EO 3KVYA 1AUPA 3D8BA 4OA8A 1GXSA 2A92A 2R25B 1NKSA 3PS9A 4M1YA 2CW5A 4MJ7A 5I9SA 4URUR 1GQOA 3MJTA 4F4HA 1FUKA 1XQ9A 3WB0A 3FNIA 1KYIA 3E3LA 5KQLA 1O6ZA 3VJRA 3ADDA 2W2VA 4LSMA 4UEQA 2BEUA 1WUYA 3F6SA 4MEJA 3SSNA 1NKTA 2MSKA 4PHGA 2DHRA 1CZLA 3ISVA 4KO1S 2JFVA 2QS9A 2WILA 1GUAA 1Q0ZA 1SC4A 4MYSA 3WK9A 3WSVA 3WSTA 4LJ9A 1RFGE 4AWBA 5AOBA 3B7GA 4NVRA 2O0LA 3SS7X 4EEXA 3EF1A 1I5RA 1NJFA 2A4MA 3ILXA 1ANKA 2PQ2A 2QE6A 3BMNA 3E3AA 3U0BA 4BNIA 5JJBA 1OFGA 1P6UA 2JJYA 4UOQA 2QN6A 2X77A 2XECA 3WNCA 1Q7EA 4J16A 1J5PA 4K6FA 1B6TA 2IXTA 5ELLA 3VOBA 5DYNA 1QHYA 4MW2A 1ZH6A 1K75A 4X3CA 4WLVA 2W2LD 3A6EA 4YAKA 2V7GA 4DV2B 3EUFA 3SJBA 4H1WA 1PR5A 4JT2A 1WW3A 1HPLA 4JBLA 1JW9B 2X8LA 3GJ4A 1JE1A 4TLBA 1OU4A 4ZPXA 2P8SA 1J1UA 4KXQA 1O5TA 3IA7A 3N87A 4LJSA 3WMXA 1ZYUA 3LXXA 3N8KA 2XQIA 4RHEA 3RU3A 4EBBA 2Q8NA 3PT9A 1T9HA 4E21A 4OBXA 4F5YA 1CVIA 2FK8A 4R2HA 3WRVA 1P7PA 4L9RA 2QV7A 2GLXA 4HMPA 5IT9A 3ONWA 4FW8A 1U2TA 3HL4A 2R00A 1XMSA 5K8CA 5C8XA 1E4EB 3JVUA 5EJIA 2QTNA 1ETUA 2I6FA 1D5WA 4V1CA 1YE3A 4BO8A 4D5GA 4IUYA 4TXHA 1DPGA 4OJNA 1C7QA 3Q6NA 3QMWA 3A6HA 4KN8A 3WLHA 5GIOE 2R68A 4KGVA 3RIHA 1IEWA 4M76B 3G2PA 2HJGA 1H4SA 1VSBA 4TQUS 1FY2A 2IOFK 4IP0A 3R3ZA 1RLIA 2PT6A 2XSZA 3ND7A 5ICCA 1W75A 4G2NA 4PIVA 1MU0A 4HUQA 3F5QA 2BDEA 3VSCA 3VSAA 2XMRA 4ZREA 4P4TA 4BWFB 1KGDA 3DL7A 5L6MB 1OYOA 1VMEA 4KQMA 5D1HA 2EJWA 2KBFA 3B1ZA 3SIWA 1RC8A 4UHCA 4ENWA 1M2OB 3IQIX 2PQ6A 2D4HA 3FD8A 1W36D 1VPEA 2PX0A 1SXHA 2O0HA 3O8CA 3WYFA 1XEFA 2VN8A 3D8HA 4LJ8A 4IVPA 4EZIA 1L9XA 3FWKA 5ALZA 4QT4A 1NM5A 1KH1A 4ARUA 1QGUB 4MHOA 1Y4DE 1YCFA 3ZQUA 1XZCA 2B69A 