3H20A

Crystal structure of primase repb'
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
288
Chain Sequence
RTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKKHTTYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLERRTALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKHEADYIERTVSKVMGLPSVQLARAELARAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
molecule tags Replication
molecule keywords Replication protein B
total genus 99
structure length 288
sequence length 303
ec nomenclature ec 2.7.7.-:
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16793 RepB_primase RepB DNA-primase from phage plasmid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3h20A04
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h20A02
3.30.1490.240 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3h20A01
3H25A 3M1MA 3H20A
chains in the Genus database with same CATH superfamily
4FF2A 1DFDA 2KN4A 3SMZA 3LGMA 1M1HA 2HPUA 4P6QA 5D3GB 5LMNF 4CC5A 4AYBD 2BBEA 3LO3A 2BE9B 3FGVA 4ANCA 3RB4A 4YB7A 3M30B 4DV6F 1RKJA 2DNHA 4P75A 1KSPA 4GC7A 3QFFA 5HROA 4DV4F 3TJAA 5MAOA 4NZ7A 2F7VA 2AYMA 1XMOF 3O2IA 2RB7A 2YTCA 5C44G 4OHZA 5G0RA 3THTA 2V34A 2AW0A 1NBEB 2BANB 2YW2A 3W7BA 4J37A 4PG5A 2BM0A 2C2DA 2QE5A 4X65J 1UC9A 3HKWA 2G0IA 2ZH7A 1T9TA 1YITS 2UUBF 4DU7A 2W1BA 4OI1A 3TAMA 2B5JB 1N5VA 3BJDA 4QR2A 1RWVB 3GCWP 2W25A 3MM7B 2XCAA 3PDNA 4CNZA 4CIOA 2H5EA 2FJBB 1JLCB 1H3DA 2IVFB 2F4VF 1RT6B 2G2OA 3TANA 3I9ZA 3TQEA 1O8BA 2GZOA 4GVBB 4U95A 1IUJA 3M8QA 1Y3KA 2CQYA 2UU9J 2ZH2A 3BGUA 2RHQB 3D0IE 2P9GA 1JLBA 5J2UF 3ZZUA 2WW4A 2AX0A 4JV2A 1NK0A 4R5PA 2W2NP 3N4WA 2MKJA 2QSWA 3V4IB 1SI9A 1L5UA 3CCRS 4EBDA 2BRKA 1F2HA 3GG0A 3IG1A 3MAAA 3BG5A 3T3FA 5KX5F 3KK1A 4LF7F 3MMCB 3R5CA 2PT0A 2C2KB 1YIJS 1VRTA 4CLKA 2CJYB 4A48A 3ZO7A 4IG0B 1FDNA 3GSIA 3G8SA 3NCQA 4OI3A 1O5JA 2J9GA 5KFEA 1YZ6A 3KJFB 2E9RX 4JGIA 1NDLA 4C48A 1EQMA 2J9EA 2NCKL 1FJCA 1RWNB 4C5BA 3MAHA 3ZZPA 2VB6A 4DPUA 1MLAA 2HHWA 1OY8A 4YDXA 2I0XA 3CDEA 3G6ES 1PYOB 3IVAA 1HI1A 1OIAA 2D1CA 5B0FA 4A4JA 4U67Q 5KG7A 1K98A 2ATLA 1LK7A 4I64A 4A3EG 1XNQH 1UP1A 3VMMA 1TVRA 4C8ZA 3J81U 2DIKA 2W8LA 1Q8BA 1TKTA 4ETXA 1XNRJ 3DYAA 3RW7A 1IBKJ 4TU8A 2VOOA 2DY9A 2H4YB 4I68A 4QWCA 3WHIA 2YRXA 5LA6F 5LMNJ 1S1VB 4PWWA 4A46A 4EO8A 2VBWA 2UV8G 1VKZA 1XERA 2V63A 3VZHA 1I94J 4C6AA 4R8UA 1VQNS 1IKYA 2R3VA 2LDIA 2ADBA 4UCVA 2EKNA 4P73A 3UVJB 4A8XA 4I7FA 2H51B 3C6UA 3TUZC 1DTTB 5H80A 2GIFA 1MG7A 3H90A 4V19X 5D4NA 4ER8A 2I1RA 3PRBA 1AYEA 4AE5A 4RNHA 4UOCA 1TKXA 2PA3A 3PEJA 4JBCA 3VAJA 2G1DA 2XWYA 2PD1A 3JQKA 5LL6d 3N5BA 4RNFA 5B0AA 4M5IA 3UI3A 4IH7A 2ZDGA 2DZDA 2EXUA 2OD6A 1L3SA 3R5BA 4XYLB 4XPCA 3IMQJ 4F25A 3SZ2A 2CWXA 2FQQB 4KJIA 3W2WB 3CCWA 5KT6A 5KT5A 3WIUA 2XY7A 5GADU 2X1AA 4A8SA 2DHSA 4F7VA 3NG8A 2ALZA 2YNHB 2CQ2A 5T41A 4PXCA 2OMLA 3J7AK 1Q8IA 4J9UE 4E4TA 2NZ4A 1B7YB 3DDIA 2UXBH 1RJPA 5DGAA 4KR0B 2BE2A 2LU1A 2YQ1A 3SSSA 2Z58B 1ZPWX 4PQUB 3H20A 5K8MA 3HVRA 2C1EB 2X51A 4KKOA 1X8DA 2XZWA 4Z7CA 5A8RA 4USJC 3I87A 2DR6A 2RHSB 4DMZA 5KG0A 3BGFA 2ZBIA 2K8GA 3CD6S 5H9FK 4RPFA 2V9WA 4LF5J 1TL7B 2HHVA 2KM8B 4I67A 4NLRA 2XG8A 1TMMA 3QQCD 3JQMA 4LRCA 3MGJA 1KBLA 2VFVA 5KFYA 1X4EA 4KKOB 1Y4ZB 2RH3A 1VQPS 2VJUA 4USTA 3FC9A 3MTKA 3KK3A 1T9UA 1C0TA 4IQMA 3CJKB 1FE4A 1CQJB 2XGQA 3OQ2A 1NK5A 3UD4P 4AL5A 3DRPB 1MWQA 3PN1A 1S1TB 1TVRB 1V4YA 2HHHH 5A2QW 2YZNA 1I1GA 1FRJA 4LRDA 4LF8H 3H0GA 4A2AA 2ZUAA 1QTNB 3W64A 2BKPA 1IJFB 4P7TA 2EWHA 4IG3B 2UVUA 3PR5B 2BABA 4IDKA 2NVXA 4DR7F 2VBYA 1E4EB 1E4GT 4HR7A 4O0NA 4BHQA 2X1BA 2C35B 2Y0SD 2MLZA 3BBFA 2OEMA 4RU9A 3ILLA 1F3FA 1WDDA 4DSEA 1D8ZA 2FGOA 2LMIA 2Z4PA 1T3NA 2BUNA 1D9AA 1KQGB 2Z56B 1KQSR 2RS2A 4J9NA 4G1QA 3D3BJ 3E51A 1FJEB 3LA0A 2B9EA 3TVKA 2SCUB 1WCMG 2ACYA 2ATCB 2Y8WA 3FMAA 1X4DA 2Q43A 5BPHA 2OWOA 4C97A 5LXRA 2L08A 2HZVA 4HI1A 4DXLA 3W63A 1KJJA 1BUXA 2NXUA 2GJFA 4IH6A 3KAJA 3RJMB 2R4FA 4AL6A 4N8NA 4FYVB 1C1BA 4HDGA 4AQYJ 4USUA 2LDYA 3NKYA 2R7KA 2BJ8A 1RI7A 2A0FB 4ZPAA 4ZLPA 1P6TA 2ZH3A 1GXTA 2PN6A 3EGVA 2DNOA 3D66A 2LQJA 1TV6B 4MFBA 4QYZJ 1I7LA 2W6PA 2BANA 3TEHB 1VOMA 1RKIA 3MMBA 4B9UA 1H73A 4IOAQ 4LF4H 3TI0A 3MEEA 4B9MA 3U7JA 4UCUA 2MQOA 2HNYB 5IYBG 1WTFA 4KHPJ 3J7YU 3DMJA 1UWBA 5ETVA 1JNZB 2R82A 2Q2UA 2CZVC 5B0CA 4LSAA 1H74A 1NSKL 4FS1A 2WDTA 3M30A 3UNGC 3FMBA 1RTJB 1LWXA 3BO2A 2RUGA 3VGVA 3T5KA 3PRDA 3K0JA 4DS5A 1CQNA 1VMBA 2XSFA 1XMOH 2KRRA 4D3HA 2BQRA 3KTQA 4OZJA 2YZMA 1WEYA 4RWXA 2OPRA 1DRZA 3M2RA 2LQ9A 4B9VA 2PI5A 2VDIA 2LFVA 4USWA 2ASDA 4OMFG 4JV0A 5LOVF 1SQGA 3GB0A 3SBMA 2AZ1A 1JIHA 2W2PP 2KTQA 1LW2A 3ULHA 3GYXB 3BO4A 5LP6F 1WSCA 2UUAJ 2QGFB 1S6QB 4HNTA 2XLIA 3ET6B 2AGOA 2YKMB 4IR9A 3OT9A 4GMKA 1FKOB 3M32B 3BJYA 5AXKA 1BQNB 1FXDA 4K0KF 2K7KA 4Y2IA 5ETQA 3HPOA 2C2NA 3CULA 5K2MA 3S6EA 5DJBA 1HNZH 1MN9A 3HFKA 1KVIA 4G3IA 2O1PA 3BEGB 4RNNA 3MEGB 4AL7A 3MMBB 4BBSG 3Q8UA 3VAIA 4DUTA 2VZ9A 2KHCA 3KXDA 1NSPA 3LOUA 2V8VA 3M32A 3HD2A 3SQOP 4J5OA 5IT0A 2E5JA 3ET6A 1YG0A 4JB8B 4N76A 3CEDA 4FVCA 2X0SA 2P0AA 4WTOB 2CQ4A 3TUPA 4DSKA 1JXLA 1S6PA 1RISA 2AIRB 3K2YA 3R1HA 2E7VA 1I50A 1VQ7S 1VBKA 2QLJB 2A2DA 3D28A 3M7VA 1VBZA 2ADCA 