3H20A

Crystal structure of primase repb'
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
288
Chain Sequence
RTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKKHTTYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLERRTALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKHEADYIERTVSKVMGLPSVQLARAELARAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
molecule tags Replication
molecule keywords Replication protein B
total genus 99
structure length 288
sequence length 303
ec nomenclature ec 2.7.7.-:
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16793 RepB_primase RepB DNA-primase from phage plasmid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3h20A04
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h20A02
3.30.1490.240 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3h20A01
3H25A 3M1MA 3H20A
chains in the Genus database with same CATH superfamily
1HKAA 2AEMA 4OJ3A 5HATA 4LFBH 3WHPA 3KG0A 1JXEA 3DMJB 3I0SB 4ZP9A 3EGZA 5B08A 3EJMA 1SUYA 1AA1B 5CD4A 1MMNA 4WYLA 5G4DA 2ZVSA 2BUNA 3QT5A 2GHPA 2C22A 2QA1A 4CC5A 1Y5IB 4B9VA 2BJ1A 2DNHA 3QFHA 1QLNA 5KTQA 2XIGA 3K5LA 2YS7A 3KAKA 3VPDA 5K14A 4ECRA 5I3UA 2D3O1 4M63A 4B3RJ 1TVRA 3BGUA 1FKAF 1HQUB 4LBHA 5KG7A 5KKNB 4YR2A 1SC3B 2BRLA 3SDEA 1RI7A 3IMQJ 2ALYB 3R6GB 2KT3A 2DH8A 4R8UB 2J9GA 2R8KA 1EKRA 2W9BB 2UXDJ 1JKHB 3VF0B 1XIQA 2YVSA 1VI7A 2LVWA 5KFXA 2ZVIA 5HO4A 2XSJB 3G86A 3U1NA 1RGVA 4F7VA 3I5BA 2DHAA 4OYAA 4AXJA 1NB2A 3EDQB 3H98A 2OPQA 4DR3F 1OY8A 1NU4A 2BJEA 3GR1A 3I4NG 2DIKA 2IDLA 3MPDA 2FZCB 1RHMB 3J7AN 3NMAA 1T0TV 3D9BA 3PW7A 5CYQB 1DFDA 4NLQA 1WH2A 2QK4A 2HFVA 3K5HA 4X66F 3ZTQA 1FJGF 3LP2A 2J8SA 2GIFA 5EX0A 1R0AA 3BBFA 4CIOA 2R7SA 1RHKB 1QSYA 4PUOB 4PXBA 5HVHA 4CLSA 1IWGA 1QAJA 2WZ1A 4TV9F 4J9VA 1PGZA 3CJQA 3OTBA 2UXBF 4TY8B 4L3KA 3G82A 1XMBA 1IUJA 3B8HA 2OPSA 3SSSA 2J0QD 2OEMA 1HW8A 2KHDA 2FJVA 1SYXB 2O1PA 2UZAA 2CJQA 3AFGA 3GB0A 2HNYB 2DNKA 4OI4A 2KRRA 3EXCX 3BO2A 1IBMJ 5E41A 1RK6A 