3H20A

Crystal structure of primase repb'
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
288
Chain Sequence
RTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKKHTTYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLERRTALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKHEADYIERTVSKVMGLPSVQLARAELARAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein B
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
total genus 99
structure length 288
sequence length 303
ec nomenclature ec 2.7.7.-:
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16793 RepB_primase RepB DNA-primase from phage plasmid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3h20A04
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h20A02
3.30.1490.240 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3h20A01
3H20A 3M1MA 3H25A
chains in the Genus database with same CATH superfamily
1DIKA 3OHBA 1YJVA 1V5IB 1V3SA 4WFBQ 2Y8WA 1E6VB 1FEHA 2R42A 5AT1B 3KHGA 5CYQB 3HFKA 1CEZA 2YQ0A 1UKUA 3VQTA 2F9DA 3MCSA 2KG0A 1L3UA 3BYPA 1XK8A 2HAFA 5DO2A 4USUA 1OWXA 4H4MA 3H4DA 2E1PA 4TYBA 3CPWR 3CCVS 2WVDA 2FGOA 5JQWA 2UUAJ 3U27A 4X4OA 4GO7X 3V6DA 1L5UA 2A2CA 1ZAXA 2M8DB 1EKSA 3DDNA 5IQ6A 1V9OA 1FFGB 2FK1A 4I69A 2ZH5A 2LYVA 2BMBA 1JJ4A 2MKHA 4B08A 3PR5B 2E2HA 3CJ4A 1BY9A 3OXGA 3HOWG 5DZ7A 1TV6A 2WBRA 1ZA1B 2EXUA 2QSWA 3V6HA 2LLZA 3MM6A 4IHJF 2ROEA 2HPUA 2XC9A 1VQ5S 4CM2A 1X4FA 5HVFA 5U47A 1NCLA 2R8HA 4X64H 1NK4A 2B5JB 4DFPA 1LFWA 3DGPA 2V8PA 5KFVA 3VCDA 3TAQA 1C0UB 4LF7F 1KVJA 1R8BA 2W6OA 4ZN1A 2QYGA 1RYSA 4TVAB 1RT1A 5FDLA 5A8WA 3V81A 4L73A 4K4VA 3DRSA 2R6FA 2VQFJ 2NCKL 2HNDB 5T7LB 1KJIA 1G7CB 4M5NA 4USHA 4A3IG 3MUVP 4FF3A 3H2UB 2WYOA 1YJNS 4WBNF 3KUGA 4O4RA 2RB7A 4FYWB 2MGZA 3BULA 5ETSA 3G8SA 4B3RH 2HHTA 3HOUG 3CVZA 2KYZA 5CZXA 2YWHA 1KEKA 1FK9B 3V4SA 1H98A 1RCXB 2M5YA 3ZNJ1 4ZJOA 3Q8VA 1LQ9A 1Q16B 2CQIA 2QA2A 3D6HB 5T41A 2FMME 3TARA 3LPEA 2ZD1B 2QYCA 2HAIA 3KXDA 3P5BP 3HHLD 3R5FA 4WK1A 4ANDA 1WJ9A 3AHPA 3KDNA 3IBWA 1F2GA 3OLAA 4IAJA 1IKWB 1TVRB 4LFBF 4DLEA 5GMDA 3QPIA 3JSMA 2VQEJ 3K5MA 1N33J 5KFDA 2VHGA 4LF8H 2IBOA 1WD6A 1SI9A 5C24B 4KGXB 2CQ4A 4IG0A 2E9TA 2CQDA 4A8KA 3KG1A 1U7LA 2F63A 3HHLB 2DGVA 4O3OA 1UJ5A 3Q8YA 3T9ZA 3CJ5A 1QTNB 3RIZA 1T02A 3VTIA 1SJFA 3S7RA 1YBAA 4FXVA 1KVKA 2NVXA 1XN9A 3M2VA 1FERA 3BGLA 3T19A 3CULA 2AU0A 5EDWA 2CKWA 1X5PA 3TNVA 5BPFA 4JI5H 1J5OB 1GMVA 2AYMA 5FJ8G 3GG1A 2AJ0A 5F8JA 3EM1A 2OSQA 3MMAA 4N8OA 2GIRA 3P5TL 3IMQJ 4U67Q 4QIWE 4DUYJ 1JLEA 5E3QA 4ZVEA 4AYBD 4B9MA 1TK0A 2H5IB 1NK9A 1RT3B 4Q44A 2HNYB 3NEKA 2B6AB 3ENWA 3PYEA 4R0EA 4MIBA 5F3TA 2R7ZA 5F8GA 5KFYA 4I50F 2B7BB 5CQGA 3EZOA 2APOA 1YHQS 1VQ6S 3CD0A 1WHWA 1VFJA 1SFOA 5G0RB 2V5HG 1NSAA 1A7GE 3BBBA 2HBRB 1OWTA 2VPQA 3QGGA 2HFSA 2J7UA 2CNOB 2WRMA 5I3QA 5IM0A 1TUVA 2RRNA 2CJAA 1Y1WG 3KJVA 1S9FA 8RUCA 4MTDA 1O75A 2YL2A 4QJVA 4YY3F 5A2QU 2DR9A 4CO5A 4Q8EA 2H4YB 1NZAA 3ZTSA 3PNIA 2O5DA 1NK5A 5E3PA 3MOZA 4OHZA 4Y28C 1B7FA 3Q2SC 1NBEB 2ATLA 1ELOA 4FPIA 1TWAA 2VODA 2PO4A 3GIIA 1XTZA 2HVQA 1MNEA 2HVDA 1X8DA 2Y0BB 2HFZA 2FPHX 5H1SV 5J2QA 4AD6A 2YBVA 1D8ZA 2CQGA 3RRHA 1MN7A 5L1IA 2XMVA 3CF5Q 2EC0A 4F02A 2IRXA 1UL3A 5D0GA 1UVMA 3GIQA 3A3PB 2WSFC 5KKNB 1REVB 2I8CA 1SH0A 2XSJB 3N8DA 2ZC4A 3OT9A 1WG4A 3FK4A 3GIRA 4J9NA 2J9DA 4PXEA 4DUZH 1RZMA 4X4TA 4X66H 2LXFA 4ED3A 3ZFVA 2RDDA 1S68A 4Y6IA 3DMJB 2ZVSA 2OELA 3IBFB 2FYXA 1Q7LB 4K4TA 1U45A 1KHVA 2YWEA 2VBYA 3K3VA 3UN5A 2JEFA 3PRBA 3R23A 1X4CA 2MJNA 3G6XA 4E98A 1EYZA 3HHEA 1VQLS 4H4OB 5HLFB 4ZDNA 4CTAA 1IBLF 1M0TA 3JS9A 3DOKB 2VD3A 3TVKA 2JJ4D 1YQHA 4UCOA 2PVPA 3MECB 4DHVA 4HI1A 2KFZA 2HYIB 1IQZA 1IKVB 3Q89A 1Q95G 4YEAA 4RUHA 3OSNA 3RR8A 5L1KA 2ZZMA 4MV7A 2LEPA 3SDEA 1S4EA 3OW2R 4ZVGA 4BDPA 4OZ0A 4ZCIA 3QRPA 4Y2MA 3QJPA 2XNQA 1RYRA 4NXNH 1MMDA 3PO2G 2JEJA 3BDPA 2BBEA 4R25A 4G86A 5GONF 4NEZA 3KLIB 2CPZA 1CJKB 3DI6B 3FMBA 4WF9Q 2BXJA 2MQMA 4DSKA 4YHHH 1TL5A 4D3HA 2CPHA 2YX7A 2AYGA 3PKMA 3TQEA 3S1TA 5M2RA 4KY3A 1M6VA 2R2UA 2ZDQA 4TYAA 4M5DB 2QLJB 2AGQA 4DV6H 1RI7A 2F65A 3BZQA 4Y3CA 3LF0A 2W7PA 1E6YB 4Z37A 2HQFA 1QVFR 5ETNA 4OYMA 4LFCF 2GHVC 1EJ7L 5A8KA 3W64A 4FKXA 1RHJB 1NKEA 3HZGA 1MMNA 4HEA9 3LP8A 2QA4G 4QWCA 4MTPA 2CPXA 1UZDA 2AZ3A 3QT8A 1KFDA 1RSCA 2EC2A 2FZGB 3KKFA 3WIVA 1RWXB 1NM2A 2V4QA 1LK5A 5BYQA 3GTOA 1FNOA 1CQJB 2R7VA 3R7SB 1SQEA 3FCWA 1NU4A 1R8AA 4IWXA 3EGWB 4OX6A 4BY1G 3EYZA 2BJ8A 3JB9k 4FYYB 4NMLA 2R9LA 3BV8A 4QR1A 2XCAA 4DU7A 2DT9A 4M5MA 4BLGA 3B4MA 1S6PB 5C25A 4NASA 2UXBH 1VBXA 2HS4A 3CCQS 1HR0J 2ZH8A 3ORQA 4HACB 5A76A 2FB0A 1R9TA 3E5NA 4O4LF 4FBTA 2HVIA 1TL4A 1E4FT 2J7WA 3CQZA 4KE5A 1SC6A 2FE3A 4MA5A 3NNAA 3IR5B 2DCUB 3PYDA 3JAMW 2FHKA 3T1YH 2YPZA 4HHHA 2DNZA 3QGIA 3RB3A 5ADZA 2ZHOA 2YKQA 4LSAA 1S59A 4LQ9A 4LFAH 5KFNA 2AJFE 1M5PC 1HWKA 1U6FA 2W2PP 4FXWA 3Q0AA 5IP9G 4YB8B 5LL6b 2HHSA 4DX5A 1EP4A 2FLOA 2FVRA 3BN7A 4G3IA 2GQCA 5RUBA 3GTKA 3EVMA 3DF7A 3M1MA 2XO7A 2SXLA 1SUQB 2IJNA 2ZH1A 2R2SA 3RB0A 2D1CA 4DPYA 2RHQB 2PGCA 3UCUP 3GTLA 5LL6d 2MHEA 2HGNA 3NLCA 4PG5A 5EGYA 1KONA 1ZHQA 2C3PA 1TL3A 2DGXA 1TR0A 4J9MA 3W5XA 1V6HA 5D15A 4WP9A 3RR7A 1VRTA 3IRXA 1T9YA 