3OSNA 3K58A 4W98A 1D3WA 2HEKA 5KG3A 4DEZA 4EBEA 3K5IA 3CE8A 1RT5B 4OZ0A 4DR1J 1Z1ZA 1HNVA 4YAJB 4RW8A 1RUSA 1ZAWA 5L38A 2XMTA 1PC5A 3T5JA 7AT1B 3C6UB 2DITA 1X5PA 1ZM3A 4B3RH 4CH7A 2W70A 1CULB 1OO0B 3F41A 5DM6Q 1RT6A 4R0JA 5KFRA 1WF0A 1HQ2A 1BC6A 3HO1A 3MTJA 3IRXA 3T5HA 3GYNA 4ECSA 2ABYA 3HOYG 3GTKA 3HOVG 3CDAA 2HHHF 4RUBA 3KHHA 3CQZA 4Q43A 2W4CA 2DO0A 1SH3A 2HWHA 3BYRA 1C4AA 4HNUA 2JWNA 4I6YA 3QO9B 4E0DA 2DD8S 4YAKB 4QJFA 2E5LH 3EZ5A 2GHPA 3MMJA 2YRWA 5D3GA 4RAYA 4DOZA 2XWXA 3FCHA 2EFQA 1T8EA 2QEXS 4QWAA 4B9LA 1JXVA 4OX6A 5EGYA 1PCAA 1S49A 4G86A 3L09A 3PKMA 1WHXA 3OTEA 3X1LB 2DK2A 4X8QA 4KPCA 2HHQA 4ILRA 1HMVA 1RHRB 5FPRA 3AOAA 4NYPA 1KQFB 5F8LA 3VALA 5GVQA 3EDRB 4E2FB 1GX5A 1TQLA 3OL8A 4DZ6A 3CCSS 5J2PA 2HBYB 1KOOA 4RZRA 4J9MA 1NDCA 3MDFA 3LP2A 3NNCA 4IRKA 4BWSC 4BC7A 1BXRA 1RJRA 5CZVA 1VC6A 5L9NA 3FZBA 2CNNB 4X66J 5U47A 3GJSB 5DDPC 3K5MA 4IRDA 2R85A 1WD6A 2G0JA 3RGIA 1SH0A 1MZBA 1HBUB 1P8LA 5HJYA 1WC0A 2W9CB 1RAGB 3KJVB 1URNA 2DNYA 2FYXA 4ZKAA 3IFEA 2ERRA 2FTRA 1SPBP 2DWCA 3SSRA 1UL3A 3W8PA 1G7CB 2WB1E 2MHEA 2ZZMA 3VPCA 5IQ6A 1HQEA 2MKKA 2ZBRA 2ASJA 3DC2A 4AFFA 3CCZA 3CJ5A 4PQUA 3RZAA 4A3MG 4CM2A 2QG9B 3CCLS 2KYXA 4A93G 2UUAF 5JQWA 5H1SV 1GTEA 1UCNA 2D74B 3TA0A 3D6TB 1M1GA 2CQHA 5HANA 2R84A 1HWIA 3TZXA 4OJGA 4LFAF 4CLLA 3TJ9A 1WCMA 2DR7A 3C14A 1TUGB 1TKTB 3T1YH 2V4JB 3OFGA 4X4VA 2R2SA 6FDRA 2EK6A 2VQEH 5KFMA 5HMXA 1W26A 1WC6A 4C11A 4ZPBA 1UZDA 3CJTA 3HHLA 4ED5A 1T03A 1J27A 5B0GA 3CDWA 1U47A 2B3TB 2AEJA 3MPYA 2B9WA 3VTIA 3H40A 1KVKA 1Q6AA 3I4HX 2P8IA 1NDKA 4LH6A 4OV6A 1R6YA 3MM5B 4NXNH 4YMEA 3UN5A 1B7FA 5CA1F 4PWDB 2VPWB 3BH7B 2R7ZG 5D1OA 3U1MA 5L1LA 3VR1A 4K0KJ 4DS4A 1RA7A 1F60B 4B3TF 1JMTA 1OY6A 3V6DA 5CABA 1GAOA 1DV1A 1VS3A 2JA6G 3W65A 3QRPA 3K89A 4LF9F 1IOVA 4NZ0A 3GYGA 1SXLA 2OFHX 3M9NB 4O4HF 4IUFA 4NRTA 1JLGA 4JI5F 5GMKa 1Q5YA 1X5OA 1U8WA 1MSWD 4N56A 3AA8A 2R9LA 5J2PB 4PAAA 4FPRA 3TX8A 2I2YA 4ZVEA 1RT7A 1HKAA 2D69A 3UPFA 3Q8VA 1N33F 1J2VA 2DR5A 3D68A 4JI0F 4LT6A 2YQ0A 1ZETA 5LT5A 2K2PA 3AD8C 3W9HA 3OFEA 3GE9A 1Q53A 1UVNA 1Z2PX 2V2QA 3JSBA 2VG7B 4KY3A 1QLNA 4I0WA 4QPTA 3GLKA 3BGRB 4KFBA 2GIQA 4N8OA 4MK7A 2RGVA 2JLEA 1K8AT 1U45A 2ZJPQ 3IM9A 4KSEB 5DG7A 4A47A 3ONQA 4OX9H 1YRTA 1S1UB 4A8QA 4TYBA 3VF0B 4LFBH 1G2EA 4MV6A 1YJ7A 2G2YA 4M7EA 3QGPA 5MLCV 2P6TA 2LECA 2I80A 3WNZA 2KZZA 3EZUA 1MMLA 4HDHA 4UY85 1NPRA 4ANEA 1N34H 3KDOA 5KFAA 3DF7A 3TR5A 1RTJA 1NJYA 1KEEA 3ZZYA 2ZBQA 2CPIA 3MPUB 4ES3A 2YWKA 2F8MA 4CO4A 2W4DA 2XSJA 2XS7A 4B02A 2QJ3A 1S68A 1NH7A 4DSLA 3C2PA 1P1TA 2RRAA 1RU2A 5RUBA 3CJRA 3MMAB 4C0OC 1N88A 3UW1A 3OFFA 3OR1B 2NXJA 1PJ6A 1Q1KA 2BM1A 4Y65A 3IV9A 4PR6A 3M6UA 2NSBA 5HROB 4OJ1A 4CLFA 4GRSA 2RU3A 2GV1A 2XSJB 4DR5F 5KG5A 2QSFA 3CMAS 3RG6A 1S0MA 3JS9A 4WYWA 1NXIA 1A0OB 3G82B 2VPSA 3O44A 3CC7S 1HNIA 4DL6A 1LWFB 3SCIE 4F67A 3SV4A 4IFVB 1CBKA 2KM8C 2GMLA 4NXNF 5E3CA 4CT8A 2POKA 1IBCB 5GADI 1HNXF 2JLGA 3QIPA 4WE1B 4KYZA 3UCZP 5E7OB 3H4BA 3D1HA 2FJEB 2CPDA 4LRBA 2ALYB 1T05B 3KLGA 1CJTA 4ELUA 2FMAA 2ILYA 3AB4B 3LP8A 3PY8A 4ZVGA 2YL2A 2OI2A 3B82A 2Q1LA 3SV3A 3GV7B 2GA7A 1RK8A 3OPKA 1EP4A 2BKOA 3QSIA 1RLCL 2WBMA 2NYHA 2DB1A 4JI7H 3BABA 2DIVA 3CCTA 4JI3J 2IIHA 3K5HA 1SUYA 4JI6J 3QIDA 1FXLA 2BJEA 4DCJB 3PX0A 1RWMB 2BV3A 2JEGA 4NEZA 2FK1A 2CW8A 1WOPA 4UT4A 3H0GG 3EM1A 5L8RC 1B0TA 2YKQA 4JI0J 3KLVA 4M95A 3NOGA 4PG4A 5KFUA 5KG1A 4LFAJ 3GTMA 3LH2S 4HT5A 4LR8A 1V9PA 2YKPA 1S76D 5LMUH 2ZJRQ 4ZVTB 1BQMA 1C1CB 4WFYA 2DHHA 3HT3A 3VAKA 2BMBA 3R8YA 3UD3P 3I0SB 2VQFF 2OAUA 4DUZH 2K06A 4P9SA 4DLKA 5K14A 2HK3A 5L9XA 3BQ1A 2ZDPA 2FJZA 1OPZA 4Y2CA 2HS4A 3MECB 2XNQA 2QFIA 1WG1A 1Q86T 3P3DA 2PMZD 4TV8F 4RLEA 2BR0A 3KK2B 2AQ4A 3G71S 4RUCA 4PXEA 4KHPF 3HX9A 2F63A 1ZZNA 1KJQA 4L73A 4QIWA 3JSYA 3K17A 1R31A 3JAMW 5L46A 4X65H 4EYIB 1NMEB 3M8QB 2GMHA 1DQ9A 3CJ4A 3EVOA 3A4TA 2IM2A 2FDNA 4M5JA 1HNXH 5AJ3F 3ELHA 2QL9B 3ZZZA 1RTDA 3U02A 5BYSA 2RKIA 3T6BA 4NCAA 4C8YA 4I2PB 4CO0A 1IWAA 3NS7B 2IC3B 4JOUA 5T7LA 3R2DJ 5JVHQ 2B5JA 3I6PA 3GTPA 1BY9A 1RT2A 4MIWA 2ZM6F 4IG0A 3OJUA 1NAQA 4NA1A 1RB0A 3TUJC 3HOXG 4B9TA 1PAUB 3N44B 3HHDA 3GFZA 2NR0A 5B09A 1NZAA 5B0EA 3FCWA 4U9RA 3V4MA 3EGZA 7FD1A 1M7JA 2VPQA 1H6KX 5L1IA 5LYJF 3R7NB 2J7WA 2XMKA 4URGA 1T03B 3S1TA 2CQDA 1NHUA 1FRHA 4IG3A 3C46A 1M0TA 3BS9A 1A9NB 2FHJD 5D4OA 4DSFA 2JA7A 2W2OP 3AJ1A 1V3ZA 3O1LA 1VRUA 3N0VA 2NPFA 1OQ3A 5F0WA 3GWCA 4Z37A 4RW4B 1LFPA 1K1QA 3MECA 5FD5A 1XMQH 3NNHA 1I94F 2OFGX 1JDBB 3QGGA 4LFBF 2C2EA 3M2VA 1CJKA 5GAHU 3SI8A 5IFMA 1DQAA 2A10A 2MQ8A 4NLUA 4IOCQ 2ZH5A 1NDPA 3NAIA 3TO8A 1TAUA 4KIAA 1E4FT 4ETZA 1PC4A 1DTTA 3KAKA 3ORQA 3EGWB 2YNFB 1N4LA 1U0HA 2HJWA 1Y5NB 2FJAB 3DOMB 5H9FJ 5D4PA 5K5MA 1LW0A 3G86A 4DL5A 1ZTTA 1B04A 3AXKA 2E1AA 2WOMA 5HVHA 3E01A 2J70A 4IZOA 2RIJA 2G9OA 1GH8A 3IGVA 3T1HH 1Z2NX 4RW7A 3E8OA 1N5YA 2RE1A 1W2BR 3FKBA 2R86A 1B33N 3NY0A 3OXGA 3CVKA 4X64H 4MV1A 1PSDA 3BGOP 4JI5H 1U2FA 4DV1F 2ASLA 1N0UA 4KQZA 4FNHA 4LFCH 4DN0A 3DKDA 2I5JA 4TY8B 4URQU 4MYTA 3SQGB 2NXNA 4ZVHA 2V69A 2MTLA 1FFSB 3H0PA 4DL2A 1IKXB 2FJWA 1O0PA 2ZHOA 2HFOA 2VG5B 4QU7A 5KT7A 4NA2A 1CJVA 5D0GA 2CKWA 4USVA 2BE7D 2J0SD 1TKZB 4W4MA 4CLTA 3PW5A 