1YSJA 1VQ6S 4LSNA 3BV8A 4QWAA 4A3MG 3QFFA 4C48A 2ZHOA 5KT2A 3U1LA 1LW2B 1X60A 1DJ0A 4JI0H 5C25B 1RT3B 1HBUB 4IQXA 1RT7B 4K0KF 3MFHA 2C42A 2UUAH 3U9TA 1KBLA 2EWHA 2HHVA 3AD9C 4MV7A 2HK2A 2ZDGA 3D3CJ 1SL0A 2AJ4A 1P9QC 4L73A 4TYAA 3TUJC 4V19X 4DL6A 3FBFA 1FX4A 2FVCA 4J9NA 2HVSA 2M8HA 1HNWH 3W62A 2C2NA 4DX6A 1HWUA 4IHJF 4UOGA 2V59A 2A3JA 2LQBA 5D1OB 4UQGA 2NU6B 2HRUA 1M5OC 1UVLA 3M30B 3DLBA 2GQQA 1V9PA 3C14A 4CH1A 4W90B 1YHQS 4JV1A 2LXFA 1JLBB 3Q2OA 1H2UX 3GIRA 2FTRA 1TP7A 4OI1A 1HBMA 2BQRA 4BBRG 3KLHB 4GVBA 3DRRA 3OTOF 1RB0A 3MPUB 2WAQD 3GG0A 5ETPA 4ZHRA 5C5JA 4C8KA 2IJFA 4KFBA 5KFWA 4KR0B 3D1HA 3H5YA 3PO2G 5HBMB 1WOPA 3CC7S 1SJFA 2WHOA 1RWXB 4DU7A 5HQMA 1QAXA 3NBPA 1K98A 4X65F 3RG6A 1N54B 1UEUA 5F0UA 4UY8T 3KALA 4USTA 2HHQA 5KFLA 4X4SA 2CW7A 2HBRB 5KFOA 4X62J 1KHVA 3FSYA 2UUAJ 2F3JA 2CG8A 3GIMA 1QTNB 1H3DA 3AOCA 2ZITA 3HHLA 1KOHA 4MFBA 4NASA 2X1AA 4HI1A 2KN4A 5C5EA 1HFEL 3JYTA 2D3OR 1UFKA 1FWKA 1N32F 2N7YA 3PDNA 1FKOA 5C1PA 2NSCA 1LK7A 4DQQA 1HNIB 4EYHB 2Z4PA 4KPYA 4CI0B 2I5JA 3THVA 4LFAF 1BY9A 2OSQA 3K2YA 1G1XA 5KFQA 3W61A 4C7QA 4LSXA 2RHQB 2F4VJ 3HJFA 1K1QA 4C8ZA 2BANB 4UFZA 3KWMA 4JUZA 1P1LA 3BR8A 4A3IG 4DLKA 1IWAA 5M2UA 1PBAA 4JI1H 1HI1A 3CC2S 3BSAA 4TU7A 4Q0BB 2W2QP 4FPRA 2PVPA 3R23A 3CCRS 4DFJA 1MWQA 2VUGA 5F8LA 1TA8A 4LF6F 3Q8RB 4OX9J 1VQ7S 3DGPA 2BABA 1XJWB 4EGQA 4UOHA 1F2HA 3EMTA 4PPDA 5C7PA 1Q6AA 1T9XA 3PW4A 4XYLB 3M2UB 2CPHA 2ZOMA 4WK3A 1HL6A 4LFAJ 1N6QB 2B3TB 2P6TA 4C8NA 2Z2MA 3W9IA 4AL6A 4QPXA 4ED0A 4QBUA 2JA5A 2WVCA 2C3MA 3CMES 4QJVA 3F73A 1RBLA 3TI0A 1N6QA 1GXUA 1O5JA 2QL9B 3ZZ0A 3AH6A 2CQDA 4X66J 5CABA 1KOOA 1D1UA 4PR6A 3W5XA 1TFYA 4IH5A 2UUAF 3GG1A 3PY8A 1JKJB 2GGPA 4P2MA 1XMOF 4RW7A 4M5IA 3SZ2A 3NXZA 1B6SA 1TL7B 3BABA 5KFGA 1TKXB 2QL7B 4DR6J 4X2BA 4M5GA 3TUIC 1PJ7A 4CTAA 3TZXA 2C3PA 2IC3B 1SKRA 2DRAA 1S1UB 2XNQA 3PFOA 3I5CA 3OR1A 4ZVEA 1M6VA 5KFJA 1CJVB 4YJ2F 1BD6A 3JSMA 3OV7A 2VG7A 2E5HA 3VGTA 1YZ6A 1XERA 4B3RF 3NWRA 4LF4H 1KR4A 4ZN1A 5I42A 4TNOA 2UU9H 1HHSA 