1KEEA 1UA0A 2YKMA 1U8WA 6FDRA 3E8OA 2OLWA 2H9ZA 3FDSA 4ECXA 3OTOF 4Y65A 1SC1B 3JSYA 1T9WA 1B99A 3DHXA 3RBZA 1RJPA 3BO4A 5GADI 2YH0A 4ZJLA 3MD1A 3M8PB 2AJQA 4X2BA 4A3CG 2C3OA 3OVAA 1S1WA 1NO8A 2J6SA 5AJ3J 2LDYA 1QY7A 1JLAB 1PJ6A 4MK7A 1S1UB 1HA1A 4K4UA 5DZ6A 1L2ZA 2V6AA 2B4PA 1QLNA 3RV4A 5DRKA 4ELTA 2WAQD 2W4CA 1RTDB 3HKZE 5IYDG 2GS8A 2DR5A 2M88A 1R43A 1UWBA 2HHHF 2YKAA 4YDDB 4JI4F 4KO0A 4J91A 1S1XB 3MZIA 4DCPB 4X65J 4NI2A 3PHEA 2B43A 4YS2A 1S9GB 2V2QA 3C15B 1PYTA 3RB4A 3KLEA 2Q2UA 3BQ1A 3CDUA 4YBZB 4OX9F 2HFVA 3GMGA 4ALZA 2FHMA 2QMXA 4QIWA 1RHKB 2DJWA 1UW9A 2RMLA 4HHJA 1GAOA 3KK1A 2CPIA 3DOMB 2R93A 2R87A 4A3KG 3EZUA 4NL5A 1WI6A 3TZWA 4H4KA 2DNHA 1HW9A 5AE3A 5I42B 2UXCJ 5KT5A 3SCJE 5B0FA 1N32J 3CWJA 5LM7E 1VLOA 1HNWJ 5E33A 2XMMA 1P9YA 3WX8A 1N34J 4N77A 4DL0C 3QZ8A 3DLGB 3PDNA 2UXDF 1YRUA 4EYHB 1UZHA 3H4BA 3CIMA 1SCJB 2MKSA 3VWSA 1SL0A 3HLUA 5CYJA 1QJHA 3I5AA 4EGJA 2JFDA 3T6JA 4A8XA 4GVBB 1ZAVA 2AT1B 4FYXB 2MQNA 3BF4A 4LSNA 4A48A 4DV1F 3KMQA 3PX0A 3LP2A 2YNHB 3MMBB 5DS7A 1UJ4A 2YH1A 3UCGA 4DSLA 5K8PA 5HL7Q 4WYWA 3PXGa 2Y0SA 2Y8YA 5CHCB 1VQKS 1SJQA 3WC0A 5EHHA 2FDNA 4B3OB 2VKZG 1NB7A 2NSBA 2MSTA 3PW7A 3K0JA 4QIFA 4TLQA 1F3VA 3JSBA 1U47A 4DI6A 4V1Ak 2K8GA 4DR7H 3TINA 3M1VB 4C5AA 4HL9A 4JI3J 3HSDA 4JYAF 1F0XA 3M8WA 1CULA 3GTMA 3AD7C 4NA1A 4GKKF 3HMJG 1PAEX 1GGOA 4PAAA 4IZOA 1M1KT 2AV5A 3W8GA 2QLXA 4LFBH 4JI2J 3K2YA 3BKUA 2VG5B 1Z1ZA 3MPYA 3GLKA 3JAMU 3HOYG 2CQYA 4LH7A 4EG0A 3DU5A 1VMBA 3AB2B 1R8JA 2LP4A 2OKQA 5DM7Q 3P49B 5KG4A 2JFKA 1NK7A 4C5BA 2B9XA 2BJEA 4GO5X 4HVZA 3T41A 5CCLA 2WVFA 4ICLA 5HO4A 1KC7A 3ISZA 3HPOA 3PO4A 1VQ9S 5HQMA 4PYAA 4RB3C 2AJ2A 2AYEA 4DCJB 5L8RC 4EZ6A 4S0MA 3PEHA 3EE3A 1Y1VA 3IGVA 4A2BA 1F6TA 1YJUA 2RF2A 4Y2IA 1AYEA 4IO9Q 3NMAA 3K5IA 3VZHA 1QAIA 3U1LA 4DR2J 2LEBA 3TJAA 3VPBA 2Y1JA 2OPRB 3R2CJ 4BS2A 4K4WA 3UQSA 1QUPA 5CYQA 4NRTA 3B82A 3PCOB 2F8EX 5K8MA 3M2UB 2QX0A 1R8CA 4Q0BB 1LWFB 4B3RJ 4QU7A 4USVA 4FDFA 2YPYA 1YK9A 1SEIA 1VS0A 4TU7A 1NXIA 3FKBA 3NRBA 5LMUF 3KLFB 1CJVA 3T5LA 5CAAA 2G2YA 4N5SA 1LW0B 3K89A 1TWCA 1PCAA 4YY3H 4KV8B 4CP5A 3TWZA 4MV3A 4U6PA 4KHPH 3HOVG 3G71S 1CQIB 3OR2B 3E01B 1HBUA 2PSZA 1P8GA 1FDBA 1W53A 4UOGA 4RNNA 3UFXB 1T05B 2J8SA 3F8NA 4KBIA 2HGLA 4USTA 1HPZB 2GIQA 4O3RA 4DQPA 2A6MA 5C5JA 4K4XA 4AXJA 3J80Y 3MTJA 5GAHI 2I87A 3D54A 3MI7X 4QU6A 4YUDA 2HKEA 2DNYA 1A9NB 1FWKA 1RAAB 1M5SA 4LF5J 2G2ZA 2B5JA 3AY0A 4CYUA 1WOSA 4DV0J 2D9OA 1C0UA 3ENVA 1DHMA 2VDIA 1RHRB 3MEDA 1Z2PX 3HVWA 2O67A 4I64A 2HNDA 5T7LA 5D6GA 5JJBA 1U2RA 4IOBA 3R7BB 4UUXA 3V4ZA 3F41A 1XWLA 5B0AA 3AXMA 4PZVA 3MM7B 3Q22A 1NHKL 2HGSA 1NJXA 2R7LA 1N33F 1U0HA 3RBEA 2UU9F 1AUXA 4I55F 1VRUA 4DV5F 4P74A 2XLKA 1LV5A 4RU2A 4Q43A 1NPPA 4Q2MA 3UFCX 2BJ3A 2YNGB 1VQMS 2LXIA 1FK9A 2LXUA 2DXDA 4JI6J 1PG5B 3M8ZA 3MDFA 1RWNB 1CJTA 3A8KA 1O51A 5L39A 3CSKA 2HEKA 3IM8A 4ZVFA 2XG8A 2XMJA 4ED7A 1ZZFA 3BSNA 2ZD1A 3HM9A 3NWGA 3L4JA 1IBLH 2EFNA 5C8DA 2RE1A 3GLJA 2KRRA 4O2AF 1TVRA 2I2YA 3BREA 2NREA 5LYJF 1NHUA 1NSQA 4KKOB 3WHPA 3I5BA 3FKIG 4DMZA 3G6ES 1KHWA 2K3IA 2G0JA 5C24A 4PEOA 3C6UB 2J9GA 4UUWA 1CC7A 3HHLA 1AA1B 1C3OA 5A2QY 3OVSA 4B9VA 1YBTA 2G1DA 2UUWA 1N5QA 2E66A 4QYRA 2X1BA 2AX0A 1UZ3A 2MPUA 5HJYA 4I56A 1VAJA 1X60A 1J5OA 1X5SA 2KT2A 4YP3A 1SVDA 1HMVB 3C3LA 1RT3A 4ECTA 2GO9A 2CJBA 3ENAA 1PYOB 4QW9A 2B6AA 3NGDA 4J9VA 3HKZD 4CO1A 2BKNA 1S0VA 4ZPAA 4DUZJ 4X66J 2IDLA 1RABB 1H2VZ 9ATCB 4ZOLF 3B78A 2DTJA 5G0RA 5T14A 2DNGA 3GV7B 4ANCA 2NXNA 3HKWA 3SI8A 3Q8RB 1JJHA 1RA7A 4M5JA 3SCKE 3NKYA 2ALYB 3FQKA 2Q1LA 3CVKA 1WC4A 2OUGA 5KFGA 4Y2CA 3LP0A 2CG4A 4G6VB 1KD1T 4X4VA 3BSCA 2AGPA 2M8HA 2ZH9A 2FLNA 3ZZUA 1S0OA 2MZJA 4LUBA 1JLBB 1CJUA 4NZ7A 4M1KA 3RAMA 1T95A 3K8WA 4DR3H 1X5OA 2NUHA 1Y7PA 4J9PA 2ZE2A 1WEXA 1IR1A 1JIHA 2DH7A 1I94J 3ILIA 2KI2A 1VBYA 1NPRA 3UNGC 4FPRA 3H0GA 1MG7A 4OZ5A 1WI8A 2DHSA 4EFEA 3A13A 3KDOA 2BOAA 2AYBA 1T36A 1T03B 1GEHA 5H9EK 2EPIA 4CH0S 2J9CA 4KGMA 3RUBL 3TUJC 4E0DA 1HNXH 5F9LA 1FRJA 1S1VB 1JKHA 3SCLE 1K73T 2ACYA 4WU3A 4C4WA 1JLFA 2VASA 1L3VA 3R7NB 1RTIB 2E5IA 1PX2A 3Q8SB 3E3XA 4DXLA 5C1OA 3SV3A 2YKPA 4OYZA 1X4AA 3UD3P 1FXRA 1PIEA 3RZAA 2K7KA 2OLSA 1IM4A 3UDEA 3CJ2A 4KPCA 2BEFA 3M4IA 5L46A 1OMSA 3J7AK 5KFJA 4EO8A 3MGJA 5FLXY 4RB1A 4OYXA 2J5AA 2BQ3A 2FHJD 3KJNB 2GVZB 1XNRF 3NNHA 2E1RA 1CG2A 4MV6A 3H0PA 4DZDA 1TQLA 2RIJA 3N44B 2QT7A 1RE1B 2WONB 1GFWB 4OV6A 4H4OA 5F8HA 5HLFA 1RU1A 3CJSA 2I6WA 3DOKA 2VICA 2EG1A 1T9TA 4LF4J 5CD4H 4RL1A 3R5AA 5IP7G 5LXYA 1N52B 3IG1B 2CJKA 2PA8D 2HVSA 4RZQA 1DTQA 4UOHA 2MHNA 3QJLA 4CT8A 3SSSA 2ABYA 4HR7A 4DV4J 1HQUB 4IFYA 1G4CA 3FSYA 2WOMB 3R2DJ 3F0NA 4PWQA 1Q53A 1FNMA 3U9SA 3CD6S 2FJDB 1X9SA 3IWLA 1AXQA 1PAUB 4RB2C 4OX9H 1WACA 4LFAJ 4M5DA 1XQIA 2VG6A 1S97A 2ZC3A 2G2OA 2EI5A 4IUFA 3CCUS 4KRWA 3V6JA 3RRKA 1JQGA 2FLPA 3FEYB 1AFJA 1B0VA 2YCHA 3LGHA 4Z2XA 4F3MA 5KFKA 4MAKA 2ZUAA 4W92B 4Q0YA 3HSGA 1YIJS 3ICLA 4MKAA 4FM9A 1F2HA 5HN0A 4DR4J 3IXQA 1UVNA 5KG0A 3CTRA 2UXDH 1UVJA 3HZEA 1FX2A 4UY8T 1S6QB 2W4PA 5KG5A 1VC6A 1XR5A 1HWJA 3QLHA 2MZ1A 1S76D 4U95A 2CNNB 2QZ8A 3J7ZT 3J7A1 2W1BA 4X62J 4DV1H 2J8AA 5IT9U 2CVIA 3GJSB 2KZZA 2GW8A 3W3SA 2RUSA 1D1UA 4M5KA 4DV3F 