5EKSA 1FMTA 3O92A 3TLYA 5IXJA 3S70A 1N9ZA 1I2BA 1QYCA 5JDIC 1XTJA 3OJFA 3ZV5A 4XQEA 2SECE 5EPUA 1QLHA 2WJAA 7MHTA 4BNTA 2DUJA 3ONNA 2ZRFA 3P2OA 2CLMB 2WD9A 3S28A 1EM8B 1Y4SA 2V6FA 4IS2A 4HEQA 4YCDA 4IG9A 5TARA 4HEHA 3UKOA 2QL5A 3LVFO 2FX3A 3JQEA 1USGA 2XNKA 3KFXA 1MEEA 3NBQA 3OA2A 4KXLA 1GG9A 4IIXA 4BC1A 5HIMA 2YY5A 1M6VB 1OCEA 1LC0A 3FA2A 1RM0A 2FW1A 1HE4A 1XTZA 2IEAA 1EWKA 3OE4A 3PQCA 4UZEA 3QU9A 4YI3A 2K7FA 2D3WA 2FMFA 2RH4A 4D42A 1QKIA 3IUJA 4HZUB 2X9LA 3U7GA 2ATEA 4WI1A 4BCCA 3ZWXA 3V9PA 2CHEA 4YHHB 3TOXA 4D9IA 1WD5A 1NFQA 1Z8FA 4YQFA 2I03A 4DLYA 4KH0A 3A7DA 1SU8A 3VOSA 4YDHB 4EUHA 2FE1A 3LVQE 3O26A 4I2NA 3WIBA 3DTTA 1XK6A 1PW7A 3SF8B 3HABA 1DOHA 1RHRA 1SVWA 4TKVA 1XXLA 1KJYA 3VO1A 1IMOA 5DDIP 5BUQA 1LX6A 1XTTA 2LPMA 3K1AB 3R09A 2QQEA 4ZVTA 5LMNB 3UJ9A 4C20A 4TRRA 2YASA 4CN8A 2VHWA 1R8QA 3UK6A 1DRWA 5CXSA 2BW0A 5D8DA 2Q5JA 5A2GA 4UU0A 5I5GA 3RNLA 2IXBA 4YRJA 2NUAB 2X0RA 3T7AA 1VKNA 2IYVA 5K99A 1HZZC 2YQ4A 3H99A 3I04M 3OT1A 3PSHA 1W1UA 3SFVA 1BSVA 4UM7A 1N6RA 3UWMA 3T52A 2PA3A 5G0SA 4G85A 1IAVA 5LOVF 4ZN6A 2ZIZA 4Z2YA 2FUG6 3DLIA 4HPXB 1NQVA 2PA0A 4PLPA 3PFBA 4AY6A 10MHA 1E5TA 1ZR2A 1Q3HA 2D3TA 2XZPA 4OHFA 5ER9A 4Q66C 4LYGA 2X0EA 2F55A 4Z9FA 1O8CA 4D0SA 4UREA 1A2KC 1KO4A 3MAGA 4ZGBA 3HVHA 3S29A 1CR2A 2B98A 1N2IA 1TMOA 3DW3X 4U02A 1PSWA 2AKYA 4E46A 1KO5A 2BAGA 2KBEA 3R40A 1PNRA 1ZCBA 3L9WA 1XZKA 1HWYA 2GCOB 4KO8A 4X7RA 4G4SO 2HDOA 2UZ4A 4Y2QA 2GBFA 5FUWA 3HDJA 2A9QA 5GGXA 1O6CA 2GPWA 3UKDA 2DBRA 2ZRBA 3L01A 3LFUA 1R0WA 4M0UA 3T4XA 3ZLVA 2QTTA 3H1PA 5LZ7A 3HBFA 5JXIA 1KRXA 4X45A 4H0FA 5C7IO 1AKNA 2IYRA 3TRKA 