3KK2A 1Q0NA 4ES2A 4KQZA 2G2OA 3SFUA 5KFNA 1NPRA 1GNKA 3BREA 3MEEA 4A8YA 4AYBE 2W9CA 5ITHA 2PDAA 3X3UA 5LMUJ 2IMWP 4HYKA 2I87A 5FPRA 2HNDA 4HTJA 1C0TA 1RT6A 4F67A 4OX6A 3V6HA 2QYGA 1KJ8A 4OYIA 1YG0A 2FHMA 3WIVA 4E98A 3H5XA 2GPSA 1RQ0A 3W7BA 2L48A 1OYEA 2DGTA 1H74A 2MLYA 1DTQA 4HKQA 2KT2A 5J2NA 3BH6B 4G6VB 3HVTB 3MM7A 1IQTA 1X4HA 2W70A 5SZTA 2D7SA 2HURA 2DISA 2R42A 1VCTA 2FE3A 2MKHA 1LQ9A 4IZOA 3DLHA 3IV9A 1KJQA 3R1HA 5FJ4A 4IOAQ 1SC4B 1WHWA 3HF5A 3HKWA 4DR4H 4M5MA 4CC6A 2YX4A 2FHJA 2RQ4A 2FK3A 2DEJA 2HQ3A 3T1YF 2JSXA 1F3FA 4GKKF 3WIUA 4K4YA 3OL8A 3KLEA 3BA9A 4OZ2A 5L38A 3W2WB 3K89A 4U6PA 2XCPA 2DHSA 5M2PA 1UJ6A 3SFGA 2C3OA 4R5PB 4ID5A 2W4DA 1SUQA 3ETJA 4J91A 1OSCA 2G2YA 2JEJA 5FDLB 4IG0B 5J1EB 2HVEA 4LIWA 4HNUA 4FF3A 1I50A 3N41B 4BBYA 2CPXA 4Y28C 4DQPA 3D2WA 3GJRB 4CLFA 3RTXA 3OTDA 4JV0A 4IG0A 4OL8A 2RGVA 2A1BA 3TP2A 1RK5A 2ZH7A 1WF1A 4U7UD 5DZ6A 1B0PA 2DNRA 1Q95G 1VBXA 2PO4A 4OYBA 4KHMA 5GAGI 4WF9Q 1RTIB 2GAGC 2ABYA 3DOLB 3JQJA 4UOFA 4Y2IA 2AV5A 2HMIB 2GMHA 3HSJA 3M2VA 3LP0A 4Q8FA 1JLLB 3V4IB 1LFWA 3QIPB 5EN1A 3HD1A 5GADI 1CQNA 4LF4F 2MZJA 1E6VB 4CNZA 1UKUA 3DXBA 3MTJA 2O3DA 2VR1A 3CCWA 4KFBB 2FLOA 5KT7A 3DGVA 1RADB 3IBFB 1VKZA 1SIZA 1RT4A 4ED7A 1FDAA 4KGMA 3HLUA 4MV4A 4OHYA 2RT3A 2ZJTA 4EG0A 1Y5NB 4MTEA 4WJBA 4WCEQ 5GAEI 4NL5A 2HVIA 1JJCB 4OYXA 5DQHA 5F8MA 2YNHB 4RW9A 4NLSA 1RT4B 4CLYA 2C1EB 1FO1A 4M5DA 2DJWA 3TX0A 2VD3A 1RT2A 4NLDA 3RB6A 2UUBJ 2FY1A 2NCKL 3HHLB 4C5AA 1CS4B 1HBOA 1DAXA 1RKJA 2MDAA 2XI3A 3CMAS 1TFWA 3SCLE 1F6TA 3RGZA 3PYEA 1ZHSA 3PM9A 2NXCA 2XC9A 4LQ9A 3HOZG 3AJDA 4F3OA 3FSIA 2Y0SE 2HHHJ 1H2TZ 4P9SA 4CQ1A 2ZH9A 1JLBA 4ER8A 3Q2SC 2DGQA 3JQKA 4B9MA 5DGAA 1Q7YT 1LNQA 1PYSB 2VG6B 3RJ0A 3U02A 3RR8A 1TKDA 3D3BJ 3GTLA 3AODA 2J9DA 4B3MH 2VFSA 4JYAJ 2VL1A 5K8PA 1JQGA 5HAOA 4WD3A 2YXLA 3BULA 4G3IA 3ET6B 5D6GA 5T7LA 1R27B 2ASLA 5FD5A 3QRRA 2CPFA 3EM1A 1R89A 2GIQA 2N7CA 2FHJD 3LTOA 5F3ZA 2EFOA 3TR5A 2RDIA 4FVCA 1HQEA 4YR0A 3N5BA 4XPEA 2YTCA 1S0VA 2KHCA 2NUUG 3DHXA 