3OVBA 2I5JB 3BB5A 5HQLA 1HD1A 3I0RB 4I68A 4HACA 4KHRA 5G4DA 1K47A 5CZVA 2JL9A 4OZ1A 2VB6A 2DGUA 4F67A 2ZBIA 1OYDA 3ZXWA 2AJ1A 3OL8A 4JYAH 3KXYT 2H48B 5GAEI 2HHPA 2OFHX 4JV5F 3ZTQA 3T9NA 2ZVIA 2W6NA 1RDRA 3RGXA 3GQCA 1R27B 4MKVA 2OTLS 1RT4B 1ZHSA 1I5OB 2XYPB 3QGPA 4FP9A 3TR5A 1TKXA 4NLRA 1FKPB 4ERDA 4ECUA 2AQ4A 3N41B 4LJMA 5E3CA 5KFAA 4ZVTB 4U96A 4OI1A 3JRXA 2UUCF 4EWTA 4WKYA 4MV1A 5B0CA 1WG1A 4A8MP 3R1HA 2B63A 5KFZA 3A8EA 1IOWA 3PRDA 1WOOA 4U7UD 1B4SA 2FVPA 2UUAH 2YZMA 2Q66A 4LF7J 5KT3A 2PDAA 4NCGB 1N6QB 4WU2A 1APSA 3SV4A 1OPIA 4O4GA 4ED4A 4WP3A 1FKOA 2A1BA 3RF2A 3QIPB 1GLVA 1GSOA 4MTEA 3ULHA 2OD4A 3OQ2A 5LMNF 2I80A 7FDRA 3H2VE 3M8PA 4EYIB 3HSZA 3TYTA 5LSRA 4PQUB 1JLAA 1N48A 3UNYA 1O8BA 1S1UA 2XULA 5J1NA 3RFCA 4EUVA 2W57A 2V8DA 4OMFG 1X9MA 5I3PA 3QT5A 3ZTOA 2V2KA 4HNTA 4OJ1A 4CH1A 5KG2A 5F8LA 5BR8F 2O66A 3C6TA 1JXLA 4IOAQ 3TA0A 2MXYA 3MPWA 2AWZA 3V4IA 2CDQA 3TVYA 2KFNA 3EX7B 2VUGA 1FJ7A 4K5SA 3D67A 1VBKA 3N79A 4UCSA 4ZITA 1XMQJ 4ECWA 3ADAC 4ZHRA 2NU8B 2WAQA 1JDEA 1U24A 1W96A 4ZP7A 4I0WA 1Y4ZB 4MKYA 2ZH6A 4LFBJ 3A8IA 4WD3A 1TAEA 3QQCD 4WFNQ 2JLFA 1B6RA 4DL5A 4URSA 2RNEA 2BE2B 5A0YB 1AFIA 4F36A 1FJGJ 4J9KA 1TKTA 1C30A 3ETMA 4MT1A 3BGFA 4LRAA 3F73A 2W4DA 2DXFA 4BWJA 2CQHA 4YB1P 3LGNA 5F8MA 2X1GA 4JI3F 2MZTA 1FO1A 2WHOA 3KLHA 3VPCA 2KJWA 1O6XA 2CVEA 3DLGA 2C3MA 2G9OA 2YX1A 2CFXA 1KN6A 2V50A 4YN3B 5DM6Q 3PW4A 3HJFA 4L76A 3OFGA 1VQ7S 1M5OC 2VJVA 4BBYA 5DDOC 5KFUA 1WCMG 4GVBA 2YNFA 2EBEA 2IRYA 4LT6A 2YNHA 3MMBA 3OLBA 5JVDF 2LU2A 4NLWA 1N33H 1RTHA 4M7EA 3NGTA 1NK6A 5KFFA 4B3OA 2VOOA 4X4SA 4LVOP 3W60A 3KJQB 2VPXB 5D0RA 5LOQA 1SJ4P 4QZVB 2HW3A 1YDLA 3O5TB 1U1PA 1NJWA 2W24A 4MK9A 1S03G 3DC2A 4P2XA 4OZ2A 4Y0FA 4TUYF 4OZNA 2VU5A 1UFKA 4DFJA 2MQPA 1EB0A 2VFSA 3GFXA 2A2DA 2OJ3A 1VK8A 3HOZG 2LMIA 2L9NA 1F60B 1U1OA 4OIXA 4YY3J 3AJ1A 2Q3PA 3CJ0A 4C98A 1W2BR 4DUYH 2CPYA 2VFVA 1RT5B 2HMIB 3FEXB 1S1TB 4OJHA 4ECSA 4IRCA 3VAIA 4DR2F 2KHCA 3D0HE 2FGCA 1ROFA 1VHIA 2HLTA 1D0EA 5CXTA 5J2MB 2BE7D 2EVZA 3BGRB 4OFZA 1SV5A 4CO3A 1FD2A 1S10A 2HHUA 2JH3A 2MDAA 2RF4A 2CQPA 2VONA 2JRSA 2VJUA 2EKNA 1NSPA 1ZZNA 4UT4A 3SYZA 2Z2ZA 3SQGA 2PEHA 1H2TZ 2MY7A 3M32A 4GLXA 2B63G 5C8YF 2M0GB 1RK5A 2YWKA 3NS7B 3MMCA 1NH8A 3OFFA 4C9DA 4PYDA 1GYFA 2DNKA 1W25A 1QE1A 2LA6A 3ILJA 3FBBA 2BANB 2D3ZA 2VA2A 2UV8G 2DB1A 2W6ZA 2MKJA 4HHUA 2I0XA 3BSOA 1YSJA 2LQJA 2LQ5A 4TNOA 3FCHA 4KYZA 2DH8A 2DGSA 4CIOA 3AT1B 3FC9A 2UP1A 3M2UA 3KK2B 4C8ZA 2IRUA 2UZAA 2XSFA 1C1CB 2K1RA 1GO3E 3GCWP 2XLIA 3U9TA 3QGHA 2XS5A 5M2UA 4LF5F 2UVUA 2WTFA 1VRQC 2Y1RI 1F9EB 2XBPA 2KZMA 3CCES 2EFVA 1LW0A 1Q4RA 5KFMA 2R85A 3JQMA 4D3GA 3U1NA 3V4MA 4GKJF 5E7OB 3NGSA 4B3MF 5ETQA 3M30A 2VOBA 2ZJRQ 1IBLJ 1SUYA 3QZ7A 3I0SA 3OR2A 1IKXA 3E01A 2M52A 2QO3A 1VQPS 3QFWA 4BHQA 1T05A 1YG0A 1C2PA 1XNQJ 5KFCA 1RAJA 3AA8A 3EVOA 1NNDA 3OTDA 2HFUA 3VGVA 2C28A 2KTQA 3GTGA 1HARA 1MROB 1AUVA 4JI6F 3NS6A 4ECQA 1NJZA 4K5RA 3A8JA 1YTYA 2XM3A 1TUGB 2P0AA 1FRIA 1EQ0A 4OYAA 2FZKB 2OI2A 3TUPA 5KFXA 4ZPBA 2NVYA 3CC7S 1HNZF 1PKUA 2HRYA 1NSKL 2RS2A 1OIAA 2H4WB 3PR4A 1RT6A 4A47A 4PCQA 3RGIA 1WHXA 3W66A 1VQOS 3MM7A 2FUG9 2YRXA 2VZ9A 2ADBA 4K0KF 3W8PA 1WC1A 1FWLA 5GMKa 2CJYB 4PWDB 3WIUA 4O3NA 2HBZB 4OZLA 4R5PA 1K8AT 2PI4A 2YNGA 1TP7A 4LFCJ 8AT1B 2O3DA 3DDKA 2GV1A 2DISA 2R4FA 1QTEA 3IS9B 1XNRH 2XD4A 3AJDA 5FD6A 5IC4B 5GAHU 5DQGA 2FMAA 5DG9A 5B0DA 3NWRA 3J7AN 3B4DA 3C16A 1BMTA 1ZTWA 3PN1A 5DQHA 3MPVA 3C2PA 3PTWA 1PILA 3QMQA 3UVJB 4KKOA 2WB1E 3RBDA 3THVA 2H5EA 5H9EJ 3C6UA 4EEQA 1HBNB 2D3UA 3MPUB 1UA1A 1RWWB 3T1HF 4XDCA 2MZRA 4F7VA 1I7LA 3AXKA 1RU2A 4YAKB 1LWXA 1RWPB 1NZ8A 1ZM4A 3TEHB 3IBCB 1JNRB 2OPQB 4E8UA 4QWDA 4UCUA 1JLGB 4J7CA 4IH6A 4DV2F 4U8VA 2V59A 3MUMP 4DG1B 1NHVA 2V34A 2RQKA 4NLXA 2GAGC 3TA1A 1RQ0A 1VGYA 5ETOA 1DAXA 2O01C 4NMXA 4ECRA 1HIYA 1RAEB 4NLPA 1EETA 4UTGA 2KSWA 3H5UA 4X4QA 4CI0B 1S9EA 1UEVA 2MQOA 1CS4A 3HI9A 3PW0A 2CZ4A 1SL2A 1TKZA 5H9FK 2R7RA 1RCOB 4O0IA 2DZDA 3CJKA 3VAGA 4IR9A 2E5HA 4ETXA 2AX1A 3KK3A 3CMQA 2EK1A 4DFMA 4RAYA 4U7UK 4O44B 3PEJA 5KFQA 2HHVA 4ME6A 1FCAA 4DX6A 3HHKA 4YB6A 1CSJA 3MHYA 2DVIA 4BC9A 4UOFA 2HZCA 2ZHBA 3FBCA 2X3DA 4CM0A 1K9MT 2QA1A 2YNIB 3NCRA 5KG1A 1SH2A 4C11B 2MKKA 5D8DA 2MJUA 1PYSB 4KAIA 4PKDB 4RR5A 2VDHA 3OTOJ 3EJMA 1UNNC 1SL1A 3QAEA 1RHQB 2KG1A 5EOYA 4C3LA 5IZHA 3CC4S 3NCQA 2IP4A 4DV3H 1P9QC 5C7PA 3BKTA 4UOCA 4B9SA 2I8EA 4WZMA 4LF2A 4Q2LA 1K1QA 2ZM6F 2ASJA 3W65A 5JXSA 2XGPA 4UQTA 4FS1A 1SV1A 5HQ8A 3MPDA 3DLJA 2VG7B 4IQXA 3Q1KA 3K59A 3C14B 1FVSA 3H2LA 1TL1B 2RQMA 4ELVA 1EZ1A 2FVQA 4JV5H 4LSLB 3DHWC 5HP1B 1LWCA 2HHHJ 4LF6F 3K17A 4JI4J 1SBRA 3HX9A 1S1VA 3D0IE 1LWEA 1AROP 4CC6A 2EEYA 4DX7A 5BYSA 2J9DE 3MJFA 4OX9J 2XMWA 2DNOA 2C2EA 4IFVB 4DJBA 4JOUA 2OSRA 3KALA 1N54B 4ZS6A 1DARA 5IWAF 4LREA 4EFBA 2IM2A 2IMWP 3J80W 2N4CA 2JX2A 2YS6A 1WTFA 1TAUA 4RX6A 3LWMA 2MZQA 1DLOB 2GAHC 3JYTB 2WONA 3SFGA 5K20B 1PJ7A 5E41A 1FFSB 4X65H 3MEEB 1IQTA 3KG0A 1C4AA 3Q8PB 3CD7A 4FF2A 2HIYA 1GMWD 4CLFA 2DO0A 5LSOA 4Z7CA 1Z2ZA 2O1PA 1UAWA 1BQNA 5CABA 2MKCA 1ZOTA 3IG1A 1FKAH 1KLMB 2AJ4A 4AT1B 2C1EB 3O6QA 3TI0A 4Y8VB 1X31C 1FRHA 5CYMA 2UVVA 5BR8H 5HMZA 4KH1B 3CJTA 2WOMA 1MU2B 