2HVQA 5LSRA 3AJ2A 3MOZA 3TOQA 4WD3A 4DBQA 1HBUA 1TWAA 4DX5A 1RWWB 4OJHA 2LXUA 3RAMA 4U7CA 2WHOA 4RBUA 3M2UB 2QMXA 2W24A 3HD1A 4ZN3A 2UP1A 2VR1A 3NP5A 4CLPA 2X7IA 3MPDA 1LWCA 4QU6A 3TAMB 5FD6A 3KHGA 1TKZA 2VL1A 2J6UA 1JB0C 4KH0B 4AYBA 4M1KA 2FC8A 3NEKA 2E29A 1U0SA 2ZHAA 3M9MB 5HI7A 2RT3A 2W9AA 2KU7A 3RRGA 2E5HA 2XC9A 4DV2H 1WORA 3AT1B 1Y0HA 4NLWA 4ZIVA 4DCPB 3PW4A 4YUDA 4J9LA 1QUPA 2YY3A 2ZE2B 3PXGa 3RBXA 4C11B 2D3UA 3LPEA 1H98A 5E2QA 5C25B 3C15A 2JX2A 5KFGA 4R25A 1NHKL 2ZVIA 3DOLA 2V58A 1CSJA 1JLQB 4C2MA 4DV0J 1TR0A 1DBDA 3MM5A 4MTEA 1LXNA 1O51A 3TIGA 1CC7A 3DN9A 1LW0B 2PSZA 1FD2A 3A12A 1QVFR 3GONA 1HL6A 2FVCA 3J7Z5 2E1MC 3IBFB 3G4SS 4E8UA 3CCJS 4UQGA 2BW7A 4G65A 3VAMA 3JSNA 2LA6A 5CXTA 1HPZB 1CE8A 3JTOA 3HSDA 3MD1A 1OJ4A 2W2QP 3HSJA 4RU2A 2IM0A 4M63A 2DNZA 2JVOA 3KUEA 3VGTA 4X4QA 2W57A 1SJRA 2IM3A 1EUDB 3JYTA 1HWKA 1FKPB 1VLOA 2R8GA 1L3UA 3C66A 3AYHB 4I2PA 1RJQA 3UNYA 3KNAA 2VD3A 1FEHA 4A8MP 1RK5A 2EBGA 3EVWA 2JH3A 2HNZB 3J7A1 3N6XA 3MEEB 1F1BB 1VDHA 1SCJB 3D7SB 2CPEA 3PJWA 5ETRA 1V3RA 3K5LA 5D0HA 1I51B 2JVRA 4H4MB 1M5VC 3HXLA 3W1YC 2ZD1B 1V2ZA 5E3PA 3KG0A 2R2TA 2WVEA 1UJ4A 2JNJA 2YZGA 3UDCA 4DL7A 1HW8A 2H4WB 1SKWA 2WW8A 2R93G 4HLBA 4IOBA 1JLGB 5IT9Y 2UXDF 3IGNA 5HQLA 2IBKA 4ATNA 1U26A 2B9XA 4LF6H 1VBYA 1RYRA 2OUGA 2CAJA 3AD7C 4ILLA 4FN5A 1IBLH 4TVAB 5D6GA 2IPOB 4P71A 5C1OA 1Q16B 2FZKB 4CH1A 4GVLA 2V5HG 3R5JB 3D1QA 2HFUA 1N5SA 1HNZF 3TAPA 1FO1A 2VDHA 2F8EX 1W25A 3D54A 4OI4A 4B3MF 4M5HA 2E44A 2ROGA 1C2PA 2VIHA 2UVVA 3BZQA 1RACB 1B0VA 2ZWOA 1N5TA 2DNNA 3ZTRA 1T7PA 4WFBQ 1WTBA 1GTHA 2NXEA 1NK7A 4KRWA 4YHHJ 3OR1A 3F56A 4ECUA 2HNZA 4MKYA 2A18A 2XCPA 4NXMJ 1Y5LB 5FPOA 1VK3A 3F73A 3V6KA 4EEQA 2V4JA 3IWLA 2YWWA 1OQ6A 1HW9A 3T1HJ 1JLQA 2EFGA 1TL1A 4JI4H 3OD2A 1FHTA 4FXDA 4DR6J 3MM6B 4F04B 3E2EA 1FA0A 1VRUB 3W2VB 4USMA 1ZYQA 4X62J 1GSHA 1XR6A 2IA6A 1X4HA 3CMQA 1TA8A 4C7QA 3Q8QB 5AE2A 4DWIA 4P2MA 4HH3C 1HWJA 2FB9A 3UE2A 1RE1B 3TEGA 1GO3E 4LF2A 2FPPB 4ERDA 4Q2MA 3PFOA 2M70A 3BBCA 1ZHSA 1UKUA 2C2MB 1XWLA 2Q66A 2LA4A 3NGRA 3SQGA 2E2IA 2JA7G 3EGNA 1NUEA 4O3OA 3H4DA 2RDJA 2PFFB 2M52A 3ENVA 1QUVA 4ECYA 1U49A 2ILZA 2NREA 1U02A 4U6PA 1SL0A 2YPZA 2W71A 2ZJTA 4KGXB 2Z30B 2DXFA 3C6TA 1F9EB 4MA5A 4ICLA 1U25A 2L9DA 2WBRA 1QAXA 2RAQA 3R23A 1W96A 2ZM6J 4O4GB 1HYSB 3LWMA 5KFXA 4NCBA 4QW8A 5IV4A 3HVTB 1S03G 2OLSA 1NPKA 5CH7B 1GT8A 1ZOTA 2EPIA 2ZH6A 2W6NA 2BQ3A 4UW2A 1R0CB 4DQRA 1TTHB 5AT1B 1HHSA 2Q79A 1R0BG 1NK6A 1T94A 1X4FA 2OELA 1JK9B 3OL7A 1HBMA 2MZRA 2MQNA 3NCRA 2JFKA 1HFEL 2CFXA 1T9VA 2I8CA 4ZDNA 4RL1A 3OJSA 4WTYA 5A8WB 2KFNA 3K5OA 3LGNA 4LQ3A 3H2VE 2PMWA 5ETTA 4NLDA 3PYDA 3DHXA 5SUHA 5IWAH 2VBXA 4HKQA 4BBRG 4WK3A 2JFDA 4OZ3A 2CADA 3KYLA 1HBNA 3IS9A 2KSWA 3HK2A 4DX8H 2RF4A 2KJWA 1WKJA 3HVAA 1RCOB 4LF1A 2GGPA 5ETLA 4KGVB 1KRPA 4QPXA 4LSNB 5H9EJ 3WDOA 1RT1B 3K57A 2PI4A 2ZBCA 2FGCA 1WI8A 1RAJA 2XHCA 4MV9A 4ZVOB 1PGZA 5CAEB 2YYAA 3S7RA 3E5NA 1BD6A 1S9GB 2UVWA 1RHKB 3R2CJ 1FF2A 3U1LA 4O4GA 3Q8SB 2OLWA 4K4TA 3NBPA 4LMYA 5ADZA 1AB8A 2FZCB 2RQMA 3IC1A 1Q5VA 2YNHA 1ZZFA 2DO4A 2QIFA 3ZZTA 4QWBA 1QSAA 1U6ZA 4F0HA 2VQEF 3CC4S 4KPYA 3CJ0A 1FXRA 2QT7A 2FLOA 1HNWJ 1CC8A 3RGXA 2B4UA 2GNKA 4YB5A 6FD1A 2DPJA 4PXDA 4F26A 4KGMA 4DV4H 1Y1VA 1RJJA 4Y34A 4YR0A 1ZTWA 2V2VA 1N33J 3A1YG 3HHLB 3U9TA 4U7UK 1TK0A 2H1YA 2FZGB 2AV5A 5KFQA 3KLIB 1OPIA 1U6FA 5J1NA 2XCLA 2V5AA 3QJJA 4DR7H 2E9ZA 4OV1A 4LBPA 1RAHB 4O2BF 2CQBA 4DR6F 2WB1A 2JA8G 1CVJA 1FKAH 1DLOB 4ZK7M 1IBLF 1QD1A 4X64J 2Z2MA 1E6YA 5JVLA 2LYVA 4ZCIA 3QATA 1D1UA 3QGHA 4IR1A 2JZ5A 1G6BA 1LWEA 1GXUA 3KLIA 2VC1A 4P2FA 3OHAA 2I87A 1YJUA 1S57A 4X66F 5CA0F 1F5AA 4DV1J 4QJVA 5AE1A 4CI0B 4ZVQB 1JLEA 3BSAA 1Q7LB 2CYYA 3K3PA 4DN9A 4OHYA 1B3TA 1KFSA 1FWLA 2KHDA 1TK8A 4L75A 1TUWA 5HAOA 2OH2A 5BR8H 2CJKA 1ULZA 5CA5A 2CG4A 1ZA2B 3OLAA 5C24B 1WH2A 4G1IA 3L4KA 2X1FA 2EBEA 1FRXA 1KJ8A 4ZJQA 1FFGB 1JWWA 1UW9A 2YKNA 4DG1B 4LBIA 3RF2A 3QYYA 5HQ8A 4Q5VA 1IBMJ 4LQ9A 4XZ3B 1FVIA 1SV5A 4ZCMA 3IAS9 4ETSA 2CWKA 2NS1B 4DHVA 2J6TA 4NRUA 1S4EA 2HHPA 1U1MA 1TL1B 1OWXA 5EX3A 4PWDA 2ZDQA 4JYAF 1KLMB 5C2CA 4A8KA 4WFZA 1KJ9A 2DT9A 1S6OA 4P52A 2V4RA 4UQTA 5SZTA 3WC2A 3R6LB 1DGSA 3MI7X 2IBOA 3GG1A 2DXEA 3DLGB 3MR7A 1U09A 2FY1A 4RB3C 2EC2A 4HYKA 1ROFA 2W9CA 4AXJA 3JRWA 4YR3A 3VWSA 3H59A 2VG6A 1CQMA 3RTVA 3MM7A 4C4WA 4DR2H 2FVQA 1RTIB 5KFBA 3CTRA 2HKEA 1V51A 1RTDB 5IM0A 2IVMA 3PFEA 2IMOA 1QVGR 4RNMA 1JXEA 3GTQA 4J9PA 4M5DB 3FEYB 3FCVA 4CO3A 2IY5B 1IKVB 1KEKA 1GMWD 1AUVA 1C0TB 1DTQB 4NLVA 4PG7A 5F9NA 4O44A 2VF3A 2QYZA 2HHSA 1RA6A 3CB4A 4QBUA 3MR6A 4WFNQ 1WG4A 1VC0A 5HP1B 1C30A 4A8OA 4URSA 5EX0A 4DV5F 3HVTA 1YI2S 1S1UA 2M8HA 2FHKA 5CQGA 4LF7H 3GFHA 2DGVA 4A3DG 2BJ3A 2RDDA 3KJVA 3RW6A 1VGYA 4JI8J 1XNQF 1KDNA 1PBUA 2FKLA 2HBRB 3Q22A 2XY6A 1UVLA 4YP3A 1E6VB 1RT3B 5F3ZA 4XPEA 4DUYJ 3MXHP 1LWEB 3GTOA 4WE1A 4CO1A 4LF4F 1DURA 5KT2A 2YWGA 4IAJA 1MNEA 3MJFA 4ZHRB 1S6QA 3SEOA 1VS0A 5J1EB 5C8DA 1UPMB 1EARA 3NGUA 1SYXB 2WSFC 3HJVA 1AW0A 3IA0A 2PGCA 4EZ6A 2RNEA 1NO8A 4ELVA 2AD9A 2O3DA 4P74A 5LJ3Y 1M5SA 3BPSP 4NLTA 2H54B 3A3OB 3MAAB 4HTJA 3DRYA 3R6GB 1GYFA 2JEFA 2DNQA 4LRAA 4C8MA 2HAIA 5J2MA 4DV2F 2K1RA 2HGMA 