1SL2A 5LM7E 2JA7G 2HBZB 5BMVF 3DLGB 1VQKS 2Q2TA 1KQFB 1XMOJ 1NHVA 2MQNA 2A2DA 2PIIA 4A48A 2BDPA 2CJYB 5IYDG 2BKOA 3RW6A 3IG1A 3MMBB 3TOQA 2DHGA 4HQ6A 1F5CA 4ERDA 1HHQA 4XAKA 3RU0A 5E3PA 5AXLA 1APSA 1YJTA 2R7KA 3GFHA 4K4XA 3LGNA 3IRXA 5KFKA 2XLKA 1RKIA 3H59A 4I2QB 4ZP8A 5IT9U 3OQ2A 4ENOA 2ADCA 3O2IA 4RW7B 3CDAA 3HHLD 1WG1A 3M8QA 1YJ7A 2OMOA 4DQIA 1EARA 2Z0GA 5E3QA 5J2QB 1FTRA 4JI2J 1ZETA 3P5TL 4OI2A 1QUVA 2HKEA 3OXLA 2G13A 4Y65A 2XSJA 3BO4A 1B7YB 2RD5C 4BWJA 4ANCA 4ECVA 3JAMU 5B0BA 4NLRA 2V34A 2FPGB 3P8BB 1F5BA 3MOJB 1B70B 1PBUA 2QGFB 3P6YC 2BE7D 1N5SA 1RWPB 2GX8A 4JI3H 4KY3A 4ZS6A 3UD5A 4FM9A 2XHWA 1GXLA 4DUZF 2VBZA 4UZBA 2D9OA 8AT1B 5MLCV 3MZIA 1MLAA 1NNDA 2VG5B 3EGNA 5KT3A 5A76A 3CJ2A 2M05A 1LKZA 3QLHA 1BUXA 3FK4A 3EPIA 5K2MA 2AGOA 4ED5A 5BR8F 3H0GG 2NSBA 3IWXA 1NJXA 2H3EB 4CLWA 5BYSA 2IM0A 4O3OA 3R9LA 5A2QW 4NWBA 4QR0A 4NCBA 2LXUA 4C0HA 1DBDA 3CCLS 1SI9A 1S4EA 4UCVA 1Y1WA 2JVOA 1JLQB 2KI2A 5JXSA 2JRSA 2UUCH 1VQLS 1S6OA 3DOKB 4KHRA 1HWJA 4AYBA 4DPOA 3LPEA 3MR2A 1KQKA 2LQ8A 1S1WB 1TWGA 1LWFA 1SC6A 4NLTA 3GV5B 2WBRA 4ZPBA 2DGOA 4ZP6A 2V50A 2CAJA 1VISA 1TUGB 4DS5A 1IQZA 2OD4A 4B3SF 3ETMA 1IBCB 2QYZA 1IR0A 2GLTA 5J2UF 4QYZK 3OJUA 4F4XA 1M7JA 1UZHA 3DFEA 4EFEA 4WFBQ 4XIUA 2LQ9A 4DR7H 5DM6Q 1C0UB 1ULRA 1MG7A 1E6YB 3S7RA 4J9QA 1VK8A 2R8GA 4NA3A 1S10A 2IJRA 2CADA 2H65B 2F7VA 4CDIA 3FVYA 4PXDA 2L9WA 2XQCA 1NK4A 1N5QA 4KIAA 1CULA 1B0VA 1VIOA 1T05A 2F9JA 2BOPA 2EFVA 1MMLA 2V8GA 5HP1A 5D0RA 1F0XA 1L3KA 2W8LA 4DUYJ 1WKKA 1UVMA 2UUBF 4N8OA 3J81Y 1NSAA 4L72B 3UN2A 1BGWA 1NDLA 3W9HA 1HBOB 1RT1A 1TUVA 3IBCB 2MSTA 2JX2A 1S9EA 4ZK7M 4B02A 4DZDA 3D6HB 2O5DA 3G4SS 4YHHH 1U8SA 3V6DB 3NWGA 3M2RB 4MIWA 2YZGA 5D1OA 4YY3F 3VAKA 3W60A 1EYZA 3GILA 5E3AA 4KHPJ 3R5BA 4IYQA 4MMOA 2XCAA 4F4AA 1AZSA 5A0YB 1DIKA 2FGOA 3IAM9 4IQMA 3V4IA 2J8AA 3M1VA 2GC8A 5A8KB 4OJGA 4DV5H 1MW7A 1S4FA 2LEBA 3QT6A 1URNA 2HPUA 2HNYA 5HMWA 1SJ3P 5D4LA 2ZH3A 2BJ9A 1C4AA 4GVBB 1VAJA 3FBCA 2MZRA 5EWGA 4CO5A 1S6QB 3B6BA 1HNZH 