5IT9Y 2UXCH 1MLAA 3P4UB 1N32H 3L7UA 1KOOA 1HNWH 1H6KX 1JJCB 2L41A 1FDNA 5D77A 4JYAJ 2AF6A 4C8LA 1PK8A 4DR4F 3GTYX 1NRKA 2YQ1A 3H98A 1XDNA 2JA7G 4FF4A 2ZHAA 3HVRA 4OHXA 1U4BA 1NPKA 1GSHA 4TQSA 3QT7A 5IC6B 1GXTA 4GKKJ 2VFTA 1OJ4A 1FWPA 3FCVA 4MV9A 1REGX 4FZVA 2V94A 2WE6A 4F4WA 4WIIA 3MM5B 1E4EA 4DPWA 2X3GA 1SC3B 1SKWA 5KX5F 1ULRA 3IM9A 4TY8B 4KGKA 3PX6A 4WZQA 2E2IA 1IR0A 1Z2LA 3NOGA 4LBHA 3AQPA 5A2QW 1WR2A 2F7VA 1OO0B 1Y1WA 4KC5A 4JI3H 2WSEC 3L3CA 4A4JA 2W6MA 4USWA 3GJRB 4H4MB 5MAOA 2R7OA 2ZZTA 4HKQA 2GVDA 3RJMB 3N5FA 3C66A 2XS7A 3CDWA 1KQGB 4NX9A 3R5CA 2H5JB 3TRGA 4EO6A 1KC8T 3HO1A 3AYHB 1WWHA 1T3NA 4JI2H 5DG7A 3N28A 4ZCLA 4LMYA 2ZUGA 2XLJA 3GFZA 1T9XA 2O03A 3I0RA 4L6V3 1TV6B 4R8UB 5HMXA 3GWCA 3ILOA 5HAOA 2DLNA 3IRWP 3EPGA 5HSPA 4LSZB 4NPOA 3MM6B 3QRQA 2LCWA 4LBIA 4NLDA 1X4DA 4EGLA 3JQKA 4J0MA 5DDPC 3GV5B 1DQ9A 5LMUJ 4AQYF 1RADB 3TJ9A 1CE8A 4HNUA 2YRWA 4DL4A 2C2NA 4PABA 1R89A 3LANA 1JB0C 4CH7A 4MIAA 2NZCA 4I6WA 5FDLB 1IKYB 1FKPA 4DR2H 4KGZB 4OYIA 4YAJB 3GFHA 1R0AA 4DFKA 1S49A 1S0MA 1Q78A 3HHNB 3RV3A 5KG6A 1R8HA 1BQMA 4NA2A 1TAQA 5BXIA 1DGSA 3MR7A 4TLRA 1BQXA 3D6MB 4C8YA 3A12A 4B02A 3OTBA 2BABA 3ETJA 5DDRC 4USMA 4ZP8A 3ETOA 4RBVA 2POKA 1U09A 4NCGA 3AJ2A 3N01A 2JWNA 3RG6A 1N88A 3EZ5A 3HVTB 1XMQF 3WO0A 4NCBA 3J80U 1YZ7A 1L3TA 4USKA 3QIPA 1YI2S 4JI0J 2KYXA 2LQBA 5GAEU 2WB4A 1HL6A 1N0VC 1A9XA 3M2RB 2CDRB 1Q8LA 4CRJA 2ZH4A 1NB2A 1UVLA 1UTUA 2DNQA 3MXHP 2WB1A 1WELA 3JSMB 4O3SA 1SKUB 2P2CB 2UU9J 2DNRA 3DLBA 4DV5J 2R86A 2DEJA 3EICA 1WC3A 1FJGF 2U2FA 4IG0B 4RNMA 2QLFB 4LF9F 3O8WA 4JV1A 1V3RA 4LF5H 2XWXA 3CMAS 2I2XB 3D66A 1DURA 2M9KA 4OJ3A 3LAMA 1CPZA 4DV0H 5FLXW 4QWEA 2BQRA 2N3OA 4MYUA 4CLSA 1JXEA 1NUEA 1QSYA 1GX6A 3H5XA 2W9BA 1AUSL 3M2VB 1WHVA 2JZ5A 2BJDA 2AIRB 4IG3B 2BYCA 3VR1A 4CC5A 5IXUA 4DQIA 4DQQA 3TX0A 3VVTA 1N36F 3N6XA 3MMAB 4DR6J 4DV7J 4PXBA 5J2PB 3MM9A 3BGUA 3I32A 1RXOB 2VOPA 5A0YA 2UUTA 4DR5F 3OR1B 3DRPA 1ACMB 4J9UE 3IP0A 1TMMA 3IWNC 1PC5A 1BJTA 1WUUA 4JI6H 2LA4A 2MQQA 5D0EA 3MF5A 3RGZA 4FKYA 1FJCA 2V69A 5A8RA 3Q8QB 1P1TA 5KG3A 3ZTRA 3DLLQ 4ES1A 4LF1A 3DLKA 3DM2B 1C0TB 1HNZH 1G2EA 5HVHA 4EBDA 1D09B 1TFWA 3R1LA 4FXDA 2AW0A 1SIWB 2WW8A 3OTCA 5KT7A 4ILRA 3TOQA 4BWMA 5C5EA 2EG2A 2FY1A 3QIDA 1Y00A 2IPOB 1HI0P 4WJBA 2Y0SE 2C3YA 2LQ8A 2YYAA 4L75A 1I6JA 4RNFA 4KPYA 1MZBA 3Q2OA 4YDXA 4FYDA 2E1AA 2PMHA 4DBQA 3P45B 1T11A 3OL9A 1ZM9A 3W2WB 3EDRB 3KNAA 4O4HF 1XMBA 4Y2AA 2W9CA 2D69A 3D3BJ 2XI2A 1RHMB 5HATA 7FD1A 2R92G 1RHUB 2LKZA 4FYVB 4X64F 2HK3A 3UR3C 3K5OA 2VC1A 1IOVA 4Y00A 4C8NA 2JA5G 1HI1A 2DNMA 3D28A 3MFIA 2K06A 1I6UA 4UF4A 1XBWA 3BR8A 4YJ2F 3H8YA 4A8SA 3A3NB 2CJQA 1OSCA 2ZNYA 1AZSA 4ED8A 3MM8B 2YWGA 2XZTB 2BX6A 3QFFA 2QYZA 1Q1KA 3M8QB 4P7VA 3OUYB 4ECYA 2BM1A 3MEGB 2BW2A 3OBIA 3T1HH 3W7BA 1U1QA 5J2MA 5KG7A 2W01A 3HDSA 3BGRA 2J6UA 5J1PA 4A8WA 3I4PA 2R7MA 2PMZA 2FPIB 2QFJA 3VGSA 3R9LA 1SJ3P 4F4AA 2R2RA 2VC0A 2P6TA 3I31A 4WBFA 2EFGA 4RW7B 1ZAWA 4YB5A 3BAAA 4ZCMA 2J7KA 1R6YA 4ZN3A 2DPIA 1O5JA 2ZDGA 2L3MA 1RLCL 3MMJA 3ORRA 5ETKA 1NK8A 1XMOJ 1SB6A 1JKJB 4L1KA 3RTVA 1S6UA 4RW9A 1XNQF 1NDPA 3SE7A 4C97A 1I94H 4LF8F 2Y1LB 1VYAA 2CQ0A 2HS3A 2CKZB 1LOUA 5BJRA 3SDEB 2RDIA 2QL7B 2BKOA 2KHDA 4URGA 3B8HA 1VJWA 2FK2A 2OPPA 4P6QA 4XAKA 1VQNS 4TY9A 5HMWA 2OHDA 3CIZA 1XNRJ 2KVIA 1PJ5A 4PG7A 2DHXA 2DYAA 4DL2A 4MMOA 2MLZA 3O2IA 4ZLNA 3TUIC 3FFIB 4V19X 3G82A 2YW2A 2CWXA 3SMZA 2ZWPA 2BM0A 4G65A 1FHTA 3CCJS 2CG8A 4J37A 2QLBB 5FLXU 3ZTPA 4K59A 2RRAA 2FIUA 4UQGA 4JI8J 5D8HB 3AODA 1LNQA 5JH7F 2ZM6H 5SUHA 4NLYA 2V8HA 2AP6A 4OHVA 4M8LA 1KTQA 2Q79A 5K9FA 5KFSA 5B0BA 3G96A 1V51A 1NH7A 5LT5A 2Z58B 3LWBA 5A8KB 1LFPA 2RS8A 1PC4A 2XZWA 2H3EB 4ES3A 5J2UF 3LQVA 4CLUA 1BC6A 4LF6H 2L48A 3H7HB 1AW0A 1WC0A 1RBOB 4K2XA 3MAHA 1I7NA 4DQRA 3L95X 5JVGQ 3T1AA 4NCAA 1QAYA 1OS5A 4LF4H 3R3TA 4LRCA 3Q24A 3X3UA 4EEYA 4RJVA 2BOPA 4NLQA 4BBRG 1MN9A 3THPA 5F8IA 2HWTA 3OHAA 3DRXA 4PWDA 1IVZA 2PA3A 2XEXA 3OXFA 1FDAA 1IBMJ 4IDKA 4DV4H 4XPCA 3Q2TC 3C46A 1F9HA 2ASYA 2IA6A 1RBLA 2COLA 5F0WA 3KTMA 3IS9A 2F4VF 2EKYA 2HQGA 1KBRA 2M4MA 5KAKA 3OUZA 1TKDA 2HBQB 2CWKA 3GP9A 3ZZTA 4DLGA 1X5TA 3D68A 1EQMA 1U1MA 3F56A 5GAGU 4GVLA 1X4EA 3L2PA 1KJ8A 1HWLA 4ITSA 4XDDA 3IA0A 2CPJA 4PDBA 3O44A 1HBNA 2ASDA 1JX4A 1EP4B 1TL7A 2UVWA 2ZH2A 4JB8B 2CW7A 2FTRA 4DV3J 1T94A 4QR2A 5D78A 2LQ9A 2KT3A 2HGMA 3BO2A 1CLFA 2RSQA 2I38A 3CCZA 1VBGA 2GGPA 1DRZA 4I67A 3GILA 2HQIA 2DO4A 1KFSA 3GV8B 3HOXG 4C6AA 2B7CB 4WKRA 4CWBA 2V68A 2XMUA 4AL7A 4DR4H 3ZC4A 4RLEA 4WYLA 1TL3B 4JV0A 4JV5J 3R5JB 1Z2NX 1VK3A 3R5BA 2CQBA 2JA6G 4LRFA 5GVQA 4B9NA 2E5LJ 2AHOB 2IHR1 1VRTB 3IRXB 4JI1F 1DZ5A 2YKMB 3C0FB 3RUPA 2BZ2A 2JLGA 4X62H 3JSNA 3EDQB 2L9WA 5AXNA 4ZVSB 3DGVA 4W4MA 1SJ1A 2GNKA 2GFFA 3JTNA 5J2NA 4BXXG 5C1PA 4HR2A 1CQNA 2RT3A 2NXCA 2CAJA 3DYAA 1WDTA 1IJEB 3I12A 3IAS9 2MB0B 1FD8A 1S1WB 2HVEA 3ZZZA 1IM6A 3CE8A 4G1QA 4O44A 2UUCJ 2FJEB 1TA8A 4HLBA 2MQLA 4C48A 1BE4A 2AEJA 3HK2A 1Y0HA 3KFWX 4NXNF 2B9EA 2YZGA 1XC9A 4QIWD 4I2PA 1SQGA 4N76A 2YNIA 2QSFA 4ECVA 3PJXA 1BNCA 2DPJA 2YU9A 4OX8A 4YHHF 4AL5A 1UEKA 2PIIA 3KLEB 4DPXA 4I6AA 1Q5YA 4JI7J 4MV8A 2YVSA 3G4SS 2OD6A 2M70A 2FD2A 3BABA 