5KTYA 3F96A 3NGMA 1QZUA 3CLUC 2QSUA 4DBVO 3TLGA 9LDBA 2LIVA 1T9GR 2I1VB 5C5EA 3TTYA 3KYJB 2Q6VA 4DA6A 4EABA 4ZZ0A 1NYTA 2M98A 2OGSA 2ZJ4A 4MPTA 4QWMA 4AI6A 4Q37A 3TBFA 3ZZNA 1CE8A 2Y1WA 2H2FA 2BHLA 2FPOA 3WYCA 2HHJA 4MLDA 4WZBB 4QM6A 2WZQA 2CDRA 2G08A 2ZAGA 3FSEA 3LGXA 2W4MA 4LTNA 1P77A 2A3NA 3W1EA 1U1IA 4X65B 1HYHA 3WLSA 5ANRB 5AK6A 3HMKA 3ZWOA 1DZ3A 2WIAA 1VI2A 5B2ZA 2PMWB 5EYPB 3AG6A 1FYXA 4DIEA 1F2DA 3V2UA 4EY3A 2PZKA 4RGYA 1SVOA 1U7OA 4NS1A 5ER6A 3WWPA 3BCRA 1L7BA 4L0QA 2B5VA 1KAMA 5IUJC 2HMYB 4PNEA 4H7FA 5CG1A 5FRDA 2QMYA 2GNPA 3C3BA 3C39A 1KP2A 5LJLA 4K6GA 1TC2A 3KAPA 3W6ZA 1YUBA 4AJIA 4YUYA 1X8XA 1IVSA 1KIAA 3AUSA 3TLAA 1EM6A 2AC7A 2ZPAA 1JYSA 4FYMA 4K9LA 2BZSA 1OLUA 2IODA 3RS8A 2A5DA 2CZQA 4B32A 4PF1A 2QM8A 2QVZX 3HYNA 2WP0A 4YP7A 1IHDA 3P9YA 2VL7A 4K3VA 2GKSA 1MMFB 2NM0A 3R23A 1JR3A 2JFHA 2BM0A 2C4NA 3LUDA 1G20E 1COWA 4G0QA 3WGLA 5JQGB 5KNCH 1OBVA 1JNXX 3G9UA 1Z18A 5ITZA 1DJOA 1EYZA 4G23A 2VPTA 2JKVA 4LHXA 3USES 1OE0A 1M10A 1RBZA 3GNQA 4JA0A 1P29A 5EEGA 3SVZA 4R71A 5CB4F 1GM5A 2CMKA 1ZBDA 3IRVA 1QIMA 5KWJA 4BVBA 4M0FA 5IJ9B 3MCZA 5JATA 1U90A 4FUQA 2PL9A 1JS1X 3O1IC 3RJMA 2FEXA 2FSVC 3ONDA 3CVWA 4ARIA 3GEBA 5ISMA 2EERA 3NWJA 4RD0A 1DQNA 5KWIA 4GBED 1YB6A 3N53A 4N54A 4NEGA 3U5TA 3UV6A 3DT9A 5FNVB 2OWEA 1CJMA 1QVZA 4RPGA 4QYXA 1SB9A 4HP8A 4U8GA 3U80A 2XBMA 3IDZA 1HKUA 3UO8B 4XGRA 1UWVA 2Q62A 3OLCX 4TLDA 3OAAA 4B71A 4EG4A 2V6JA 4Y9DA 3OICA 4EWLA 4NXNB 2HMAA 3JCZA 4Y2RA 3WYBA 1P73A 2CD7A 5TQ0A 4C3UA 3SEAA 3DTYA 3P2EA 5A5FA 2IYZA 2ZAMA 1N5LA 3KJZA 1WB9A 2XB6A 3AETA 4ZI3A 3LT5A 3WFZA 2BEWB 1SRQA 2WKWA 3RARA 