2RQCA 3EZ5A 1CJKA 1NKBA 3KLIB 3HOXG 4ID8A 4Z7CA 1UJ4A 4PDBA 3DU5A 4HL9A 2HG4A 4I67A 1TUWA 4XZ3B 1U1MA 3S01A 2R7QA 3BA8A 3AB4B 1TWCA 1NJZA 2HZVA 3S8SA 3D66A 3KK3A 3DLKB 3HOYG 4X4NA 1JIHA 2H48B 3HXMA 4ED2A 4UCTA 5AE1A 4URSA 3BB5A 4BS2A 2I1RA 1TMJA 4LF5J 1CE8A 4I50F 3FEXB 4MJKA 4C8LA 2XG8A 4R0JA 2IVYA 3HX9A 2DIUA 4ELVA 1PC5A 2UXCH 3GTKA 2KM8B 1RCXB 5LP6F 2KM8C 3RBDA 3W8PA 2UXBH 3ZZYA 2ZM6F 1R8AA 1FVIA 4FYDA 4EMDA 3QQCD 4NA2A 1SXLA 4JV5J 3AY0A 3MR7A 4CYUB 4WWSA 5J2QA 3MUTP 5HROA 1Y11A 1RA6A 4NLPA 4K5SA 2UUTA 4B9UA 1YIJS 3I6PA 3HMJG 3DRRB 4BWSC 2R7RA 1SJRA 2B43A 1Z2PX 1T03A 5CZVA 1X9MA 3LO3A 2DR6A 3NGRA 2AEJA 2M70A 4J9UE 1VQYA 4M8LA 2DWCA 3MWBA 4OFZA 3CPWR 4Q7AA 2M5YA 5D1PA 2BM1A 4AQYF 2E7XA 3EZUA 2PBZA 3G96A 2DZDA 3HHLC 3MMCA 3NL0A 3CT9A 1AROP 4LVOP 5I4MA 4K59A 2JA8G 3QATA 4C98A 3PR4A 4PWDA 4UT4A 4QR1A 1KQSR 4EBCA 5CHCB 2M4MA 3GTQA 1ZTTA 1JLEB 2EBEA 5LMUF 4DR2H 1BMTA 3LWMA 3LANA 4IRCA 3UVJB 4Q43A 1E4EB 2CDRB 2AQ4A 1SJ4P 4DR7F 1X4AA 5LMNH 5L1JA 4OZ5A 2AT1B 1GMWA 5IM0B 4FF4A 2R82A 3FGVA 3I55S 3P4UB 1WC6A 2L41A 1Q6BA 3OR2B 1JLQA 5KG1A 4NA1A 4LRCA 1U1RA 4PQUB 2JLFA 1N88A 2BM0A 3GJSB 1JK9B 1MSWD 5BR8H 4B3SJ 4ZJQA 3GV7B 5IV4A 3AXKA 1H72C 4RJVA 3ILIA 1S1UA 1N48A 2KL8A 5CAAA 2HFSA 2HVQA 2ZZTA 2EXUA 5KFEA 3H20A 4YB1P 5BPHA 2YKMB 2GVZB 4YOEA 5D4OA 1VR6A 4E8UA 2E1AA 4ES1A 3WHIA 3AXMA 1FRHA 3DDIA 2IIHA 1VBKA 5H9FJ 4DV6J 5HI7A 3EICA 1KP6A 4HEA9 4OQJA 3ZZTA 1U7LA 2C2OB 1NRKA 2HZAA 1NM2A 2DHHA 5FD6A 3N8DA 4CWBA 4AUKA 3M32A 5F9NA 4L75A 3UDVA 5JVGQ 4IR9A 5L8RC 1JWWA 1C4CA 4JV5H 4DLEA 2DCUB 3PFEA 4IWYA 3W64A 1G7CB 4PZVA 2E1PA 2GS8A 3DMJA 3JAMW 3OD2A 1QE1B 4RW6B 3OXFA 3KDNA 4MK8A 3LUYA 1RJJA 2HW3A 2RRNA 4G1QB 4NZ0A 1R0AB 3M8QB 2EFNA 2MEWA 3P49B 3JTOA 1U2RA 5LA6F 3BEGB 1GTEA 4ZCMA 8RUCA 4LQ3A 4OX9F 4LF6J 2N4CA 4DV2H 3LA0A 2ZH2A 4GO7X 3Q24A 3MEKA 3D4JA 3HHDA 2KU7A 3MM9B 2DLNA 2OUGA 2KXFA 4EEYA 4U7CA 3CSKA 1M1GA 4Z7YA 2P8IA 1EUCB 2Z58B 5A2QY 4H4KA 3ZZPA 1OPZA 2AGQA 2OD6A 4YEAA 4ZVFA 1WTFA 2GJIA 