2ZEJA 4X4PA 5LMNJ 2W6PA 4UZBA 3ETHA 3BBCA 3MR3A 4IRKA 3G86A 4WFYA 3POTB 1WH2A 3D4JA 4M5LA 5AE1A 5EZYF 5LXRA 5E3AA 2CJ9A 3PW5A 4A3DG 2YKNB 4FVMA 4OHYA 3C14A 5BR8J 4LSLA 1UW4A 5HP1A 6AT1B 1ZETA 2QIFA 1UVIA 3H5YA 1BD6A 1MWYA 3MCOA 2B4VA 4LF7H 1F5CA 2Z0GA 2SCUB 4DQSA 3JXOA 3HULA 4A8FA 4NYPA 1RAOA 4TU8A 2NR0A 1F1BB 1M1GA 1CVJA 2R7UA 3OPKA 1AB8A 3N40P 5HVGA 2V9WA 2Y9HA 2LECA 5EX3A 2A18A 1W7WA 4LSNB 1M0WA 4RUAA 1N56A 4HI2A 2XY5A 1VJQA 2CPFA 4OV1A 4B17A 2Z4PA 2H65B 2HWIA 3HHLC 1DLOA 2NU6B 4P71A 1JMTA 3AA9A 4QOTA 1KNZA 4MA0A 2KN4A 2R2TA 1HNIA 3MEEA 3GSDA 3GB0A 2HHWA 3GU0A 4ZPDA 3W63A 2RQ4A 3L4BC 2NXEA 1XMQH 2EFOA 2DHAA 2DHHA 2ZBRA 3K57A 2V5AA 2A10A 1D9DA 3FKIA 1RJJA 3QWUA 2KT5A 2VQDA 4C8MA 4ID5B 1X0FA 2VV5A 3KHRA 4ZVHA 4Q8FA 2GQQA 1RAGB 1JWWA 4A3MG 1TMJA 1X4BA 1RTJA 2WK4A 2Z30B 4NLTA 3J81U 3W5ZA 1GMWA 1FJGH 3NXZA 4DR1F 1MU2A 5B7WA 2NXJA 2CADA 2Z56B 4IKAA 2PT0A 1RWUA 3QO9A 3FZBA 1CBKA 2J0XA 1WG5A 3UDLA 2HQCA 1RK6A 2IAJA 4LRDA 1X9WA 2IVFB 3ZZOA 3I56S 1T9UA 1FXLA 4ILMA 1URRA 3ZZPA 4XPEA 3DCAA 2VKRA 1N36H 2WDTA 1WDDA 2RF2B 2J6ZA 2WCXA 1RP5A 2HVZA 5D4OA 1VISA 5EWGA 1WTBA 4DR5H 3VZIA 3R5XA 4TY8A 5L9XA 4F04B 3UW1A 2XY6A 1E6VA 4UFZA 4FF1A 1KP6A 4URQU 4I7FB 5DLGA 1V9PA 3J81j 1AT1B 4OLPA 2R84A 1S99A 1S6OA 3UR0A 5KT4A 1FT8A 1T3OA 3VAJA 1R0BG 2EFPA 3A3OB 2FJAB 5L1LA 2ASLA 1M7JA 4RW6B 1LEOA 5HMYA 1GXUA 1CJVB 2ZDPA 4ZLLA 1I50A 2XCPA 1VC5A 2FVSA 4PG4A 2JOQA 2J0WA 2JEGA 3KHHA 1S4FA 2XYGB 1KVIA 2DXEA 1M5KC 2NXUA 2KXNB 4M95A 2V58A 3MR6A 3NMRA 2C3UA 2DNPA 1HBUB 4B3SF 5E0OA 4R8UA 1M90T 3DLEB 2E44A 1BMQB 3GYXB 3RAXA 2BUNA 1TK5A 2OPSB 1WF2A 3L7OA 1U1LA 2V63A 3K5LA 1SYXB 4NLVA 1HQ2A 2YKOA 1HHTP 3S8SA 2R3VA 4MV4A 3GE9A 4DSEA 4HT7A 4RWWA 3M7VA 4CYUB 3HFZB 3BDEA 5KFIA 1LK7A 3WZ0A 2FPPB 1ZS6A 3I4HX 4XX0B 3RBXA 2CQ2A 2Q2TA 3SCIE 4GKJJ 1VBZA 2NU9B 2Q43A 4B3MJ 3MEDB 2GC8A 2OO4A 3D3CJ 3FRZA 2GA7A 1IKYA 4WXWA 1JJ2R 1OYEA 3GTQA 2ROGA 1NK0A 4JI0F 3RW6A 1FRMA 1BWVA 1RACB 1B0TA 4JGIA 2CNLB 1YITS 5DGAA 4PWUA 3H20A 3TP2A 2PFDA 3GSIA 2EK6A 3R97A 3H5SA 2FPGB 1FESA 1U0HB 2NS1B 1RKIA 1HHSA 1VRUB 1TWGA 2C35B 2CIMA 2NPIA 3LUYA 3C8YA 2FY8A 3TVZA 1GK8A 4O4IF 2N7CA 3KUHA 2XMTA 3U02A 1M5HA 2NUAB 4DR7F 4NE9C 5F8NA 2R7WA 1CJTB 3IAM9 3ONQA 2FB9A 2V4RA 5FD1A 2W8LA 3HVTA 4DL7A 3FVYA 3FEZA 4HTIA 3MWBA 2GMJA 1EARA 1AUDA 2C2RA 1HNZJ 2I1RA 3GJQB 4EMDA 1SC4B 4WE1B 3M2RA 1IKWA 2CXEA 3M6VA 2F40A 4DR6F 3UDCA 2H1YA 1LXNA 4DV7F 1UC9A 1XNQH 1MWZA 4K0KJ 4DSFA 3UDVA 4M5IA 1K98A 3CW2C 4RBTA 4QIVA 2D9PA 2GJIA 4F4KA 1PBAA 4OL8A 2XHCA 1IBKJ 2M05A 3W9HA 3KAJA 1DY3A 3HSJA 3AOBA 4RAZA 2FJZA 4WP8A 2JA8G 4YMEA 2E9ZA 3G87A 2RAQA 2W70A 3THTA 2KJVA 2JNJA 4I2QB 5JVLA 2C00A 4WXOA 5ETVA 1IUJA 1YZ6A 2WAQE 4IG3A 4FVCA 3GIPA 1U48A 4TXSA 1ZH5A 3BJYA 4K8RA 4M9UA 4J9RA 2R8IA 2IM1A 3AAWB 1HYSB 2V8GA 5J2PA 2R82A 1D3WA 4PXDA 2HNYA 1WKKA 2OIHA 4OYBA 3OR1A 5FPOA 2VUMG 1RAHB 1RK8A 3LWLA 1Q5VA 2XYHB 3T1HJ 4ANEA 2P9EA 3FRYA 3EYYA 4PG6A 4F50A 4LFCH 3DRYA 3SSQA 5LSLA 5DETA 1NAQA 5D4LA 4CO0A 1X9NA 4AYBA 4P9SA 2GPWA 5IT9W 1H2UX 2OEMA 3P96A 4NXMF 2XZDB 2VR1A 3ZZ0A 4DV2J 1QTMA 3BPDA 3DM2A 5CB4F 1C0TA 4C8KA 1Y3KA 3LP0B 1Y5NB 4I4TF 1U02A 5EWFA 2E5GA 4H54A 4KHPF 2IJFA 2XB2D 4ZLJA 4KT0C 4UZCA 4DCOB 2IYGA 3EZXA 1CJUB 4U7CA 3WDOA 2RRBA 2B51A 2ZE2B 4ZPTR 2GX8A 2FC8A 1IR2A 2QGFB 1ZBTA 2UVRA 3W2WA 1SLYA 3IO1A 3NL0A 1V2ZA 3MURP 2F4VH 4TN2A 4OI0A 2KU7A 3I9ZA 2BRKA 1GX5A 3U7JA 5LA6F 3SEOA 4ENOA 2ZH3A 2IIHA 4Q5VA 3N6LA 2HFNA 3PKYA 1HBMB 4UCRA 2N3LA 1REVA 4WCEQ 3GG0A 2XSJA 2KM8C 1JKHB 1XMOF 1RJRA 1R3NA 1ZTTA 3MM8A 1JLFB 4CDIA 4XO0A 3GJTB 1C1BB 3I55S 3M8QA 4IWYA 3OUYA 5DLFA 3MEGA 5B0GA 4QYZK 1HFEL 3DMJA 3DLHA 3ENQA 3I5CA 2DRAA 2ZM6J 2E1CA 3VQSA 2KKHA 3OV7A 4DWIA 5GMEA 1MW7A 2DWCA 3M05A 5HANA 4LR7A 4RW7A 1TTHB 2YX4A 1SIZA 3KMSA 1KJJA 4LF6J 2DIUA 4LVNP 1S72S 4QIEA 4JI1H 1RWMB 1I3QA 1KR4A 1VR6A 3VGUA 1QSAA 3MECA 3OTOH 3G8QA 2DIVA 3H42A 2IM0A 4P2MA 3BQ0A 1XJWB 4ER8A 2FZCB 5HBMB 1IKVA 3T6BA 3UD4P 3N9UC 3X1LB 3RRGA 1EUDB 3ITHB 2HHQA 3SBMA 4JI8F 1NDLA 3EMTA 4CO4A 4ZIVA 3GYNA 1B7YB 2QA4S 1HQEB 1DTQB 3EGNA 4C2MA 5IWAJ 1VOMA 3JSRA 4C3MA 1NDCA 5C42B 1QAJA 1SQFA 4IFYB 2EWHA 2X0SA 1VIXA 2W9AA 3KLIA 3I4MG 3DI6A 1CJKA 3J7YU 2HHHH 1X0PA 4NOHA 1FJEB 4JI4H 2MCTA 1N0UA 1XERA 4NYZA 4PUOB 3FFIA 1JLCB 1ZYQA 5HROB 3UD5A 1B70B 3TA2A 4KB7A 4LIWA 4DSIA 3HD2A 2C2OB 1UVKA 1B64A 2MZSA 1WC6A 2C2MB 2YWFA 2VG6B 1JLQB 2MQ8A 1Y10A 1H7XA 3M8RA 2RD5C 2DRDA 2ZKUA 1OQ3A 3NGRA 1TK8A 1FTRA 1FF2A 1E6YA 3CDEA 2BV3A 1IBMF 4TKTA 2NU7B 4CLPA 4RU9A 3TZXA 2WW4A 4Q7AA 4OI2A 2R7ZG 3IC1A 3MR5A 1D8YA 2ZH7A 3W2VB 2R7KA 2KRBA 1SXLA 3N0VA 1WCMA 3OD2A 4RWXA 2HNZB 4GMKA 5KFRA 2XGQA 2P5VA 5I4MA 2GMLA 3BQ2A 4HT5A 2UUBF 5C44G 5IT4A 2H51B 3LP1B 3QLHB 4LH6A 5KFWA 4OZJA 2OMOA 4A8OA 2XIGA 1Y5IB 1L3SA 5LOVF 4DR3F 5CA1F 3FQLA 2R8KA 4X4NA 4EGQA 1S6PA 4X8QA 3TIGA 1DQAA 2W7AA 1GTEA 2Q6CA 4KR0B 3I82A 4WFXA 4DPOA 2NUUG 2VF3A 4P7TA 1C4CA 1K44A 2QE5A 2X1AA 5F0UA 3CDAA 1QM9A 1MMLA 3BGOP 3US5A 1BGXT 3DRRB 2E5LF 4GKKH 2ATCB 3SZ2A 1HKAA 1HNXF 1G1XA 3JTOA 2HS0A 3NG8A 2RILA 1EAYC 4CLTA 3LALA 1I1GA 3G8CA 1X4GA 3M6WA 3K5NA 1VCTA 3DU6A 2R8GA 3R5HA 1TKXB 4BC7A 2GJFA 