4RQUA 3MEQA 3FLBA 3BJIC 3NOXA 4A16A 2FCAA 5KVQA 4RSMA 1NXTA 1VHTA 2EGGA 4PXAA 5AW4A 4ES6A 2O8BB 2MYPA 4PG8A 3ZNNA 4ZEXA 4M1KA 4BQFA 4I6EA 4YJ2A 1NZDA 3FOBA 3O4VA 3BZBA 1FJ2A 3PLNA 1JL3A 2ODWA 3NNNA 3DL4A 1NR1A 1JF8A 2HF9A 1XA0A 2OVFA 4PVCA 1KJWA 2Z5VA 4TV9F 2L0XA 2RBEA 4L9WA 4FYIA 3EX7C 4E5KA 5LUBA 1RZVA 1YJ8A 1G3UA 1ZY2A 3OQHA 4RL6A 5BXQC 3D7MA 3KDSE 4CEJB 3ZYZA 1A9RA 1PG2A 1L5KA 4ZYUA 1W0JD 4O3MA 3EQ9A 4PBSA 1HQYE 1QF9A 2HHCA 4KTTE 1BCRA 3DHNA 4MJXA 5AM0A 1Q11A 3I6IA 1L5VA 4O33A 4E2FA 3HB9A 1NW9B 2WMNB 4GQBA 5TR9A 4M36A 2X1VA 3DLCA 3EZXA 1V11B 1YRLA 3ELDA 1RPAA 3F3YA 2X8AA 3B2QA 3ICWA 5DNVA 4CF4A 5CNJA 2PS3A 1YJAA 1E2MA 5DF1A 1CT9A 1Y7HA 2PGXA 4PINA 3BDIA 1GD1O 1FXUA 4EJFA 2SBTA 1QNFA 3U6KA 2PLNA 3NIDB 4MR9B 4FFPA 3M5PA 1AY0A 1R8YA 1V8OA 1TJYA 2NW6A 1YMVA 3PGKA 4TL9A 3WNVA 4FM9A 2GJ8A 2FVYA 3KQVA 1AHPA 4WZ6A 3DEIA 3DF9A 4HWSA 1L8AA 3OEYA 1G6OA 3OLWA 3TR6A 4I8IA 4A5OA 1I7PA 3THWB 3GP5A 1OWOA 3OCCA 2CNBA 2NN3C 2WDPA 3O8RA 1DX4A 1QF7A 5AOVA 3MCVA 1NI4B 4J7AA 3ZV6A 1CHNA 4DILA 4L78A 2OXFA 4J7XA 1E9SA 2PZLA 1U0EA 1M54A 3FB1A 2UV8A 3OEWA 1XU9A 4GPEA 4DCJA 2EZ8A 3KEQA 3N2LA 3EVNA 3W4JA 1N6PA 4PQYA 1UBJS 4JQOA 3V8PA 2OAQ1 5BV0A 5IUKC 4BKRA 4HVCA 2O7NA 5AKEA 1NVVR 1ZK2A 1E9EA 3DDWA 1JYEA 4GXQA 4IIUA 1VJTA 2EHJA 5E6UA 5D7NA 4CMHA 2IF2A 1LNQA 3QPAA 2Z2YA 3JXEA 2WUVA 3MWEA 2ZQZA 4PRYA 4X8LA 3ROZA 4QBKA 4G8DA 2BF7A 2QX9A 2LRHA 5KB3A 4AECA 1A27A 1R3UA 4JBIA 1G4HA 3GEMA 3FPFA 1J2TA 2A2ZA 3HUUA 3ZCXA 1IFXA 3O8OB 5ALPA 1N7HA 2FJPA 2WP8J 1XZEA 2AD1A 4G97A 1SXJA 4KHZA 4MZXA 3WKDA 1IY2A 1US8B 1PZHA 1Z0ZA 3NCHA 2H8GA 2AFIE 3FYUA 