1AXQA 2F63A 3MWDA 3MTKA 1M1HA 2HHPA 1WEXA 3F56A 1W7WA 3ENAA 1RYSA 1OWXA 1TL5A 2W4CA 2DNYA 3KDOA 1C0UA 3BDEA 4ZLJA 5T14A 3EWGA 5HBMA 2KYZA 2WSFC 3GIIA 5CH7B 1N5YA 2KFZA 3N0VA 2Z30B 3CO0P 2EBGA 4XDDA 3ZNJ1 4H54A 4RW8B 1SV5A 2BQ3A 4HEHA 4RAZA 2PMZE 1CJTB 2RUGA 2CKZB 9RUBA 2FJWA 2VKZG 1RJRA 3M8WA 1S7IA 2XZTB 2O01C 4LFBJ 4OHZA 3N6NA 2HFNA 3P96A 3TANA 3K3VA 2HFUA 1U0HB 4TU9A 3O1LA 4X65J 1HI0P 2J6YA 1S9EB 3G71S 3M30A 1BLUA 2N3OA 2LEAA 2UU9J 1U49A 3FCWA 1TAEA 1AZSB 3P45B 2MKKA 2BE2B 3TVKA 4B3MF 4GO5X 3ET6A 4MT1A 5H9EJ 1VFJA 4C6AA 3PIOQ 4Y00A 5THWA 4LR9A 2DXEA 4JYAF 2YX1A 2XHCA 4BWMA 3N9UC 2NVXA 4NXNH 3DOLA 2O03A 4GRSA 4DR2J 1H38A 4KKOA 2RILA 1PCAA 4DFPA 4K0KH 4C5BA 1N36H 3LF0A 2F9DA 1HNWJ 1UP1A 4WK1A 3T9NA 1YJRA 2IMOA 2VDHA 1ZM4A 2RS8A 3TINA 3SCIE 4K4SA 1U6BA 5H1SV 5C42A 2CJAA 3LAMA 3RF2A 3VVTA 3D0GE 1E6VA 1KJIA 1Q7LB 2HGSA 3T9ZA 4F02A 1UETA 1KHWA 3BDPA 4X65H 3NLCA 1YJWS 4DI6A 2J9EA 2GW8A 2LMIA 2QFIA 2ADBA 2R2RA 4MH8A 2XI2A 2FLLA 3BPSP 5J1EA 1DLOA 4F50A 1S6PB 2FYXA 4L1KA 4Y8VB 2K3KA 3W5YA 1KD1T 2W2PP 2FD2A 2JJ4D 3WC2A 1S0NA 1N34F 4OV1A 2R2SA 1YDLA 3GPAA 1RAIB 3HSGA 3IS9B 1GX6A 3GCXP 2YKAA 2VODA 2HNZB 4MV1A 4QR2A 4HDHA 4HHUA 5KFAA 3F0NA 4ZJOA 2ACMA 2R9LA 1CQJB 2WOMB 5D77A 3K8VA 4YS2A 2GZOA 2YH1A 5D8HB 2X3DA 1VBHA 1IBMF 3M7VA 5BYRA 2PI4A 4A8SA 3ENVA 3CB4A 2HMIA 3A8EA 4OX8A 4NEYA 4EBEA 1WC3A 3RB3A 1N0UA 4DCJB 5IT4A 5FJ8G 2E44A 5KFPA 4QIEA 3H25A 4DQSA 1GMVA 2HEKA 1S1VB 2FGCA 3O44A 1PJ6A 5DDRC 2DNQA 3DHWC 3RR7A 2FPPB 2BX6A 4DFKA 2JEFA 3DLKA 3FKBA 4OMFG 5IV3A 4O3SA 2B9YA 1WI6A 3A3PB 2MY7A 3AA8A 3C15B 3KXDA 2UVVA 3MAAB 1TKTB 3A4TA 1R9TA 5HL7Q 5C24A 3BH7B 4JI2H 1Q8IA 1Y4ZB 3VPCA 5CYMB 3TVYA 3RRGA 1L5UA 1J5OB 2QLXA 3HPOA 1IKVA 1JLCB 5C8YF 3ILJA 2PI5A 4IFYA 4CO3A 3J7ZT 3DI6B 3CTRA 2B8PA 4RB2C 2Y0BB 1GMUA 5LSOA 2ZDHA 3C16A 1AB8A 2NYHA 1J5EF 4G1QA 1S12A 3K7RA 3SV3A 4EFAC 1GEHA 2DNNA 4FS1A 4YHHJ 4RNMA 3TEGA 2GAHC 3PRVA 3JRWA 4UQTA 2CVEA 4DL7A 4XYMB 3PR5B 2P5VA 4MTDA 3N6XA 3G8SA 2HNZA 3OHBA 4J7CA 