3C19A 4RO0A 1D9AA 1SUQA 4F25A 3BO3A 1P27B 3NY0A 4ED5A 4AFFA 4DR1H 2XNRA 2ZDOA 4ID8A 1N5YB 5KOWA 2G4BA 1KKHA 4ZPVR 1KJ9A 4A8QA 2X7IA 1KQKA 2OP5A 2B4OA 5D1OB 2PBZA 4YQWA 4EK2A 2GPSA 5D3GB 5FLMG 1WF0A 2RU9A 4AQYJ 3CXCR 4FU0A 3FUYA 4NWBA 2UV8A 1FRLA 3M8SA 3K3PA 2KM8B 2RH3A 3MUTP 1KDNA 3IFEA 2CJXB 3KG4A 2ZFHA 1U6BA 4O4GB 3BA9A 4JI7F 2VPYB 3GIJA 1VHFA 1FKOB 4QJFA 1RT2B 3H90A 3DXSX 3KAKA 1RWVB 2XY7A 3MAQA 2M3DA 2AZ1A 5J1EB 1WC5A 3BH6B 3CB4A 2ZZNA 1KQFB 3RB6A 3VPDA 2QTWA 2HHXA 1RTDA 3RJ0A 2QRRA 4IRDA 3CO9A 2HZAA 3C6TB 4PG8A 4ZLPA 5CA5A 5LMUH 4GC6A 4LIRA 3VAFA 2XMKA 3V4IB 1S1XA 4EI2A 4K50A 1S9GA 3C15A 2HQ3A 4WPAA 3VALA 3GYGA 2CQCA 1BXNA 3GFYA 3QRRA 1P1LA 4F2SA 2QJ3A 4ZHRB 3R27A 3K5HA 2CZ9A 2VBZA 4F3OA 3QNWB 1JXVA 3QSYB 1BUXA 4NYOA 4B3SH 1G3OA 5C3EG 3POTA 4N41A 3DOMA 1Q0NA 2J0QD 2ZNZA 2G1HA 5LJ3Y 3BKFA 4MIWA 2RGVA 3NGKA 2YKNA 3QT6A 2DGQA 3KLGB 1YJTA 4LF9J 4PRFA 1TKTB 3EUNA 5I42A 1B0PA 2R7SA 2E9RX 5E3RA 2R7TA 3DOLB 1BWEA 1CC8A 1IWAA 1EKRA 2BVZA 3IN5A 3KLHB 3J81Y 1M1HA 2QK4A 3D7SB 1OSDA 4ETZA 2E1MC 1UTAA 3TQ1A 3FSXA 1W2IA 4JI0H 1DQ8A 5D4NA 2YNFB 1GXLA 2KB2A 1N36J 2KO1A 2A0FB 2DY9A 3F44A 1N5SA 4NLUA 3CCMS 1JK9B 3RU0A 3TW0A 5J2TF 2UU9H 4CLKA 2HG4A 4DV5H 2YZNA 2MSSA 4DR5J 1RTHB 4V19J 3I87A 3WX4A 1GQEA 5EN1A 2CZVC 1IN0A 1UETA 2ZJPQ 4CLZA 3GR1A 3OFHA 2MY8A 3M1VA 2D3OR 4W90B 4IH5A 1ULZA 3N6NA 4C0BA 3BN4A 1PBUA 5DG8A 2WVCA 3E2EA 3HT0A 2JC0A 4DL3A 3K7RA 1J5EF 1Y14B 1Q6BA 1VC0A 5BPHA 2IVMA 1FI4A 4FBUA 5AE2A 3LA0A 3PACA 4XYMB 4ID5A 5FJ4A 4DR6H 2VG5A 4DV7H 4LBPA 1L3KA 1RT7B 2VFRA 4B3TF 1EZZB 2J6TA 4K4SA 2DHGA 4K7QA 3QSIA 1VQ8S 3ISNC 1YBUA 4HQ6A 1FE0A 1Z2OX 5KTQA 2C2DA 2HFOA 3S01A 1Q8BA 4ETSA 3D6TB 2B4UA 2LDIA 4OHWA 4RUBA 1YVFA 3CCWA 2GIFA 4DS4A 1SV5B 4BWSC 5K5MA 4RB0A 4F4ZA 1VLYA 4MJKA 2RHSB 1QAXA 2KL8A 3HXLA 4X64J 2F8HA 4A3FG 2E7XA 3D1OA 2XQCA 3SQGB 2UUAF 3WHIA 3M32B 1QSLA 2U1AA 4HTJA 1S12A 3PYGA 3MMCB 4ZHQF 3MAAB 4KSEB 4A3EG 1QE1B 5IQQA 2OPRA 2ZDHA 2GCFA 2W25A 1TWHA 3MEKA 1HW8A 3D2WA 3CMES 4F26A 4OJGA 5IYBG 3PO3G 4I7FA 3EWGA 1PSDA 4NLSA 1H0HB 1WNEA 4Q0BA 1LWFA 3AQOA 4IOCQ 1X4HA 4I6YA 2K1RB 1JNZB 4NZ0A 2D7SA 4NXMH 4WK3A 4RW6A 3KLFA 3W5YA 1UFLA 1DV1A 1X7VA 3MCNA 1FRXA 4DZ6A 4KV8A 2LEAA 2ZOGA 1RKJA 5CH7B 3V2UC 3P3DA 3H40A 3M30B 4HEHA 2GQ2A 3LPYA 2VQFF 2OEJA 4AXIA 1YJ7A 4C0OC 3I0SB 4KFBB 3ZO7A 1N5TA 1IKXB 3PRVA 1HPZA 4DOZA 3DLEA 4RW4B 4IO1A 4O0NA 2V67A 3EXCX 3KNGA 1WEZA 4MH8A 1SJRA 4QR0A 2OPSA 4J9LA 5KT6A 1YRXA 1Q82T 4LF8J 4MYTA 2MYFA 4CT9A 3NGUA 3T5JA 1V4YA 2F3JA 3PO5A 4ZVRB 2RU3A 3G8TA 2Z57B 4OX7A 3OJSA 3JZIA 2R93G 3N6MA 2OWOA 3R8YA 3B54A 5GAGI 4MKBA 5D4PA 2DD8S 4HDHA 1G6BA 5CAEB 2AMCB 4F0HA 3ILLA 4RW8B 2J76E 2LFVA 1RAIB 2MMYA 2G13A 3BEGB 3K8VA 4A8YA 3HXMA 1XMOH 4JI5J 3SFUA 2CRLA 5A6PA 4PXCA 1RT6B 2DNLA 3Q23A 2VQEF 5THWA 1ICEB 5ETTA 3A1YG 5DJBA 2ZOFA 1BGWA 1I51B 2I9SA 3FGVA 1R31A 1I3OB 1D9FA 2CZGA 1IBKF 4R5PB 2ROPA 1VS3A 1Y11A 1BLUA 1H3DA 2V9KA 3QBCA 2QFIA 3QWPA 5I47A 3RW7A 1AN7A 1WSRA 3AOCA 1UP1A 3CEDA 4ZJQA 4WE1A 2IMOA 3C16B 2M2BA 2IBKA 5ETMA 4KQZA 4DUYF 4M5GA 2QEXS 2C22A 3VF0B 1OQ6A 2RKIB 4JI8H 2YY3A 5HV6A 4DF8A 4DLKA 3TAMB 1U1RA 1URNA 4RPFA 3DKDA 5B0EA 4CLYA 2IDEA 4F0MA 1DBDA 1ZPVA 1ZPWX 5F41A 3UWTA 2JA7A 2W2MP 2RQCA 1WKLA 2XS2A 2F4VJ 4QYZJ 3ISND 5JMNA 2A3JA 5K14B 4R7RA 3UE2A 3UCZP 4I2QA 4A3JG 2G0IA 2OAUA 5E5NA 3GIDA 4KHMA 2CW8A 4ZCKA 3M9MB 3Q8UA 4ZKAA 2V2ZA 2P9GA 1HMVA 2AKWB 1HYSA 2GLTA 4ZPWR 2F8MA 1EETB 5AXMA 4CCHA 1OY9A 1SKRA 4XZ3B 1S9EB 5KT2A 1CS4B 1EHIA 2W2NP 1Y1VG 1OY8A 5M2PA 1LW2B 2AD9A 1TKZB 1JDBB 2AEMA 1QSSA 5JVHQ 1RA6A 4P10A 1FVIA 3BS9A 3CJKB 5L38A 4F8RA 3PJ9A 3OFEA 1IBMH 4ZOSA 4DF4A 4DN9A 1TU0B 2FHOB 3H59A 2BACA 3KK3B 4FNIA 1FNXH 1ZQ7A 3UN3A 3WC2A 2J70A 2BE9B 4J9SA 2R7QA 3PM9A 1B04A 4AL6A 3HKZA 2ZJTA 3OUUA 1N5VA 2DEIA 1HNVB 3MWMA 3LW5C 2Z8QA 1RB0A 1UEUA 3OTEA 2FJVA 2UUBH 2OH2A 4JI1J 1MSWD 4DN0A 1JLBA 2ALZA 5I3UB 4BCAA 2CA9A 1FXDA 2JC1A 2N4DA 1R6VA 1EHWA 3NOCA 2OEKA 3MD3A 3N4WA 3D1HA 3H25A 2VBWA 2EFQA 2HZVA 1V3ZA 3PFEA 4G1PA 2QG9B 4F3QA 2D41A 1YJWS 2ERRA 1TWFA 1WOPA 2BQUA 1T9VA 4MFBB 3W9JA 2C42A 1NJIT 1T03A 1Q79A 4NXNJ 2YS7A 4UCVA 1H7WA 1HBMA 1LWCB 2E5LH 2MKIA 3ZZYA 4KGVB 5DDQC 1YRTA 2DR8A 4C3KA 2GZOA 3D1QA 1Y5LB 3D0GE 4JV2A 4YHHJ 1YX2A 1LWEB 4ZVOB 2E29A 1C1BA 3R5GA 2OMLA 1RTIA 2V4JB 4QPTA 5KOXA 5IT0A 4UW2A 3DNCA 4ZQIA 1KTVA 2DITA 1KS2A 1F9FA 4ATNA 4O3QA 5C2GA 4K4ZA 3MWEA 9RUBA 2PMZE 2GMHA 4ZP9A 4DV6J 3IGNA 3LO3A 1YGYA 1HBOB 2HWHA 2UUCH 4U9RA 4OI3A 4ZVUB 3RAQA 2DR6A 3PZPA 4FNHA 3MOJB 1RGVA 1DTTB 2OFGX 2GVZA 2PFFB 1U25A 1NKCA 3LMLA 1NLKL 2EW9A 5D1PA 3KHLA 3PW2A 4EBEA 2PE8A 3WQPA 1YLXA 4M63A 2PEBA 1VKZA 2ZBPA 5HBMA 4JI7H 2DY1A 4Y2KA 3PY8A 2JSXA 3EXYA 5LMNH 3CNQP 3ITHA 1BQNB 3B6BA 2FHJA 1KWMA 2J9EA 1U1NA 3FZ2A 1KJQA 2W8KA 3HCXA 1GH8A 4JUZA 2DRBA 1HQEA 3TANA 3WBZA 2NPFA 3BPSP 1HQUA 5FIIA 3VGTA 5C42A 2IC3B 2UXBJ 1KBLA 2NLWA 5CYMB 1HHQA 4JP8A 1S0NA 3GPAA 2MTLA 3LOUA 5L9NA 3GTJA 3AH6A 3ET6B 1UCNA 5SZTA 1P8LA 1VQSA 1WHYA 4PUOA 3SIPB 2QC3A 1FTCA 1JLCA 4OYOA 5HROA 3T1YJ 4O3PA 3R6GB 3JSLA 5FD5A 4DPTA 1B6SA 5B08A 2E7WA 3NBPB 1GTHA 1DV2A 1JLQA 4CZCA 2PC6A 1E4EB 3R5DA 4L74A 4OLOA 1NKBA 