4X62H 3LP2B 3RR8A 2MQLA 3D6HB 4A8YA 5KFKA 5KFNA 4CNYA 4KV8B 1FX2A 2BEFA 3R5XA 5CB4F 4KO0B 4N77A 4I50F 1ZQ7A 3N40P 1WOSA 3V81A 2AEMA 2P5VA 3TZZA 2DGTA 2WVFA 2XTJP 3QIPB 3QPIA 5FLXY 2DCLA 3CF5Q 3UCUP 2CXEA 1UJ6A 3KG4A 3PW0A 5C1PA 3ZTQA 4NYZA 2DVIA 1YHQS 2XMMA 4CZCA 1Q78A 4LJMA 1NJZA 4C98A 2B8QA 3NOCA 4CYUA 3EE3A 4LVNP 1X5TA 2FPHX 4WP3A 4O3NA 1TFWA 4CDIA 2KG1A 4OI2A 4DV5J 4HEA9 1R89A 3D0HE 2L48A 4CQ1A 2CKZB 4QCLA 2RGRA 2DXDA 3P45B 4U96A 3HVWA 2AX1A 1AZSB 2ZH4A 1Y9OA 4R8UB 1B0PA 1IM6A 2L3MA 3LALA 3BSCA 1HBMB 2L9WA 4R0EA 1Q7YT 1FDDA 2HQIA 4FKXA 1K83A 1BQMB 1LWFA 5E0OA 3MCMA 5GMDA 1TFYA 3NL0A 3R1LA 2AWZA 4LUBA 1PX2A 4DV3F 1HNVB 4TV9F 5GAEU 4R5PB 1EKRA 3SFGA 2XMVA 4LSNA 5CYQB 4ED7A 1L3TA 3BR8A 3MCSA 3H5YA 2E5LJ 2MZ1A 1F5BA 1GLVA 4WWSA 2HHXA 4RZQA 2DHAA 1TL3A 3I82A 3K5NA 2F40A 3DNCA 1UMJA 2DNGA 1SH2A 2CVEA 1SL2A 1FWPA 3DOKA 1QM9A 2HSEB 2HMIB 1FI4A 4LF5F 1IWGA 1RTZA 2VH7A 1SQEA 3EDQB 3RB0A 2J6SA 3E01B 1UETA 2WAQE 4ZJLA 1TELA 5JUMA 2XGPA 3EXYA 1V5VA 3THPA 5LOQA 5F8NA 1OYDA 1OY9A 4F4XA 2QA1A 3W5XA 2U1AA 2NU6B 2JC0A 4WBNF 2GO8A 1U1QA 3JTPA 2WE6A 2OJ3A 5HV6A 3HOWG 3CCMS 1IXKA 5CCMA 1X4GA 4FYYB 2VPXB 1N6QB 3FDSA 4JI2H 3DGPB 2KL8A 1WOOA 3Q86A 2DNPA 3P96A 4J9QA 1RT4A 3WQPA 4AUKA 2C3UA 3PZPA 1UNNC 1YTYA 4XK8C 3W2WA 5EHHA 4O3PA 1S9EB 4U8VA 1YRXA 2NXCA 4H54A 3EWGA 4OYBA 4KB7A 2YNIA 3MUVP 1S9GA 1PJ7A 1X7VA 1ZH5A 2HZAA 3D1OA 2AYGA 1K47A 2UVRA 3OL9A 4OYIA 1JLAB 1TWGA 5LXYA 2FPGB 4DCOB 1HQUB 1CJUB 2X1GA 1RT5A 2F4VJ 5DETA 1K1SA 5A76A 4JI8F 1U1LA 5LMUF 4DQSA 3J7ZT 2EEYA 1UPPA 5KKNB 2W2MP 4HH1A 2RD5C 2BVZA 2HFNA 1JKHB 2QLFB 1S1VA 2YKAA 3I12A 4IKAA 2H3EB 2JL9A 1PKUA 3HF5A 3RB3A 4C8OA 3RYLA 4EFAC 2E1RA 3AQOA 2RQKA 2WOMB 1HBOA 3HZGA 4NXMH 3QBCA 3WX8A 4ITSA 4CC6A 4ECRA 5HBMA 3QT7A 2BACA 2Y9HA 4YY3F 3UFXB 2AJ0A 2IAJB 4PYAA 3VGUA 2B4OA 1QSYA 2QN6B 1KN6A 4LF9J 5EDWA 5KG2A 1N48A 5HVFA 3G2XA 1SIZA 2Y1RI 3QNWB 3DGVA 4F36A 2W6OA 2N4CA 3V4IA 2XB2D 1FJGH 5F8MA 3MWBA 1DTQA 5B08A 1A0IA 1QJHA 1HA1A 1AXQA 4J9RA 5BXIA 1GSAA 4Q0BA 1G3OA 4BY7G 2AMCB 2PEHA 3OL6A 4EYHB 2ACMA 4X64F 2AT1B 3B4MA 5EN1A 2HBZB 4MA0A 4UCSA 4ED3A 1ITPA 1V5IB 2R2UA 4ED1A 3RR7A 2ZVSA 4OZ1A 1JJ4A 1UA1A 4EMDA 1D09B 1B4SA 4ZN1A 3JYTB 4ZVRB 1JJHA 5KG4A 2EW9A 4MAMA 2D7SA 2W4PA 3W62A 5JVDF 3FVYA 2RRNA 3V6JA 3O8WA 2AU0A 3AB2B 5HMZA 4NLOA 1T36A 2DH9A 4UZBA 3G96A 3OSPA 1X9NA 5HLFA 4C5CA 1FERA 1K9MT 3SSQA 2E5GA 1S99A 2V67A 2MGZA 4PZVA 4CRJA 3IR5B 2R7OA 3ZTSA 1WJ9A 4PPZA 2P2CB 1SVDA 1V9OA 5D0EA 3U27A 3BGRA 4JV5H 4A3BG 4IHJF 3ZZRA 4O4RA 2Z0GA 2YBVA 2L9NA 2CNOB 2FHOB 4FP9A 3H42A 2BX6A 2R87A 3GTYX 3V4SA 1AUXA 3RBZA 2HBQB 2QA4S 3K5PA 1VQ8S 2D3ZA 3LWLA 2J6ZA 2XEXA 1NKBA 4J9SA 4B3SF 2W7AA 1NZ8A 2BKNA 1VQ5S 1MWYA 4N41A 3GSDA 1FNMA 3EJMA 3H5XA 4DF4A 2KT5A 4HQ6A 1HBOB 3IS9B 3NAHA 2E5IA 4FU0A 3VAHA 5AXMA 1R0AA 3LQVA 2R42A 1EX8A 2MQQA 1ZAXA 3QMQA 2MZJA 1GK8A 4LSLA 4TQRA 4MKBA 2CIMA 1ZHQA 2V9KA 1N36J 1N56A 3KNGA 1FNOA 4XO0A 3I4PA 2ZOGA 4ECZA 3GR0A 4B9NA 2KVQE 2DGWA 4TY9A 4USIA 1YJRA 2IFXA 1FJGF 2HNDB 2CQ0A 2YKOA 2M88A 2X3DA 2OPRB 1M5OC 1C1BB 2BW2A 3W9JA 4A3CG 3PV8A 1NH8A 3OXFA 3B54A 2AKWB 1X0PA 3ETJA 2WB1D 2R8IA 5M2RA 3W9IA 3OTBA 4KTQA 2ZHBA 2OPPB 4ZHRA 4CT9A 5F41A 2DR9A 3EVMA 5DGBA 5DG8A 4TN2A 4LFAH 1IQZA 3MPWA 4FYDA 3FRZA 3J81Y 2PMHA 3FZ2A 5LMUJ 1YJNS 3TIIA 4DF8A 1N8RT 1M5HA 2YKMA 1KKHA 5K8OA 4DSJA 2M7SA 3FBEA 2VUGA 3BBBA 4DR3H 1H0HB 1X0FA 1Q8LA 2GS8A 3Q8RB 1I6JA 1VYAA 3IN5A 3CCQS 4UOFA 1RTHB 3OR2A 4B9SA 1SJQA 2LXIA 1AA1B 1HR0F 3RFCA 3MEKA 2F4VH 1TZ0A 4FXVA 1RWUA 1VBHA 3C8YA 3GILA 4GKJJ 2K7JA 2Q3PA 4I2QB 3JXOA 3KXYT 1XMQF 3SCJE 2DH7A 4DV4J 1UVKA 2VKZG 1U2CA 3KUHA 2DRBA 1IKVA 1VQYA 4BS2A 1RQ0A 1Y3JA 1TKXB 4WU2A 4EGJA 4AYBE 4DLGA 3EXCX 1RXOB 5J2NB 2QL5B 3Q8YA 4TYAA 5EOYA 1AFIA 2LEBA 4OX8A 4RW4A 2XHWA 2HGNA 2I9SA 1QAJA 1IBKH 4WIQA 4LSZB 4ED4A 5T7LB 4EG0A 3R9LA 3P4UB 2IRUA 2J5AA 1WNEA 1H38A 1RHUB 1S48A 4ZPTR 1PG5B 1Y1VG 2AJ1A 4ZQIA 4NOHA 3L9TA 1J5OB 2AP6A 2OSQA 2QX0A 4OYPA 3U9SA 3TVZA 1HQEB 2YH0A 2HVEA 4LRFA 4LR7A 2B0GA 5IXUA 1HYSA 4DR4H 2YNGB 9RUBA 1SJ4P 2R7XA 3M6WA 7FDRA 1WSRA 3H5UA 4X65F 2ROPA 4MIAA 3L2PA 2R7SA 4PG6A 2CQIA 1TMJA 2ZH1A 1U8SA 1C1CA 1S7HA 4DQIA 3QAEA 3ENAA 1YJVA 2IJFA 4XDCA 3BAAA 3DLEB 4QR0A 4O4IF 1QTEA 3A8KA 3MOJB 4RW8B 4K4SA 3G6YA 3EYYA 2VG6B 2HW3A 3RRKA 4BDPA 2APOA 1ULRA 2ZDHA 3DOKB 4N7TA 1VJQA 1H7WA 3KK2A 2HHTA 3IBCB 2RDIA 1HMVB 4ZPVR 3SCLE 4H4KA 2MLXA 1ZM4A 1IKXA 1EIYB 2BJ1A 2CDQA 5T14A 4A3JG 3CUNA 3HFZB 1KTVA 1CS0A 3K7RA 4MJKA 4F50A 5H9EK 1QAIA 3CO9A 1KJIA 3FSIA 1RSCA 2M8DB 3BDPA 1PYSB 2QA4G 1APSA 3BM7A 1DLOA 1IJEB 1O6XA 1FKAF 2AJFE 4TNOA 2I8EA 2Z8QA 2R8KA 2V2ZA 3CMES 1OSCA 3MPVA 4CTAA 1BJTA 3PKYA 1VQ6S 2EK1A 1S5ZA 3FK4A 4DUZF 2R7UA 5E41A 3JSMA 4OYZA 1I6UA 2NYIA 4OZLA 2UXCF 4JI0H 2OEJA 4LF8J 2RF2B 1TV6A 4M5GA 5BPFA 3S01A 1EP4B 2GVDA 3M6VA 3G6XA 1AFJA 5KOXA 3UQSA 1BGXT 3CJ2A 2F5GA 3R5DA 2CQ3A 2C28A 4JI3H 2DNMA 5KT4A 2OTLS 4QIWE 4E98A 1VQOS 3ILIA 4MTPA 4FBTA 3DLKA 3AOBA 3X3UA 2JEIA 4NLGA 4DR5H 3C14B 2IHR1 2MY7A 3ISNC 3M8ZA 3SFUA 3GZ7A 2MKCA 3TYTA 1FRLA 1RAIB 4ZVFA 5IT9U 3UN3A 3CO0P 4ZITA 3C3LA 2IP4A 1LXJA 2EC0A 4DFPA 1VQ4S 1AT1B 1YVFA 3UDEA 