3L9ZA 3GIDA 4IRDA 4DV6H 3GU0A 2J0XA 4ECUA 2KRBA 3DRYA 1N8RT 2OPPA 1K73T 4FBUA 2LU2A 5J2MA 4ZVUB 3V6JA 1RT5B 2DH9A 1HW9A 5KFRA 5K14B 5I3UB 1KQGB 1DZ5A 4ITSA 1WORA 4ECXA 3OLBA 2YY3A 5LMUH 2Q6BA 4DV4H 4TUYF 3Q0AA 3AA9A 4ED6A 1S03G 2XY6A 4OI6A 3IM8A 1V3ZA 2CJ9A 4FPIA 3MCMA 5ETLA 1TK0A 3TW0A 4B3MJ 2CPJA 2MPUA 1S59A 3EGVA 2HVZA 2NPIA 3M9OB 1OMSA 2ZH5A 4DV1J 4YUDA 2WE6A 2E2IA 3UPFA 3VCDA 5E3RA 3N5FA 2NUHA 1PO6A 3GIJA 1AYEA 4ZLNA 3QO9B 3FMBA 2J7WA 3A12A 1HI8A 4UCUA 2AJ1A 4KO0B 4G86A 2CQIA 1S1TA 3IBWA 2QTWA 4PG6A 4IOBA 1FFGB 2CQ0A 3IFEA 1VC5A 2FK1A 3C0FB 1WG5A 2DT9A 3GYXB 3ORQA 2K1RB 4A8KA 3HOUG 4DV7F 1QY7A 4CTAB 2VQDA 2VQFH 1R8CA 2QRRA 4OYWA 2XCLA 3HB9A 2XM3A 3RGXA 2ASDA 2AIRB 2RU3A 3EZOA 1DHMA 2NLWA 2KVQE 1Y1VG 2LDYA 4DS4A 1QSAA 3CCMS 4OI0A 2JEGA 1TKZA 1M0WA 3PV8A 3L7PA 1XN9A 3KLEB 1F9HA 2HHWA 3SQGA 1EIYB 2QA4S 3RBZA 4ZVHA 3PEHA 2ZC3A 4F04B 2RQMA 5F8GA 1JMTA 3DRPB 3KKFA 3QWPA 5KFSA 2W6MA 4NLUA 1O6XA 3M9NB 3GTYX 2ZNYA 2WAQA 2N3LA 4JI3J 4ECSA 4C4WA 3ORRA 2DKOB 3MMAA 1NLKL 2MKIA 3L9TA 5E33A 1HR0J 1H7WA 2GHVC 4LUBA 4F3MA 1PYOB 3I96A 4ID5B 3EPGA 2B4PA 3PHEA 2UXCJ 2V0NA 4ZI7F 2J9CA 1KBRA 4JI1F 4JI1J 7AT1B 4R25A 2LU1A 4Y34A 2UXCF 2E7VA 4YDDB 3R7BB 1X5OA 1YI2S 1VQ5S 2W1BA 3Q8UA 3NGDA 2UVWA 3HVWA 2QO3A 3QO9A 4LRAA 3IG0A 3IM9A 3RAXA 2YS6A 1FRJA 4PYAA 2D3ZA 4CLLA 1Z4UA 1P8LA 5GADU 2LA6A 2F4VF 2XWYA 4U8YA 1UJ5A 2YQ0A 3CCZA 1EZ1A 3BKTA 3GIKA 3T1AA 3W63A 4JI8J 3CVZA 4FDFA 4I7FB 4AL7A 4P72A 3VGUA 1HNWF 2RUSA 1AW0A 2R7ZA 2OFHX 3HKZE 2MQPA 3TUPA 1REGX 2RAQA 2NZCA 2ZOGA 2HQDA 1N52B 3W8GA 3M4IA 2A0FB 3W3SA 2M9KA 3GR0A 5KFTA 4IUFA 2KFNA 3OLAA 2Y1IA 6FDRA 2FVPA 4QOTA 3W2VA 4LF9F 3CDUA 2K8GA 2YNGA 4YFUA 2PN1A 5L9NA 1V51A 4FBTA 3T6JA 4ZQIA 3T1HH 4I68A 4WFXA 4M5DB 5FLXY 2DGXA 2VOPA 5IC6B 1S57A 4RW9B 3J80Y 4ED1A 5I3QA 4LF7F 3T41A 3VGSA 4CH0S 2PA8D 1F1BB 3CDBA 1XNQH 4FXDA 1UWBA 2VU5A 3T5HA 4DR5F 3MCOA 2MZ1A 1C3OA 2I5JB 2VOOA 3MR5A 2B7BB 4PG5A 1RUSA 2DEIA 1UPPA 4DUYH 3N4WA 4X64H 3R5XA 4A3EG 3Q22A 3RZAA 