4NLGA 1BXRA 1NDKA 4PR6A 4DX8H 5IS2A 1HR0F 3S6EA 4DR1J 1UC8A 2GHWA 5ETRA 4TQRA 2ZBCA 3W2VA 2DNNA 2HNZA 1RBAA 3HHDA 5MLCV 3BR9A 3FNNA 4DUTA 1DFDA 2HBYB 1S6QA 5K8NA 4B9LA 2GVDB 2F9JA 4L3NA 3V6DB 3LP1A 1IXKA 3TZYA 4A93G 3TX8A 4JBCA 1UJ6A 1O0PA 2DGWA 1PO6A 5CA0F 1Y9OA 2L9DA 2I5JA 4DU8A 1U8SA 2FLLA 2RGRA 1TZ0A 4FN5A 3PV8A 5KFBA 3LH2S 1F5AA 1KRPA 2QMUB 1RAFB 1YKWA 4P52A 2R92A 3CJ8A 4Z7YA 3AOAA 4J9OA 2JA5A 1RISA 3W61A 2FJBB 1A6LA 1UPMB 4HYKA 1TFYA 2GO8A 3H0GG 5F3ZA 3G6YA 5AXLA 1FVQA 1J5EH 3DRRA 3OXLA 2FJXA 3PVXA 3NCPA 3W62A 3DGPB 4A46A 3GTPA 2DK2A 3GONA 1UPPA 3VAKA 1RT4A 1UWAA 2M7SA 2N82B 4WTYA 1RT1B 3G6VA 5A8WB 3V81B 2NYIA 1B3TA 2C2ZB 3DRSB 3D9BA 1FX4A 2CUYA 4B3TH 3HP6A 1S7HA 4EFAC 1OY6A 2XCLA 4B3SJ 1R0AB 2KXFA 2R7XA 3U1MA 1W26A 1S7IA 2YTCA 4PPDA 1BQMB 2Z2MA 3IR6B 2DKOB 5AJ3F 1N4LA 1N5YA 4XIUA 3FMWA 1VBHA 1LXJA 3ZZRA 2MGZB 3HD1A 1QVGR 3BJDA 2B8QA 2P6SA 5D1OA 3CC2S 3NP5A 5D3GA 1T7PA 3NS5A 2Y3YA 1GT8A 2CPEA 2WB1D 3FMAA 4N8NA 2BR0A 3P6YC 3I9V9 4RUCA 1KQSR 4DEZA 3NNCA 4X65F 1N6QA 2B9YA 1VDHA 4LR9A 4QWBA 1ZM2A 2XI3A 1F3FA 1EUCB 3G2XA 2DIKA 5KFOA 2QLWA 2MEWA 1WORA 4OZ3A 1RT2A 3UQ8A 4P2SA 3SQOP 4WTOB 4TV9F 4XYLB 4E4TA 1FKAF 4F2RA 3HB9A 4A2AA 4F0KA 2X1FA 4PQUA 1U6ZA 2VFUA 2FVCA 5J1EA 5HI7A 4K2JA 3MWDA 1VI7A 1B33N 2W7OA 1Q81T 3L09A 5IYCG 1DJ0A 4X4RA 2UXCF 1GMUA 4DR7J 1N32F 2XO6A 4ILLA 5H80A 1HNWF 2E5JA 5KFLA 4XTTA 2FJWA 4C5CA 1N34F 1R7IA 4B9UA 4GKJH 3CCTA 4KIAA 1YWXA 2KH9A 4B3MH 2W9BB 2QV6A 3RTXA 1A0OB 5A6WA 2VQFH 1WSCA 3AFGA 3PYFA 4Q45A 3W1YC 3VAMA 2WBMA 3A4TA 1GSAA 1IJFB 1JLEB 3K58A 1Q8KA 2HIQA 2QL5B 3MM9B 4J5OA 4DSJA 4P2FA 2OGUA 3KYLA 2BE2A 4PWWA 1VIOA 4B9TA 2PBIA 4IH7A 3VVUA 3KLGA 3DRPB 2QN6B 3Q83A 1TUWA 1KLNA 3TAPA 2ZBQA 5KFTA 5GADU 3OL7A 3M6UA 1HLWA 3DXBA 2HQDA 3Q86A 4U8YA 3DOLA 3JAMY 1HI8A 1FEEA 4ZK7M 1K83A 1MWQA 3I6PA 5A8RB 3R6LB 3V5RA 2PMWA 1S48A 1T8EA 4ZIWA 5IM0B 4GRSA 2HURA 4ZMMA 3DLKB 4LRBA 3KJVB 3PHTA 4HNVA 4C7QA 4DS5A 3CUNA 2B0GA 4JI2F 2Z2LA 3KLVA 2VQEH 1BHNA 4K0KH 4QPXA 2FP4B 1N8RT 2HLUA 1SKSA 3UPFA 3N42B 3KTQA 1R8PA 1S79A 4WFZA 1W93A 1IBKH 3TZZA 4IR1A 4LQ3A 2ZJQQ 2VPSA 4YR0A 4ED6A 4A3GG 3DDIA 4P75A 4A3BG 2W9CB 5J2QB 3CJRA 4APMA 4NXMJ 2MKYA 3D5MA 4QWAA 4I1TA 2F5GA 4GC7A 4K4YA 1ITPA 3TQTA 3WO1A 4CNYA 4BBSG 2PMZD 3HBLA 4ZPCA 1RT5A 4KHPJ 2HMIA 3PIOQ 1RT7A 1S1TA 5IFMA 4QW8A 4PQAA 2B8PA 1HD0A 1AZSB 2VPZB 3IVAA 3H3VH 3BYRA 3I4NG 2XWYA 1FE4A 5CD4A 1LKZA 3HF5A 3J7YI 2IY5B 1XIQA 2E7VA 1K0TA 1IBCB 2AEFA 3VHQA 4NRUA 4B3RF 2KXHA 2JA6A 2WZ1A 3HFVA 3QFHA 1HWUA 3KUEA 4QCLA 3UN2A 4DV2H 2ADCA 3OL6A 3GZ7A 5LJ5Y 2D3O1 2NSCA 4N47A 4EZ9A 2DR7A 4UY85 2A6OA 5C2CA 1H73A 2NQPA 4HH1A 4FS2A 3M9OB 3MAAA 2B3TB 2PN1A 2W2QP 3SSRA 2BANA 4CTAB 3CDBA 3J7Z5 3CCLS 4KH0B 2P9CA 2R8JA 2MLXA 4N56A 2ZOMA 4W98A 2XMAA 3NAHA 4RW9B 4CNZA 4M5HA 1H72C 2CPDA 3KK2A 2VA3A 4MK8A 4P73A 1C1CA 3GIKA 5ITHA 5IOLA 3WNZA 1CQMA 1IWGA 3QJJA 1P6TA 2QL9B 2OPPB 4H4KC 5BMVF 1U0SA 2JLEA 3KOAA 5CCMA 1RLDA 3K5PA 5AXKA 1EIYB 2JEIA 4DV0F 5F9NA 1RJQA 2K3KA 3AD8C 1R0CB 1U2FA 2VPWB 3AB4B 4XK8C 2HRTA 3N5BA 1QD1A 1RTZA 2PD1A 4JI5F 3G82B 3VMMA 4KFBA 2BA9A 3CJQA 1NMEB 4UCTA 2DGTA 5IV4A 4RW4A 4I4BA 3M8YA 2PN6A 3CJ3A 4Y34A 4M0MA 4NLOA 4PPZA 4CQ1A 2XTJP 3DFEA 4ECZA 1MROA 2ZKTA 3CO0P 3GCXP 3W9IA 1Y3JA 1Q8IA 2QMWA 3MR2A 5ETPA 5D0HA 4C8OA 1S5ZA 2BJ9A 2L08A 5H9FJ 1UMJA 4RW8A 3PIPQ 4IQMA 2OTJS 1EX8A 2IJRA 3UI3A 4LMZA 4X84A 3KWMA 2JDJA 1UFWA 1M5VC 4RNOA 4QBUA 2NYHA 3HVAA 2IVYA 1E4GT 4WIQA 3JTPA 2BJ1A 1H38A 2VBXA 3EVWA 5KFHA 3PJWA 3MTKA 1K1SA 1RUSA 4N7TA 3L9ZA 5IWAH 5B09A 1PGZA 2BJ7A 2W6QA 4IDKB 2CNKB 5C25B 3BH7B 4YR3A 2YXLA 3MFHA 2ZITA 2LU1A 1U26A 2EBGA 2Z2YB 3JQJA 3QATA 2IA0A 4DL6A 2FK3A 5KFPA 1NJYA 1RWOB 4YOEA 4ED0A 1FRKA 4DDFA 3J81W 2BDPA 5HK4A 2GJ2A 4NZ6A 2UUBJ 3TIIA 3EPIA 2P8IA 5EWEA 3FJ2A 4RZRA 5DGBA 3UVJA 2PI5A 4QQBA 2KDOA 5LXTF 1U1KA 3FBEA 4USJC 4ELUA 4YJ3F 2RKIA 3M9NB 1OPZA 3M6XA 1J2VA 1ZA2B 4CLWA 4DR3J 2JVRA 5IV3A 3TAMA 2B56A 3CD5A 4DUZF 1TL7B 4X66F 2WVBA 4YB7A 1HWIA 3N43B 3L7PA 3T3FA 4J90A 1SPBP 2OPQA 1A0IA 2IFXA 1U2CA 2RJZA 3LTOA 2GGPB 2YWWA 4MAMA 5K14A 2VL1A 4KJIA 5K2MA 3BSAA 1JLGA 1F5BA 3CCRS 3L9TA 1WSVA 4DG1A 3TO8A 2HVHA 5C4XG 2RVJA 1YJRA 4ZI7F 3PG9A 2HJWA 1QDUB 3GR0A 2GHPA 3IG0A 1HNXJ 1Q7YT 3IWXA 1Z4UA 1FDDA 4QIGA 4M94A 3D6FB 4ZVPB 1SH3A 1LW2A 2W2OP 5HBRB 3L4KA 4OI6A 4TU9A 2C2KB 5J2NB 5LP6F 2HSEB 1I94F 3ZNUA 4CO2A 4ZP6A 3DYAB 4NA3A 1HR0H 1K7YA 1V5VA 3CT9A 2KFYA 1KSPA 4O2BF 3TJ8A 3ELHA 3BBFA 4AUKA 1XEZA 1WEYA 4G1QB 2RUGA 4P72A 4AYBE 1CS0A 2ILZA 4I7HA 2H54B 2LVWA 4LSXA 3DN9A 1H74A 1HNVA 3BG5A 2JHEA 4G1IA 3PFOA 3MCMA 4YR2A 1UWBB 2WVEA 4EBCA 4I2PB 4CLLA 4C11A 4WWSA 4KO0B 5BYRA 2VH7A 2DH9A 2R7NA 2V8VA 1ZM3A 4NI2B 5L1JA 3HJVA 3G9CA 5I3UA 1U49A 3BA8A 3QAUA 2BKPA 4RBUA 5FPRA 3LAKA 5EX0A 3BM7A 2X51A 2VIHA 1S57A 2V0NA 3O3LA 3O1LA 2B9WA 2Q6BA 1Q86T 4HH0A 4DV6F 2HRUA 5DQIA 3KK1B 1NEEA 4MFBA 1K0VA 2VG7A 2WSCC 3QYYA 1WKJA 7AT1B 1FFWB 3T5HA 1TL1A 4A3LG 5IYZF 4F4YA 4ZA1A 3VAHA 4AQYH 4DPUA 3RYLA 4OQJA 4LR8A 2AGOA 2Y0SD 4RKUC 2CYYA 2F4FA 4L3KA 4KTQA 2F1FA 3PX4A 4OI4A 4LF4F 2V4JA 2Y1IA 3AD9C 1T0TV 2K7JA 1YJ9S 4IFVA 4NEYA 4ED1A 1VQYA 3LP2B 5ETLA 3KJFB 