3CXCR 2KJVA 3GFYA 4ED8A 3TZWA 2VHGA 5I3UB 1P9QC 4CO2A 3R27A 1HHQA 3GU0A 3LUYA 3T1YJ 4C0HA 3I5CA 5D0RA 1VQ9S 4YQWA 3NGDA 3KUGA 3GMGA 3G6VA 2UXDJ 2N7CA 4HT7A 4K7QA 1IBLJ 5LM7E 3ETOA 3F0NA 3NS6A 3L95X 4M0MA 2P6SA 3T1HF 3Q2TC 2HAFA 2H48B 2HQFA 3H25A 2MGZB 2A1BA 4QIEA 3OUZA 2QTWA 5KFVA 3LMLA 3QLHA 1B6SA 3GQCA 2BOAA 2YKNB 1KNZA 3MCOA 5F3TA 3M05A 5DLGA 4QYRA 2OSRA 3MFIA 3D3CJ 3IR6B 3DGPA 2W7PA 2BA9A 2IDLA 4ZI7F 4DV7H 5IP7G 1WR2A 2VUMG 2VU5A 1AROP 1K44A 2O67A 4ECXA 1GMVA 4I6AA 4JI3F 3A8IA 3QRRA 1QSSA 4ZVPB 2OPSA 4YJ3F 1SBRA 5CYMA 4ZP7A 2NZCA 4H4OB 1VHIA 3IP0A 3QSYB 1IM4A 2Y0SE 3KK3B 1KP6A 4JV5J 3J80W 1XDNA 1B70B 2HG4A 3I0SA 3GJQB 3VPBA 5DS7A 2MZQA 2H9ZA 4EFEA 2KKHA 1FKPA 1UWAA 2WVBA 2OPPA 9ATCB 1VFJA 2B63G 3M8SA 3A3PB 1Y00A 2DNLA 3MZIA 1DV2A 2F9JA 4RW6B 1BGWA 2OP5A 2W6ZA 6AT1B 1RT7B 3SXLA 2B9YA 1XR5A 1YSJA 4CLZA 1HI8A 4DV7J 4NLSA 5GONF 1R8JA 4P10A 3T5LA 2FVSA 1N32F 3F8NA 4EGQA 1NEEA 1KC8T 2QLWA 2HK2A 3OVSA 2HRTA 3PYFA 5HMWA 2ZWPA 1AN7A 3LF0A 3FNNA 2FY8A 1JQGA 5DDQC 4CLUA 1TL5A 1JLFA 3DRRA 1R8HA 1IBMH 3KLEB 4F0KA 4A3KG 1A7GE 4LIRA 1Q82T 2BQUA 4RBVA 4BLGA 3G8QA 4PKDB 3TX0A 1WELA 2XY5A 3N6LA 1ZA1B 2JC1A 3TZYA 2KYZA 3VPDA 3MUTP 1PYTA 4RUAA 4ZHQF 2W8KA 1FDAA 1FJGJ 2QLXA 1T9WA 3I0RA 1LQ9A 2DBBA 3KLFA 4OHWA 4YS2A 4WFXA 2UV8A 2HS3A 4I4TF 4CYUB 2H65B 4TY8A 1K73T 3H5SA 3DU6A 4Q0YA 2IDEA 3DMJB 2EFVA 5HSPA 3TP2A 1SEIA 2V8GA 1R7IA 1M1KT 2FVRA 2J0WA 5GMEA 3FEXB 5J2MB 1L3KA 2HLUA 1DJ0A 2P9CA 2YX4A 2RQ4A 2D9OA 5I47A 1UVJA 5IYCG 3HXMA 1YX2A 3NMRA 1RT3A 2UUCF 1RAFB 3CSKA 2UUBJ 3VZIA 2RU9A 2EKYA 1SC6A 2QL7B 3K59A 5CCLA 4K2JA 2GLTA 3PHTA 4RWWA 4JI8H 2GMJA 5ETSA 1J5EJ 1S1XB 2K3KA 2B4PA 3UQ8A 2UUWA 4NCGB 3MHYA 5D1PA 4OZ2A 3WO1A 4OL8A 2GPWA 1W93A 2H5IB 1RCXB 5KFFA 2BDPA 4F2SA 5J2TF 5DQIA 3JSMB 1S6UA 4LIWA 3JSRA 1NU4A 2A6OA 2XYGB 4WFAQ 4FPIA 2UXCJ 4RNOA 2C42A 4RBTA 3NWRA 4NCGA 1JNRB 3NNAA 4WP9A 4IO1A 3HULA 2WONA 2RSQA 5IT4A 2HURA 1JKJB 2JA5G 5C42A 3J7AN 1K0TA 1AUDA 4GVBA 3MM6A 2DGXA 3D6MB 3BB5A 2IC3A 2PIIA 5BJRA 1D9FA 1QTMA 1RBLA 2XM3A 4XIUA 3FBBA 2QK4A 5IYDG 4KHMA 1XQIA 1UA0A 4OYWA 3SYZA 3EICA 3DLHA 1REGX 2WSEC 2XZTB 4PXBA 2GAGC 1VIOA 3I32A 3M2RB 4Q8EA 1VQLS 3CDUA 1HR0J 4NZ6A 4S0MA 2OD4A 2RMLA 3TA1A 5A8KA 1R8PA 2A6MA 2XYPB 3OUYB 3VGSA 1QDUB 4HH0A 4OLOA 1PJ5A 1N52B 2CA9A 2B43A 2MLYA 3L7UA 3POTB 5KAKA 2CPXA 4OI6A 1QAYA 5K9FA 2AYEA 2MHNA 1I3OB 4B3RF 3TW0A 1LW2B 3Q89A 2CQGA 4OYXA 2B8PA 3AFGA 2MXYA 3SCKE 2LKZA 1O75A 1WEXA 1S6PB 2NVYA 3FQLA 3O6QA 3TVYA 4A8WA 2BRLA 1Y14B 3IXQA 2OMOA 3DRSB 2O01C 4MYUA 4UZCA 4P2SA 4Y6IA 2PE8A 2KXHA 4X4RA 1VC5A 4FF3A 1SFOA 1TWFA 2Y3YA 1F5CA 1N32H 5DQHA 3O3LA 2CRLA 2MSTA 1T95A 1FEEA 3WZ0A 4WZQA 2FJXA 2D9PA 4X4PA 1HR0H 4JI1J 1FT8A 3MF5A 4LSXA 3AAWB 3BA8A 1GQEA 4FZVA 3I55S 1Q6BA 3VCDA 4F0MA 2PMZE 4DL4A 3G8TA 4UFZA 3DLLQ 3RU0A 2VA3A 2MKIA 1HLWA 2ZNZA 2N3LA 4DV3J 2YCHA 3MR5A 4CO5A 4HACA 4Q2LA 3CJ3A 2CZ4A 3JB9k 4YB8B 3PIOQ 1YZ7A 2WB4A 2Q6BA 4ZPCA 1UVMA 1NB7A 2ZZTA 1HARA 1JKHA 3R5AA 4C8KA 5A8KB 4RW9A 3MEDA 4ED6A 1YBUA 2KXFA 3MR3A 2N3OA 2C2OB 4ZOLF 3KMSA 3NGTA 3SDEA 5DM7Q 4PWQA 1S59A 4Y2AA 1RADB 4O3QA 1TWHA 5KFCA 2VG5A 5CZXA 5CHCB 2HVRA 3WHPA 3F44A 4FF4A 2AEFA 1U1OA 1JLAA 2HFVA 5IP9G 2FJVA 1HNWF 1CEZA 2LXFA 3DLEA 5DO2A 5F8GA 3KALA 4WF9Q 3OLBA 3M8WA 2MPUA 2WCXA 1NSQA 1RAOA 3PG9A 3HZEA 4QR1A 2YWHA 3IWXA 4DR7J 3OVAA 3CJ8A 2DLNA 3DCAA 4H4OA 3I4NG 2HQCA 2XQCA 1SUQB 5EWFA 2V8HA 4HHJA 2FLLA 2FD2A 1N33H 5BR8J 2GX8A 2BXJA 2PVPA 5GAHI 4Q8FA 1Z2LA 5KFJA 5DRKA 4ZCLA 1BMQB 2ZC3A 4DL0C 3H3VH 4K59A 2YX7A 1WHVA 4LF8F 3KWMA 4M5NA 1GSOA 4CTAB 2UUBH 2PO4A 2FLNA 3UFCX 2O5DA 1X4CA 5DZ7A 3H8YA 3ZXWA 2ZFHA 4NX9A 3MEDB 3PW2A 3GJTB 1IKWB 3V6DB 4C9DA 3HSZA 4Y3CA 2E7WA 2NUUG 3RRHA 1BLUA 1I94H 2DJWA 3R7BB 2XLKA 3KHLA 5HK4A 2J9CA 5AJ3J 2YH1A 4G6VB 4ZVSB 1UTUA 1YBTA 2DYAA 3KJQB 5DZ6A 4FXWA 1NK9A 4ZP6A 5AE3A 1N36H 2XS5A 1FRIA 4W90B 1EHWA 2LEPA 1MMNA 2MZTA 4JI2J 4IRCA 2O66A 3CCES 1KOHA 2HVSA 4B3OB 2I38A 4A3GG 5FIIA 2GGPB 1W2IA 5D15A 5HBMB 3N01A 3GIQA 5E3RA 2KVIA 4K4XA 3V6HA 5KFHA 2M2BA 2PBIA 3RUBL 3O5TB 4USKA 1TK5A 2KB2A 2ZC4A 2E7XA 1JJCB 3BYPA 2VC0A 1VBGA 2L41A 3BF4A 5BYQA 4NA3A 3ISZA 1UC8A 3T6JA 4ZPDA 2NUHA 1UFLA 1FJ7A 5FLMG 1GXLA 3C19A 2M4MA 3JRXA 3NBPB 4BWMA 2G13A 5HLFB 5I3UA 1N34J 4DG1A 3R5FA 3N6MA 3KLHA 4X4TA 2DEIA 1GMUA 2JA5A 1TL3B 5J2QB 3RJ0A 4QYZK 4EK2A 5DDOC 2DGQA 3W5ZA 3HCXA 5IT9W 1CS4A 1R5QA 3DI6B 2E66A 2J0XA 3ADAC 3QJPA 2CQCA 3BREA 1S72S 2A2CA 2V0NA 2XMJA 1WC5A 4OYAA 2F65A 2MEWA 1FTRA 4WJBA 3TUIC 4HI2A 3AD9C 3SIPB 1N32J 3P49B 2IJRA 1XBWA 2DH8A 3M9OB 8RUCA 3HHNB 2LVWA 4PRFA 2G1HA 2QC3A 3DXSX 1FKOA 4UUXA 3MFHA 4J90A 4M9UA 4XYMB 4JI1F 2YX1A 2OHDA 5FLXW 2OKQA 3W2VA 2MMYA 2ZE2A 3H98A 3HKZD 3BPDA 4O23A 1S9FA 3Q0AA 4Q0BB 2J9DA 1N5YB 1HD1A 3MM9A 2ZZNA 4DPOA 2R7TA 3GJRB 5A0YB 1IR2A 1M0WA 4HHHA 2FK2A 5E3QA 4FS2A 1KD1T 2VPYB 3VQSA 1JJ2R 1RWKB 2YU9A 1ICEB 2IMWP 1EB0A 5BR8F 3PJXA 5F8HA 2PA8D 4DV0H 2HZCA 4L1KA 4OLPA 2DR8A 2VOPA 2PEBA 4JI7F 1XC9A 3QLHB 2CZGA 2VODA 4DV6J 3FQKA 2HWTA 1T3OA 4QW9A 3ETMA 1T05A 5D8HB 1Z2OX 2GVZA 1CJTB 2VFSA 1WEZA 2VASA 2MJUA 5HJXA 4MTDA 1RT2B 3ILOA 5JMNA 1S0OA 3IAM9 3C15B 3CWJA 1NJWA 