4MJ3A 3V4VB 3ZZTA 5E8RA 3OIWA 5AI9A 1XNRB 1Q6AA 1NT2A 5DJ5A 3JWHA 4LA4A 1I32A 1KVSA 3DVAB 1NNI1 3C16C 1X1AA 3KB1A 4K86A 4KQCA 4QTXA 4YJFB 5B1HA 3BB3A 4GGOA 2PTGA 2H1FA 1C5KA 4YASA 2XA9A 4ZO9A 3RHTA 3GPLA 3QOFA 3RVOA 1I8TA 4M0CA 1P7CA 3H20A 2Y2VA 3S2UA 3WLPA 2WSBA 4C7KA 4F4CA 3A9VA 2JFNA 3PD0A 2D2FA 2HSGA 4IQFA 4GLJA 4RPKA 4ZDIA 2VDWA 2HA5A 3UK0A 3DPIA 3KR9A 1AOXA 1G9TA 4M88A 4RMGA 3PA8A 1MGPA 4XLLA 1P9LA 1RRKA 1A5SB 1H3NA 2FCRA 3ICVA 4OB6A 4EEKA 3C6BA 3D43A 4LRWA 2OXIA 1DQSA 1ZVVA 4CG1A 3W1WA 1N6KA 4FOPA 1JXOA 1NV9A 3TMKA 1R4MB 1YK0A 2ZRQA 3L6OO 5JSUA 5JWHA 3MLEA 1CJKC 2QRNA 3ORRA 4CKXA 5KTKA 1BE6A 5JRDS 3OZAA 4YJ3B 1KZHA 3G5LA 1RRFA 2JBAB 5E2BA 1E2GA 5GM2A 3BAZA 4TMKA 5C1IA 1RKUA 2WFZA 1UC9A 3HU5A 3NU1A 3KUUA 4N0PA 1Q19A 2ORVA 3D4OA 1OFIA 2JH8A 4NE9A 2DOKA 4EVSA 2GO1A 1ZGJA 1PS0A 3OLYA 3PJDA 2X0FA 5KI6A 2PZAA 1IJKA 1RVV1 1TX4B 5DBOA 3HY4A 3U1BA 2J5BA 4P0TA 1EQUA 5BYBA 4DV3B 5FUBA 5JJIA 1WMFA 3OPQA 2NO1A 2XH8A 3OIGA 2BVNA 4RIEA 3WMEA 2QMQA 1XMIA 4KI7A 4U6QA 4RFSA 4CCYB 4CMCA 4R6XA 2QF7A 1RWOA 2ZXEA 3H8JA 3OAAD 3SNHA 2B34A 4BO5A 5MGNA 3ETGA 1BFKA 2LIPA 1U7ZA 1DKQA 2JFYA 4P9NA 4D82A 2O2HA 3LUGA 4BTLA 3RVLA 1NP6A 2VXOA 3JZDA 4J7UA 3OPXA 4BTEA 2CK3A 4JYMA 2ZS7A 3PI7A 5CR9A 3RAGA 4EO9A 2GTPA 2WVJA 5L3SA 4DGSA 1P0IA 3CLTC 2EG9A 3LPAA 5I45A 4QJ3A 5HM8A 4IYJA 2AN5A 3KTAB 5H4HA 5B4VA 5C35A 1A71A 5HG0A 2YQ5A 1H6AA 1PT9A 1QE5A 3QYPA 3UW1A 5KTMA 2DHEA 2FPXA 3IT1A 3WIUA 1G8GA 4FFSA 1PZXA 4D1YA 3QSYA 1OD6A 3R9XB 1A2OA 1CR1A 2IDZA 3IAEA 3MN1A 2C9DA 4FIZA 4IJKA 5H7XA 3SEZA 4AUKA 2QRJA 3PFWO 5ARDA 1WMEA 2QSJA 1SKQA 4O2AB 2VBIA