1KOHA 1HBOA 2DGOA 4AE5A 1FA0A 2XHWA 3OJUA 4RNHA 2K2PA 4DV4F 2UXBF 4WFAQ 3CGIA 4ED2A 1DTTA 1JLLB 5KFEA 3JYTA 1M0SA 1TELA 6FD1A 2W71A 1VQ4S 3IV9A 3NAIA 1XR6A 2IM3A 3TEGA 3FSIA 3P8BB 2RDJA 3M4XA 3EGZA 3HT3A 8ATCB 2NZ4A 1HNIB 2JVOA 5HJXA 3T1YF 1CULB 5K8OA 4YFUA 2UXDJ 2FC9A 2BRLA 2CQ1A 3EGVA 2KVQE 4ES2A 2ILYA 4USIA 1QUVA 4LFAF 3FBFA 1KLMA 2FKLA 4OYPA 4X4UA 3GIMA 4DV1J 3I96A 3LGMA 2N7YA 3JRWA 2MLYA 4HDGA 3E51A 4O23A 4L72B 2HVRA 2J6YA 4OYWA 1WF1A 1RTJB 2HK2A 2IC3A 4ZVQB 1RWKB 3IR7B 3CCSS 4LF9H 1Q6AA 3TUZC 2ZWOA 3ET6A 3UO0A 4HH3C 4BY7G 1XR7A 2D74B 4E2FB 3VV2B 4ICLB 2G0CA 1SCUB 3QO9B 2J0SD 1N34H 4F4XA 1GNKA 4EU0A 2IAJB 3V6KA 1J27A 3OSPA 1S77D 2V2VA 4J9QA 1J5EJ 2IYIA 5JUMA 3NBPA 4IYQA 2CQ3A 2FQQB 3T5KA 2VUMA 2DBBA 5E2QA 3MM5A 4X62F 4R0JA 1R5QA 3SXLA 4TV8F 4B3TJ 2BW7A 4C0HA 5EUHA 2YQ3A 2ACMA 2DCLA
chains in the Genus database with same CATH topology
3AQOA 4PG7A 4IOCQ 1X4HA 4RB2C 1WACA 3OHBA 4OX9H 2DHXA 1YJVA 4I6YA 4DL2A 1V3SA 4M5DA 4MMOA 3O2IA 2K1RB 1JNZB 2VG6A 4NZ0A 1S97A 2D7SA 4NXMH 4WFBQ 2ZC3A 2EI5A 1E6VB 4WK3A 3TUIC 4IUFA 1FEHA 3FFIB 4RW6A 4V19X 3KHGA 5CYQB 3CCUS 4KRWA 3KLFA 3HFKA 1CEZA 1UFLA 1UKUA 2F9DA 3VQTA 3V6JA 3SMZA 3MCSA 1X7VA 2BM0A 1FHTA 2KG0A 3CCJS 3RRKA 1L3UA 1FRXA 4KV8A 4J37A 2FLPA 2LEAA 2ZOGA 3FEYB 1RKJA 1XK8A 5DO2A 5CH7B 3V2UC 1AFJA 1B0VA 1OWXA 2YCHA 4K59A 4H4MA 3P3DA 3H40A 3H4DA 3M30B 2RRAA 2FIUA 2GQ2A 3LPYA 4TYBA 3CPWR 3CCVS 2VQFF 2FGOA 4UQGA 4AXIA 4Z2XA 4C0OC 4F3MA 5D8HB 5KFKA 3I0SB 4KFBB 1N5TA 1IKXB 3U27A 4MAKA 4GO7X 4X4OA 3V6DA 4W92B 5SUHA 4NLYA 4Q0YA 2ZM6H 1L5UA 2A2CA 2V8HA 1ZAXA 2AP6A 4OHVA 3ICLA 1YIJS 2M8DB 1HPZA 4M8LA 3DDNA 4MKAA 4DOZA 4FM9A 1KTQA 5IQ6A 1V9OA 3DLEA 5HN0A 4RW4B 2Q79A 3IXQA 5K9FA 1UVNA 5KFSA 5KG0A 4IO1A 5B0BA 3CTRA 4I69A 3G96A 2LYVA 3EXCX 4MH8A 1NH7A 1WEZA 3KNGA 1SJRA 5LT5A 4QR0A 1JJ4A 2OPSA 3HZEA 2MKHA 5A8KB 1LFPA 5KT6A 1YRXA 4B08A 3PR5B 4J9LA 1Q82T 2RS8A 4UY8T 1PC4A 2XZWA 4ES3A 3CJ4A 2MYFA 4MYTA 1S6QB 4CT9A 2W4PA 5KG5A 1BY9A 3OXGA 3LQVA 3T5JA 1BC6A 1VC6A 4LF6H 2F3JA 1XR5A 1HWJA 3QLHA 3PO5A 1TV6A 2RU3A 2L48A 2WBRA 1AW0A 3G8TA 4K2XA 2MZ1A 3MAHA 4OX7A 3OJSA 1S76D 2QZ8A 3J7ZT 3J7A1 2QSWA 3N6MA 4DV1H 2J8AA 4DQRA 2CVIA 3L95X 5JVGQ 2OWOA 3T1AA 4NCAA 2KZZA 2GW8A 3V6HA 5GAGI 3W3SA 4MKBA 2LLZA 5D4PA 1QAYA 2DD8S 4HDHA 1G6BA 1OS5A 4LF4H 3MM6A 3R3TA 1D1UA 2ROEA 4RW8B 2J76E 4DV3F 2HPUA 3OVBA 3Q24A 2I5JB 2XC9A 1VQ5S 3BB5A 3X3UA 2MMYA 1HD1A 1X4FA 2G13A 3I0RB 4EEYA 3BEGB 3K8VA 2BOPA 4NLQA 5U47A 4I68A 4A8YA 2R8HA 4X64H 3THPA 2B5JB 4DFPA 5F8IA 4KHRA 5G4DA 2HWTA 3OHAA 3HXMA 1NK4A 1XMOH 5CZVA 2JL9A 3DRXA 3SFUA 2CRLA 4OZ1A 4PWDA 1LFWA 3DGPA 2VB6A 5A6PA 2DGUA 4F67A 2PA3A 2XEXA 5KFVA 4PXCA 3VCDA 2ZBIA 3OXFA 3TAQA 1C0UB 4LF7F 1RT6B 1FDAA 2DNLA 2AJ1A 1KVJA 3OL8A 4JYAH 1R8BA 4IDKA 3KXYT 3Q23A 1RYSA 4DV4H 1RT1A 4XPCA 3Q2TC 2VQEF 5FDLA 3C46A 5GAEI 2ASYA 5A8WA 3V81A 2IA6A 4K4VA 3DRSA 5THWA 2HHPA 2COLA 5F0WA 2OFHX 3A1YG 5DJBA 2ZOFA 4JV5F 2HNDB 5T7LB 1BGWA 3T9NA 3IS9A 1RDRA 2I9SA 3RGXA 3FGVA 1G7CB 1R31A 2F4VF 2EKYA 1D9FA 2M4MA 3GQCA 1R27B 5KAKA 4USHA 1IBKF 2OTLS 4R5PB 2ROPA 1RT4B 1TKDA 1ZHSA 3MUVP 4FF3A 3ZZTA 3H2UB 4DLGA 1VS3A 2WYOA 1YJNS 3QGPA 4FP9A 1BLUA 4O4RA 2RB7A 1X5TA 2MGZA 3TR5A 1TKXA 4NLRA 1FKPB 1H3DA 2V9KA 1U1MA 3F56A 4ERDA 5GAGU 3G8SA 4B3RH 3QWPA 4ECUA 1X4EA 2AQ4A 3N41B 2HHTA 3CVZA 4LJMA 5E3CA 5KFAA 3L2PA 2KYZA 3RW7A 1HWLA 5CZXA 2YWHA 1AN7A 4ITSA 1KEKA 1FK9B 1H98A 1UP1A 2M5YA 3CEDA 4XDDA 4OI1A 3IA0A 2CPJA 4PDBA 1LQ9A 1Q16B 3O44A 2UUCF 1HBNA 2ASDA 2CQIA 4WE1A 4EWTA 1JX4A 4WKYA 1EP4B 2UVWA 2ZH2A 2CW7A 2FTRA 2IMOA 2QA2A 5T41A 2FMME 3TARA 2M2BA 5B0CA 1WG1A 4A8MP 1T94A 4QR2A 3R1HA 2IBKA 5D78A 4KQZA 4DUYF 2LQ9A 2KT3A 2ZD1B 2HGMA 2QYCA 2HAIA 5KFZA 3A8EA 3BO2A 3PRDA 2QEXS 3HHLD 2C22A 1CLFA 2RSQA 2I38A 4WK1A 3CCZA 3VF0B 1OQ6A 2GGPA 2RKIB 3AHPA 1DRZA 4I67A 3GILA 4JI8H 2YY3A 2HQIA 2DO4A 3IBWA 2FVPA 1KFSA 2UUAH 3GV8B 1F2GA 3OLAA 4DF8A 2B7CB 3TAMB 1U1RA 2Q66A 1URNA 4WKRA 5KT3A 2PDAA 4IAJA 4NCGB 1IKWB 2XMUA 4AL7A 1TVRB 5B0EA 1N6QB 4DLEA 4LFBF 3QPIA 4DR4H 3ZC4A 4WU2A 3JSMA 3K5MA 1APSA 4RLEA 4WYLA 1DBDA 1TL3B 1ZPVA 4JV0A 1OPIA 1ZPWX 3SV4A 4O4GA 5F41A 3UWTA 1Z2NX 5KFDA 1VK3A 3R5BA 4LF8H 2RQCA 2CQBA 2IBOA 1FKOA 2A1BA 1WD6A 3RF2A 3QIPB 2XS2A 1SI9A 5GVQA 5C24B 4B9NA 4MTEA 3ULHA 2CQ4A 2OD4A 4QYZJ 4IG0A 3ISND 2CQDA 3OQ2A 2A3JA 2IHR1 5K14B 1VRTB 5LMNF 3IRXB 4A8KA 4JI1F 3KG1A 7FDRA 3H2VE 1U7LA 2YKMB 3UE2A 1DZ5A 3HHLB 3M8PA 2DGVA 4EYIB 3UCZP 4I2QA 3C0FB 4O3OA 2BZ2A 2JLGA 4X62H 3TYTA 5LSRA 3JSNA 1UJ5A 2OAUA 5E5NA 2L9WA 3T9ZA 4PQUB 3CJ5A 1JLAA 4KHMA 5AXNA 3RIZA 1N48A 1T02A 1O8BA 1S1UA 2XULA 3VTIA 1SJFA 3S7RA 4ZCKA 2CW8A 5J1NA 1YBAA 3M9MB 4EUVA 2W57A 2V8DA 4OMFG 1X9MA 4FXVA 5I3PA 1SJ1A 4ZKAA 1XN9A 2P9GA 2V2KA 2GNKA 1HMVA 2GFFA 3M2VA 3JTNA 4OJ1A 1FERA 4CH1A 5J2NA 5KG2A 1HYSA 3BGLA 5F8LA 1CQNA 2RT3A 5BR8F 2O66A 4ZPWR 3DYAA 1IJEB 1EETB 2F8MA 5AXMA 3C6TA 3T19A 4CCHA 2AU0A 1JXLA 3CULA 3IAS9 4IOAQ 3TA0A 2MB0B 2MXYA 1SKRA 5EDWA 1FD8A 1S9EB 5KT2A 1S1WB 2CKWA 3MPWA 1X5PA 3TNVA 3ZZZA 3CE8A 2AWZA 5M2PA 1LW2B 2AD9A 1TKZB 4G1QA 4JI5H 1J5OB 1QSSA 3V4IA 4O44A 2CDQA 2AYMA 5JVHQ 3TVYA 1RA6A 2KFNA