5K8NA 2KDOA 3OV7A 5D4LA 1RU1A 3ZNUA 3FMWA 2M9KA 2FVPA 2B51A 2DEJA 3IG1B 3PNIA 4QWEA 4NLXA 2F4FA 4NI2A 4JI2F 2MQPA 1HI0P 1R0AB 1ELOA 4B3OA 1N34F 3KMQA 1K7YA 1XNRF 2Y0SA 1HIYA 1S1WA 5CD4H 3FUYA 4F4ZA 2ZUGA 4K4UA 1TUVA 4U8YA 1REVB 4O3SA 3IWNC 1M0SA 1R6VA 2RF2A 4ZA1A 5A2QY 1RTHA 1MROB 2R2RA 1RYSA 2R7WA 4K4WA 4UCOA 2OPQA 5J1PA 4MMOA 1NK8A 4PUOB 1R43A 1NCLA 4DR5J 1RWXB 2CVIA 3LAMA 2HGSA 3QWUA 4MKAA 4KGKA 2K1RB 4JI4J 3OVBA 2VICA 2ZBPA 3KLGB 5IWAF 4NLQA 4LF6J 2HS0A 5KTQA 1RABB 3SE7A 2D3OR 2C00A 4YEAA 4EGLA 2VQDA 2W9BB 3CCVS 3RAXA 1FNXH 4F4YA 2C2ZB 3AQPA 5IC4B 2MYFA 2M3DA 2XO6A 2HVZA 3MEGA 1RHQB 5JH7F 3P5TL 1T11A 4I1TA 3EZXA 2PC6A 1BXNA 3SDEB 3Q2SC 4F8RA 3GCXP 2I5JB 1W7WA 3N43B 3LAKA 3NRBA 2W9BA 4GO7X 2MB0B 2HQDA 1R27B 4DUYH 3DXBA 1UW4A 3VAFA 2R8JA 4NI2B 4DPWA 3U1NA 3CC2S 4DV7F 4LBHA 1IBMF 2EI5A 4CCHA 1U4BA 1R3NA 5M2UA 4ME6A 4ZCKA 2ZJQQ 3CCUS 4YOEA 1KR4A 1Z4UA 5G4DA 2VUMA 4HEHA 1GGOA 2YPYA 3FFIA 4QIGA 2J8SA 3QFWA 1XNRH 1S12A 4X4UA 1URRA 3T9ZA 1RAEB 2WRMA 4ED2A 5ETPA 1VRTB 2QRRA 1VQKS 3DM2B 3QZ7A 4M94A 2KXNB 2WZ1A 4ZPWR 2B7CB 2WK4A 2JEJA 1SUQA 1KC7A 3EMTA 1L3VA 1XMQJ 4P2XA 1WC1A 5HL7Q 1ACMB 4XDDA 2XI3A 4ZLJA 5I3PA 1KHVA 2RUSA 1UEVA 1VHFA 2ZM6H 1UZHA 2HNYA 1WHYA 5DDRC 2PFDA 3QO9A 2VQFJ 1WC4A 2KH9A 2YNGA 3QAUA 4KFBB 3DLJA 3J7YI 2IA0A 3VVTA 4YHHF 2MJNA 1YJTA 4L6V3 2ZH9A 4GKKF 3TAQA 2F9DA 1M90T 2V6AA 2R8HA 3TARA 4PG8A 1MROA 2JHEA 2R92G 3BSOA 1S77D 3QT8A 2V59A 2F1FA 2YS7A 4MV3A 2G4BA 2LQ5A 2C3YA 4YY3J 2CPHA 4RKUC 4TU7A 1H2VZ 4DPTA 3BN4A 1NRKA 3UVJA 4DUZJ 4I7FB 3OHBA 2NU8B 4RB1A 1EETA 4GO5X 3RUPA 4RB0A 3B6BA 1MN7A 3Q83A 1IKYB 3FEZA 3D67A 5KFIA 1XTZA 3DU5A 4JI5J 3Q8PB 1UJ5A 2B56A 2GO9A 1YBAA 2MKSA 2J6YA 3OUYA 4JI4F 2JJ4D 1VCTA 3M8PB 1LV5A 5KFLA 2DPIA 2AGPA 1Q79A 2HQ3A 2U2FA 3OBIA 3BR9A 5IYZF 5KFSA 1XK8A 1R8BA 2CPFA 4C8LA 1F9FA 3AODA 1KQKA 3QFHA 4MH8A 5EUHA 1U0HB 3WX4A 2LEAA 3BH6B 4APMA 5M2PA 2OEKA 1EJ7L 2UXBJ 2QZ8A 3OXLA 1U2RA 2C3PA 4NLYA 3I5BA 3QRQA 1I5OB 2LP4A 4X4OA 3RV4A 1KBRA 1FVSA 3N79A 3R5GA 2HWIA 2O03A 2VFTA 3BGLA 1PILA 4Z2XA 3MCNA 4LSLB 3HHKA 5ETOA 3EPIA 1U1NA 3HOZG 4DR2F 1WF2A 2C3OA 1LFWA 5LSLA 4X66H 4TQSA 2FIUA 3LW5C 2AGQA 4LF7J 3I5AA 4DJBA 2LQ8A 4DDFA 5IV3A 3GIJA 4JP8A 4WKRA 1Y5IB 3PTWA 2GFFA 2F8HA 2HVIA 1Z2ZA 4UUWA 1JLEB 4OHVA 2IAJA 3J81j 3BV8A 4GKKH 1YK9A 4ES2A 3US5A 4RW6A 2D3O1 4UF4A 3NCPA 1U1KA 4RW9B 3FKIA 3KJNB 1QE1A 1YWXA 3UDVA 5C8YF 4OYOA 2DNKA 2SXLA 4YR2A 1S0VA 2WAQA 4DV0F 4KC5A 2AHOB 4ECWA 3KTMA 2EVZA 3JTNA 4RO0A 2V2KA 4WBFA 5IM0B 4F3MA 4Z7YA 2EFPA 4K4YA 1M5PC 1RTIA 1NLKL 1B99A 4C0BA 5A8WA 3RTXA 2VPZB 1SV5B 1F6TA 1H72C 1TL4A 4AQYH 2R7LA 3W66A 1NNDA 1RAAB 1YLXA 1I3QA 4K8RA 4A3IG 4JI1H 2VONA 3FSYA 3N9UC 1H2TZ 2BJ9A 3D4JA 4FKYA 4I2QA 1P27B 2XI2A 3FKIG 3I31A 4ZIWA 1MU2B 5C24A 3QZ8A 1SIWB 1C4CA 2BJ7A 3RGZA 5C3EG 3HHLD 1RT1A 2HIQA 4OX9J 2CJQA 2XD4A 4P7VA 2EFOA 5D77A 5I3QA 3MWEA 3LP1A 3JQJA 4Y0FA 3N8DA 2KI2A 2IYIA 3ZZOA 3DHWC 3HHEA 4DR3F 1G1XA 1V3SA 4ZP8A 4KBIA 1FDBA 2J0QD 1OSDA 4RX6A 4YBZB 3ENWA 4M5KA 1JLFB 3DRRB 2FC9A 4DV6H 5LJ5Y 4A3LG 4HTIA 1CG2A 1SJ3P 2Q2TA 5C5EA 5JVGQ 2QLBB 4DR4J 3VQTA 5D78A 1KTQA 1UVIA 4ZVUB 2N4DA 1HWUA 2H5JB 3KG1A 4F02A 1T9YA 2KZMA 4CLSA 5KOWA 2NPIA 1HHTP 1YKWA 4QOTA 4X84A 3D2WA 5A0YA 1FCAA 2GQ2A 4WP8A 3KLHB 4DR1H 1EHIA 2B6AA 1HWLA 3G9CA 5C7PA 3GIMA 2Y0BB 3MM9B 2CPZA 1UAWA 4ID5B 1LEOA 2WAQD 1KLNA 4EBCA 3IR7B 2VBZA 4XAKA 4IWYA 3MAQA 4DR6H 4JI6F 3PO5A 1Y1WG 1HD0A 1DAXA 4A8FA 2DRDA 1HNXJ 3M8RA 3WC0A 4MK9A 5KG6A 1BWEA 2V8PA 2GHVC 3C16B 2C3MA 3CDBA 2ZDOA 2GQCA 3R97A 1TL7A 1T9XA 4DFJA 5HN0A 3RBEA 3PEHA 2ZOFA 2W6MA 2V50A 5DLFA 4C8NA 3L4JA 4HVZA 4JI7J 2CPYA 3MWDA 2XULA 1SJ1A 2HNDA 2HIYA 4KH1B 4GKJH 3KLFB 1WDTA 3PJ9A 4L74A 4K0KH 5J2QA 1X9MA 4FF1A 1WG5A 3HBLA 3Q23A 3ZC4A 3MM8A 4GKJF 5AXLA 3THVA 1ZM2A 1GX6A 2AYBA 4ECTA 1ZAVA 4ZS6A 4TU9A 1DIKA 1Y10A 3FBFA 4DR3J 1YJWS 2E9TA 1UEKA 2OPSB 2ZNYA 4YHHH 1WF1A 5BYRA 5LMNH 3CD0A 2M0GB 1FESA 4DX7A 3OTDA 4X4SA 4NPOA 3BKUA 1MU2A 1XR7A 5B0BA 2F3JA 2IYGA 4LF4J 4JI6H 3L7OA 3M8YA 3L7PA 3M8PA 3BKTA 2MQMA 3NLCA 5J1EA 4IFYB 1WSVA 4FYXB 3MD3A 2ZH8A 4J9VA 2PN1A 4QIFA 5KT3A 3PO2G 5FJ4A 3GV5B 5A6WA 1EKSA 2DIUA 4NASA 1Y11A 1KS2A 3NGSA 1BQNA 1VQSA 1VIXA 4R7RA 1D9DA 1U1RA 3ZTOA 3BSNA 5C25A 1LKZA 2FJDB 2J7UA 2QYGA 4ANDA 4EZ9A 5LSOA 3VAGA 2Z2ZA 3Q1KA 1TAEA 1BHNA 5FDLA 3V5RA 2KG0A 1T02A 4O0IA 3H7HB 1SC4B 4RR5A 5F9LA 4I7HA 3MUMP 2WYOA 4KT0C 2C22A 4LFBJ 4ID8A 1W53A 3HT0A 1D0EA 4F4AA 3DRSA 1RGVA 2B63A 3PVXA 4F2RA 3TQ1A 4MKVA 3N5FA 1X4BA 1FWKA 3GFXA 2JDJA 1WUUA 4Q7AA 2HVDA 3T1AA 1F2GA 3LGHA 1CJKB 1UEUA 5HMYA 5HVGA 5IWAJ 3HSGA 1A9XA 8AT1B 3FSXA 3N6NA 2X3GA 4CLWA 2QMWA 4LF6F 2DY1A 3DYAB 3T41A 1U7LA 2NLWA 3GV8B 4BC9A 5F0UA 3CD7A 1ZS6A 1XMBA 4HR2A 5F8IA 1QSLA 1SKUB 5I42A 3HB9A 4RAZA 5ITHA 2HRUA 4UOHA 1B64A 4F3OA 4DV2J 2VFRA 2LLZA 1RDRA 2EG1A 4ZOSA 3KK1B 3DDKA 1NM2A 2GQQA 1WKLA 3IM8A 3IRXB 4FYWB 1J5OA 3N42B 1NSAA 5HBRB 3QJLA 3B4DA 1U6BA 1UZ3A 4L3KA 4I56A 3PX6A 3GTJA 3DFEA 3I56S 3WO0A 2CNLB 1SV1A 2BYCA 5LL6b 3VHQA 3DRXA 4O3RA 3IRWP 2KO1A 4B3SJ 1HBNB 1YJ9S 3ISND 1IR0A 1CPZA 2YXLA 4TXSA 3POTA 1FE0A 2UXDH 1EYZA 2UU9F 3BQ0A 2XMAA 1YRUA 1X9SA 4BY1G 4G1PA 2E1CA 3CJSA 4KGZB 3L4BC 4N5SA 2QMUB 3RIZA 4W92B 4PABA 1TWCA 2Y1IA 2G0CA 3GTGA 1R9TA 2LU2A 2P9EA 1JX4A 4LR9A 5I42B 2UXBF 5THWA 4DL3A 1S79A 1X60A 2ROEA 3DOLB 5LXTF 2HHUA 3RV3A 2AF6A 1E6YB 4ECQA 1RLDA 1R8AA 1VBXA 2COLA 2A3JA 2OIHA 3J80U 1S9EA 2FPIB 5IZHA 3NWGA 3FBCA 3IG0A 2XBPA 3AJDA 3BN7A 1NJXA 1LK5A 1FTCA 1YGYA 1NB2A 2RJZA 2DRAA 4YB1P 4EU0A 4J7CA 3KKFA 5CYJA 4J0MA 1Q95G 1XIQA 4GKKJ 3PX4A 1C3OA 2N7YA 2GC8A 1NJIT 3ENQA 4QIVA 3ITHA 4LVOP 8ATCB 2MKYA 4K4VA 3N28A 1LOUA 3N41B 1ZBTA 4P72A 3M2UA 4DPXA 1FRMA 4WXWA 4OZNA 1MMDA 3OFHA 4KO0A 3VVUA 5IQQA 4WCEQ 2HRYA 1VI7A 3QT5A 4MV7A 2MKHA 4NL5A 3IO1A 3PO3G 4XX0B 3C6TB 2Z2YB 3JZIA 2IRXA 3M4XA 4QZVB 4I55F 4YDDB 4IO9Q 4TLQA 3LPYA 1EZZB 2HYIB 1GNKA 4OX7A 4DR2J 2UUTA 2R7MA 2FK3A 4J91A 4X4NA 1WACA 1S97A 1J5EF 3ICLA 1FX4A 3DOMA 1KONA 4AD6A 1MWZA 2YNFA 1J5EH 2VV5A 1CS4B 1RHMB 4M5MA 5ETNA 3HKZA 3DI6A 3BO3A 2CG8A 4Q45A 2Y1LB 2FE3A 2QV6A 1P8GA 2PBZA 3EPGA 3TA2A 4Y00A 4D3GA 3FFIB 3ZZ0A 3M1MA 1UFWA 1A6LA 1JLCA 4Q44A 2GAHC 1TKDA 5DQGA 5CAAA 5I4MA 1VR6A 1JLLB 4TUYF 3PM9A 2XMUA 4NMXA 2YQ3A 1B6RA 3ITHB 4ZLNA 1IR1A 2HFSA 3OTOH 1G4CA 4OI0A 3G82A 3Q2OA 2VJVA 1N0VC 2JLFA 2UZAA 1U1PA 2BOPA 1RHJB 3P6YC 4OQJA 4IH5A 5F8JA 3CGIA 1KLMA 1MW7A 2FHMA 1IN0A 4L72B 4DI6A 2I2XB 1YQHA 4OZ5A 3J81W 4ZP9A 3DM2A 4PPDA 2M05A 1I7NA 2DHXA 3PYGA 4OHXA 2Y1JA 1UWBB 2KRBA 2NU9B 3CPWR 4AXIA 2ZOMA 4RUHA 3JAMY 3PO4A 1Y1WA 3CJKA 4DV1H 3MMAA 1JDEA 1AZSA 3TJ8A 1GFWB 3JSLA 3L9ZA 2G2ZA 2CDRB 3UCGA 3E3XA 1SL1A 3QWPA 4YN3B 4YY3H 4K5SA 2J76E 1PO6A 1IKWA 4DPYA 3HDSA 2ZD1A 2CNKB 2HMIA 3LP1B 2R7RA 1WI6A 4NXMF 4U7UD 2CPJA 4MV8A 4PDBA 5HP1A 2AJQA 4C5AA 4GC6A 4FM9A 2BJDA 2CJ9A 4I69A 2GW8A 3OW2R 4DV5H 1PAEX 3PYEA 4BBYA 5ETMA 2QO3A 1CQIB 5L1KA 3V2UC 4O44B 2M5YA 2DGUA 2J9DE 1KFDA 4H4MA 1WHWA 1R8CA 1RK6A 3I4MG 4PEOA 4WK1A 4OX9F 4AQYF 1OS5A 4IQXA 1TU0B 2FLPA 4LFCJ 1YDLA 4CWBA 3DRPA 5J2NA 3T1YF 2YS6A 4B3TH 1VQMS 5D8DA 3CNQP 1EZ1A 5K14B 3PW7A 2XZDB 1FK9A 4RW7B 4GLXA 1QY7A 3GIPA 4JYAH 2JRSA 3D9BA 4M5LA 3GIRA 4IYQA 5B7WA 4PUOA 2IM1A 4IDKB 3PR4A 2UUAH 1OWTA 2R92A 3OUUA 2GCFA 3HJFA 1DARA 2BZ2A 5HATA 5JXSA 4V19J 3OR2B 1S1XA 4IWXA 4C3KA 3IBWA 4EUVA 3TNVA 4ELTA 5E33A 3UO0A 1SKSA 4B3MH 1PBAA 4QIWD 1FRKA 1P1LA 3W5YA 3M1VA 4ZMMA 4I6WA 1N54B 3NMAA 1RBAA 2FB0A 2MZSA 1RBOB 3Q24A 4DR4F 1VLYA 5KFPA 1E6VA 2GJIA 1S0NA 5D1OB 2RQCA 1EAYC 3AA9A 3TRGA 2MY8A 4ENOA 1BWVA 1Q81T 4FBUA 3G87A 5GAEI 3PACA 1V6HA 4F4WA 2OO4A 2B6AB 4PYDA 4PCQA 2YWEA 1QE1B 1HQUA 3KFWX 1BE4A 2VFUA 1BNCA 1ZPVA 1WWHA 2RKIB 2R93A 2VKRA 4IFVA 4DLEA 4ALZA 3I96A 4EFBA 2DTJA 4HHUA 4LREA 2R7VA 3AHPA 3K3VA 3BKFA 4K50A 4WXOA 2QA2A 1NKCA 4CM0A 2GVDB 3J80Y 1S1WB 2OTJS 2E5LF 3HHLC 3KOAA 2K3IA 4FDFA 2CZ9A 1XN9A 2I6WA 4B3TJ 3CT9A 1F0XA 1DQ8A 3GTLA 2NQPA 3RBDA 3DLKB 3BULA 4HL9A 2MDAA 2HVHA 1UFKA 2OPQB 4IFYA 4JUZA 1EETB 3NXZA 3H2UB 4K4ZA 1VISA 2GVZB 4OFZA 4EWTA 4NMLA 3I9V9 3AXMA 4X2BA 2DCUB 1X4AA 1BQXA 3OTCA 2KFZA 1N6QA 2E2HA 3FRYA 2GHWA 1SLYA 4Y28C 2CJXB 1KVJA 1IVZA 5FDLB 3MR2A 3LP0B 4NE9C 3PIPQ 1FK9B 4NYOA 5K8PA 1M6VA 4UY8T 4DQQA 3GR1A 4KAIA 2Y8YA 1JLBB 1GMWA 4RJVA 1XEZA 4B3SH 3ORRA 5C2GA 4K5RA 4EI2A 4N47A 4RB2C 1OMSA 1NPPA 4NLPA 4MK8A 4L3NA 3K8VA 4HACB 3LWBA 1RZMA 3MWMA 2RILA 3EZOA 2VG7A 2HFZA 3MMCA 1CJVB 1H7XA 2NSCA 4JV5F 4TLRA 2QFJA 3AH6A 2GIRA 2CW7A 2E1PA 5KFDA 4H4KC 5CYQA 4LF5H 3OTOJ 4DU8A 4YB6A 1HNIB 1Q4RA 2XMWA 1FVQA 3NGKA 2AJ2A 3ZFVA 2HHHJ 5A6PA 2V68A 4OJ3A 3D6FB 5L1JA 5A8RB 3W8GA 3VV2B 5EZYF 2AZ3A 1HNZJ 4UOGA 2XIGA 3HI9A 3HMJG 4ICLB 1SKRA 3RAQA 4Y2MA 4F4KA 4DQPA 4ZJOA 2CQ1A 5HO4A 3M4IA 1X5SA 3T9NA 3DDNA 4LFCF 3A8JA 2FMME 4J9KA 2Z57B 3GIIA 2WSCC 3UDLA 2HQGA 1CULA 4A2BA 2J7KA 3PHEA 4YFUA 3P8BB 3UN2A 2JA6A 1WC3A 5GAGI 5HQMA 4L76A 4AT1B 3JAMU 2NUAB 3S8SA 1IQTA 3NS5A 1XNQJ 2W7OA 4BXXG 2XO7A 2DHGA 4MAKA 3CIMA 4X62F 3UWTA 1KHWA 5IC6B 4FNIA 1XMOJ 2QYCA 3GLJA 2XLJA 3P5BP 1FFWB 2RRBA 3W3SA 1LWCB 1HNWH 3GPAA 4DFKA 4J9OA 4C3LA 2ZKUA 3ZNJ1 4USHA 1D8YA 3D5MA 3MM8B 5KFTA 4UCTA 1TP7A 1S7IA 2DISA 5FLXU 1RT4B 2DNRA 2UXCH 5KFOA 1EQ0A 3AOCA 4KE5A 2IRYA 4KHPH 2EG2A 5A2QU 2C2RA 1OYEA 4WKYA 3GIKA 3UD5A 2CQPA 2LQBA 4WIIA 2KFYA 1NKEA 3W60A 1M5KC 2ZITA 4B3MJ 1U48A 3BDEA 3LP0A 2GJ2A 1VAJA 3T19A 1RWPB 5DG9A 3LANA 1N5QA 3CVZA 5FJ8G 2YVSA 4DX6A 2Q6CA 1CLFA 4JV1A 4FVMA 4DUYF 3OTOF 2FUG9 2CUYA 4JYAJ 4DSIA 3BA9A 3A13A 5C5JA 2KT2A 1Q8KA 3L3CA 2MSSA 4XTTA 2J8AA 5K20B 3CJQA 3A8EA 3R5HA 1S1TA 2IJNA 3MURP 3TWZA 4C3MA 4ID5A 3HKZE 3K8WA 4WU3A 4F3QA 3PRVA 1XJWB 3M2VB 4MV4A 2OGUA 4CP5A 2MCTA 2RVJA 3HOUG 1Y7PA 1P9YA 4WPAA 3G8CA 1FD8A 4BCAA 2DKOB 5E5NA 3EYZA 2YWFA 4I4BA 2HGLA 5GAGU 4OYMA 1F3VA 1RP5A 2PDAA 4ECVA 3ILJA 2EFNA 2R7NA 2R6FA 3UR0A 4Y2KA 3KDNA 1X31C 3DLGA 2LCWA 2XNRA 4B3RJ 4UCRA 4A3FG 2NU7B 1CJUA 3B78A 3TQTA 4WZMA 3FJ2A 3C16A 1WKKA 3HFVA 3A3NB 5JJBA 2UU9H 4ZLLA 1RWOB 4QWDA 5E3AA 4Y8VB 1SC3B 4O2AF 1F9HA 3CW2C 3W61A 2BE2B 4ED0A 5EWEA 5FD1A 4BWJA 3R7SB 3R3TA 4M8LA 3CD5A 1U24A 5CYMB 3AY0A 5B0DA 3KHRA 3WBZA 3TINA 3CIZA 2CJBA 2V4QA 2WTFA 2W01A 3ETHA 1NK4A 4DV3H 1PK8A 4MFBB 3RB6A 1LNQA 1T0TV 5C4XG 2VA2A 2CJAA 2DGSA 4NEYA 1HPZA 2XS2A 1BMTA 4WYLA 1S10A 1VJWA 1SJFA 1IBKF 1SCUB 1VK8A 3I0RB 2AJ4A 3BQ2A 4MIBA 3LTOA 4NXNJ 5EWGA 4B17A 2W6QA 1DHMA 3B8HA 4NWBA 5AXNA 4MT1A 1REVA 1VRQC 4CLYA 2UUCH 5KFZA 3EUNA 1SQFA 4KHRA 5L39A 2VQEJ 1UTAA 4G1QB 5IOLA 4O4LF 3QT6A 5BMVF 3EX7B 2YNIB 3KLEA 2HLTA 4ES1A 2VQFH 1KWMA 2WVDA 4EEYA 2V94A 3H2LA 5C42B 3V4ZA 4LH7A 2WVCA 1PIEA 2RS8A 2PMZA 4ILMA 1SC1B 2WONB 2V8DA 3HM9A 2B4VA 1DY3A 2ASYA 5KFWA 2R7QA 2KT3A 3GIDA 4OIXA 4K2XA 1EUCB 2JSXA 4HNVA 1E4EA 5CD4A 3D0GE 4QQBA 4DZDA 4UTGA 4YJ2F 2FP4B 4EO6A 2XYHB 1C0UA 2ZEJA 5ETKA 1SB6A 2ZKTA 2VOBA 3HLUA 3UR3C 5G0RB 1L2ZA 4B08A 3QGIA 4DFMA 4TKTA 3WIVA 3C0FB 3GP9A 2B7BB 3V81B 2N82B 4PQAA 2DGOA 2D41A 5IS2A 4M5DA 2GPSA 4CH0S 1K0VA 4KV8A 2FHJA 4V1Ak 1GEHA 1IOWA 1Q0NA 2R7ZA 1X9WA 2JOQA 3PCOB 1S4FA 4LMZA 1C0UB 4PWUA 3HP6A 3DLBA 2IVYA 1DZ5A 1NHVA 3M1VB 2Z2LA 3ZTPA 4LF9H 4DR1F 1ZM9A 1TAQA 1H2UX 1N36F 2UUCJ 3M6XA 1AUSL
chains in the Genus database with same CATH topology
4UUWA 4FF2A 3KXYT 1XMQF 4QU7A 3SCJE 1JLEB 4OHVA 1DFDA 5KT7A 2IAJA 2DH7A 2KN4A 4NA2A 1UVKA 2CKWA 3SMZA 2VKZG 3LGMA 2J0SD 4GKKH 1TKZB 4ES2A 3US5A 2HPUA 4RW6A 2DRBA 3NCPA 3PW5A 1U1KA 1IKVA 4P6QA 4RW9B 5LSRA 2HVQA 1QE1A 1VQYA 1YWXA 3AJ2A 4BS2A 1RQ0A 5D3GB 2DNKA 1Y3JA 2SXLA 1TKXB 3MOZA 3TOQA 4AYBD 5LMNF 2BBEA 3LO3A 4DBQA 4CC5A 4WU2A 4YR2A 1HBUA 3FGVA 1S0VA 4DLGA 3RB4A 3EXCX 4YB7A 4DV0F 5J2NB 4KC5A 3M30B 4DV6F 4ECWA 1RKJA 4TYAA 2DNHA 5EOYA 2EVZA 3JTNA 1KSPA 1AFIA 2V2KA 2LEBA 4OJHA 5IM0B 4F3MA 2LXUA 4GC7A 3RAMA 4DV4F 5HROA 2EFPA 4OX8A 5MAOA 4RW4A 2XHWA 4NZ7A 4K4YA 1M5PC 2F7VA 2HGNA 4U7CA 2I9SA 1QAJA 1RTIA 2WHOA 1IBKH 2AYMA 1XMOF 4RBUA 3M2UB 4C0BA 5A8WA 2QMXA 2RB7A 2W24A 2YTCA 3O2IA 5T7LB 3RTXA 2UP1A 4OHZA 3NP5A 2VPZB 1SV5B 5G0RA 3THTA 1TL4A 1LWCA 2IRUA 2J5AA 1WNEA 1H38A 4QU6A 4AQYH 3TAMB 5FD6A 1S48A 1NNDA 4ZPTR 3KHGA 1TKZA 2AW0A 2AJ1A 2VL1A 2J6UA 1JB0C 4NOHA 3L9TA 2BANB 4JI1H 4M1KA 1J5OB 2VONA 2AP6A 2FC8A 2OSQA 3FSYA 3N9UC 1H2TZ 3W7BA 4I2QA 4J37A 2E29A 1P27B 2XI2A 4PG5A 2ZHAA 3M9MB 3I31A 3TVZA 5HI7A 1MU2B 2RT3A 1HQEB 2BM0A 2C2DA 2W9AA 2KU7A 2YH0A 2QE5A 5C24A 3RRGA 3QZ8A 3HKWA 1SIWB 2E5HA 2XC9A 4DV2H 2ZH7A 1C4CA 3RGZA 1Y0HA 3HHLD 1RT1A 4NLWA 3PW4A 2HIQA 1YITS 2B0GA 5IXUA 2UUBF 1HYSA 4YUDA 4DR4H 2CJQA 2YNGB 4J9LA 4P7VA 2EFOA 1SJ4P 4OI1A 1QUPA 2YY3A 5D77A 3TAMA 5I3QA 2R7XA 2ZE2B 3LP1A 2B5JB 3PXGa 1N5VA 4Y0FA 4C11B 3M6WA 4QR2A 2D3UA 7FDRA 3H5UA 2KI2A 4X65F 2ROPA 2W25A 3MM7B 2XCAA 3PDNA 4MIAA 2IYIA 3ZZOA 3DHWC 3HHEA 1H98A 4DR3F 5E2QA 5C25B 1V3SA 1G1XA 4ZP8A 3L2PA 2JX2A 5KFGA 4CNZA 4CIOA 2R7SA 4KBIA 4R25A 2H5EA 4PG6A 2CQIA 1JLCB 2FJBB 1H3DA 2IVFB 3DOLA 2F4VF 1FDBA 1RT6B 2ZH1A 1U8SA 1C1CA 3TANA 2J0QD 1OSDA 1CSJA 4RX6A 1JLQB 1S7HA 3I9ZA 4C2MA 4DQIA 1O8BA 3ENWA 3QAEA 1JLFB 1IUJA 1TR0A 1YJVA 2IJFA 3M8QA 3DRRB 1DBDA 1Y3KA 2FC9A 3MM5A 4XDCA 5LJ5Y 3BAAA 1LXNA 4MTEA 4DV6H 2ZH2A 3BGUA 1O51A 4HTIA 1CG2A 1CC7A 3DLEB 1SJ3P 3D0IE 4QR0A 3DN9A 1LW0B 2PSZA 2Q2TA 1FD2A 2P9GA 3MOJB 1JLBA 3ZZUA 4RW8B 4K4SA 2AX0A 3G6YA 2VG6B 1NK0A 4JV2A 3RRKA 2HW3A 4R5PA 3EYYA 4BDPA 5JVGQ 3N4WA 2MKJA 2APOA 1ULRA 1QVFR 3DOKB 1HL6A 2QSWA 2FVCA 3J7Z5 3VQTA 3V4IB 5D78A 1KTQA 1UVIA 1H7WA 2E1MC 3KK2A 2N4DA 2HHTA 3G4SS 4E8UA 1SI9A 1L5UA 3CCRS 2RDIA 1HMVB 4ZPVR 3CCJS 1HWUA 4EBDA 3SCLE 4UQGA 4H4KA 2BRKA 3GG0A 3IG1A 3KG1A 4F02A 3VAMA 1ZM4A 2KZMA 1IKXA 5KOWA 3JSNA 2LA6A 2NPIA 1HHTP 5CXTA 4QOTA 2CDQA 1HPZB 4X84A 5T14A 3D2WA 3T3FA 5A0YA 1FCAA 2GQ2A 3JTOA 3KK1A 3KLHB 3MMCB 4LF7F 3CUNA 4DR1H 1KTVA 2B6AA 3R5CA 1HWLA 3G9CA 3K7RA 2PT0A 3MD1A 3GIMA 4MJKA 4RU2A 2IM0A 3MM9B 4M63A 4F50A 1YIJS 2CPZA 1VRTA 1QAIA 4A48A 1UAWA 2DNZA 2JVOA 3CO9A 3FSIA 4IG0B 1FDNA 2M8DB 3G8SA 3NCQA 4ID5B 2WAQD 3BDPA 4X4QA 1KLNA 2QA4G 2W57A 1APSA 1SJRA 2IM3A 4EBCA 3IR7B 3JYTA 3BM7A 2VBZA 4OI3A 4XAKA 1HWKA 1O5JA 1DLOA 1FKPB 1IJEB 5KFEA 1FKAF 2AJFE 2R8GA 3MAQA 1L3UA 4DR6H 4JI6F 2E9RX 3C66A 3PO5A 1HD0A 1DAXA 4A8FA 4I2PA 4TNOA 2I8EA 2Z8QA 2R8KA 2J9EA 1FJCA 3KNAA 3CMES 1OSCA 2VD3A 3MPVA 3M8RA 4CTAA 3MAHA 1FEHA 4A8MP 3ZZPA 2EBGA 1BJTA 3WC0A 2VB6A 2JH3A 3PKYA 4MK9A 2HNZB 3J7A1 2HHWA 4YDXA 2I0XA 5KG6A 1VQ6S 1BWEA 3N6XA 2EK1A 3MEEB 2GHVC 4DUZF 2R7UA 2CPEA 5E41A 3JSMA 3PJWA 2C3MA 3CDBA 3CDEA 1I6UA 2NYIA 4OZLA 3G6ES 1V3RA 2UXCF 4JI0H 2ZDOA 2GQCA 1HI1A 1OIAA 2D1CA 3K5LA 2RF2B 1TV6A 5B0FA 4A4JA 5HN0A 4DFJA 3RBEA 4U67Q 3PEHA 2ZOFA 5KG7A 2ATLA 1LK7A 2JVRA 4H4MB 4I64A 5DLFA 1M5VC 3HXLA 2ZD1B 1XNQH 4C8NA 1UP1A 3KG0A 5E3PA 3S01A 2R2TA 3L4JA 4HVZA 2CPYA 1UJ4A 1EP4B 3M6VA 3UDCA 1TVRA 2XULA 4DL7A 4C8ZA 1HW8A 3G6XA 1SJ1A 1AFJA 1SKWA 2HNDA 2W8LA 1Q8BA 4GKJH 1TKTA 4ETXA 2WW8A 3KLFB 3DYAA 5KOXA 3UQSA 4K0KH 5J2QA 1BGXT 4HLBA 4IOBA 3RW7A 1JLGB 1X9MA 5IT9Y 3CJ2A 4TU8A 4FF1A 3IGNA 2UXDF 3R5DA 1WG5A 2IBKA 2CQ3A 4ATNA 3Q23A 2C28A 2VOOA 4I68A 3ZC4A 4QWCA 4JI3H 3MM8A 4GKJF 1U26A 2B9XA 2DNMA 5KT4A 5AXLA 2OTLS 3THVA 4LF6H 1VBYA 1ZM2A 1GX6A 4E98A 1RYRA 1VQOS 4ILLA 4FN5A 4MTPA 1S1VB 1IBLH 4A46A 4EO8A 2AYBA 2VBWA 4ECTA 1ZAVA 4FBTA 2UV8G 5D6GA 1XERA 4ZS6A 3VZHA 4TU9A 3DLKA 4R8UA 1VQNS 3X3UA 2JEIA 1YJWS 1Q16B 1IKYA 2E9TA 2OPSB 4NLGA 4DR5H 2ZNYA 4YHHH 2IHR1 1WF1A 2MY7A 3ISNC 5BYRA 4CH1A 2V5HG 5LMNH 3D1QA 3SFUA 2LDIA 3CD0A 2ADBA 4UCVA 3GZ7A 2M0GB 2MKCA 3TYTA 1FRLA