1VS3A 2NUAB 1Y00A 4K2XA 3T6BA 1RHQB 2ROGA 3RB4A 2E66A 2CZ4A 3V6KA 3KAJA 2YYAA 3I4PA 4TLQA 1VMBA 2R92A 3TAQA 5ETTA 3H2LA 3DDNA 3VPBA 5GMKa 1S5ZA 3R8YA 4MK7A 2OTJS 1I94J 1MROA 4ANEA 2QLJB 3O6QA 5IZHA 1RAJA 2F8MA 2CZ9A 4V19J 2VBXA 4A47A 1M90T 4ZVQB 4DV1H 5HQLA 4K0KJ 2W24A 4J9KA 2CRLA 2KZMA 1I5OB 2D3UA 4C8OA 4BXXG 5DG9A 4I2PB 2LLZA 1UC8A 4YP3A 3FFIB 2FJAB 3KG4A 3R2DJ 2J9DE 1AUXA 2OHDA 3MD3A 3UNYA 4CLPA 1YITS 1J5EJ 1SL1A 2NXUA 5C4XG 1UW4A 2VFUA 2BEFA 2G1HA 3UDCA 3BGOP 2GJ2A 1XMQF 2DR9A 3G6YA 2UUCJ 1NDKA 4USVA 3TAMA 4RPFA 3BGFA 4ZVPB 4X4PA 2JOQA 1S9GB 3M2UA 1ZTWA 5IT9W 1C2PA 4ZIWA 1EETA 2F8HA 3CD0A 2QIFA 4MKAA 1X0PA 4WP9A 1J2VA 3GONA 4J9LA 3VTIA 4MKVA 1ZAVA 2R87A 4UCSA 2RF4A 4DX8H 1N33F 4WFAQ 2VPWB 1FDBA 1NK6A 2A2CA 3CC4S 2RF2B 3AOBA 2XY5A 1CSJA 2DXFA 4H4OB 1EQMA 1RAEB 1NEEA 3TJ8A 2DPIA 4F4KA 3PKYA 3NNHA 4JI6F 2OFGX 3LPYA 1CEZA 4ICLA 3FSXA 1U02A 2JA6A 1ICEB 4O0NA 4I0WA 2AJ2A 2E1CA 4RWWA 4L74A 4FNIA 1FRXA 4TY9A 1EQ0A 2WW8A 5GAGU 2MTLA 3FNNA 4ZVOB 2LDIA 5CAEB 1NJWA 2J76E 4ECYA 1M5PC 4F25A 3HM9A 1HPZA 2IA0A 2OPQB 3T1HF 3FRYA 1C1CB 4RB0A 1LWXA 4ZITA 1GXTA 4XDCA 1K8AT 4LR8A 1E4FT 4NI2A 2VPQA 3HZGA 1S1XB 3DNCA 1KVIA 1A0IA 1YGYA 2ZUAA 3NGKA 4F8RA 4A8XA 2B9XA 4O4LF 1KNZA 3FQKA 2VJVA 1W2BR 3CD7A 2PFDA 3JSBA 4JP8A 1H7XA 2QC3A 3CVKA 2FB0A 3S6EA 4XO0A 2V69A 2XMWA 4BCAA 2YNIA 4DUYF 2KB2A 3I82A 1S97A 1RAOA 1FE0A 5DLFA 2B6AB 3GFYA 5B0DA 2VB6A 3FC9A 2W6ZA 2UXDF 1JLAA 4C2MA 2VC1A 2NU8B 2LECA 2VC0A 4LBIA 2FPHX 2LCWA 3R5DA 4LSAA 2Y9HA 1D9AA 1GAOA 1GQEA 1TK5A 3PJXA 2ZH1A 4J9RA 2V8DA 2BJ7A 2I6WA 2R7ZG 1WJ9A 3VAHA 3G6VA 5FLXW 3I56S 4DR2F 1U25A 3BAAA 1A9NB 3HVTA 2BZ2A 3MM7B 2BACA 2PC6A 2MKYA 4P7TA 3KHRA 1RHJB 4ZPDA 3KMSA 2NS1B 2XGQA 3THTA 3NY0A 2RVJA 1I6UA 3BKUA 4RUBA 3VWSA 4HACA 2ZKTA 4KSEB 1WF2A 1IBLJ 1ZBTA 1H6KX 2POKA 1ZA1B 4YDXA 4TQSA 3CEDA 2VQFJ 2DY9A 2IRXA 1JKHA 2N82B 4UOCA 4JV5F 1L3VA 3RAQA 1V4YA 2MKCA 5F9LA 3PX0A 1YZ7A 1SH3A 2CPDA 1S48A 4WFYA 4DUZH 3EDRB 4C97A 1RXOB 2CPIA 2OH2A 3K5MA 4OLOA 2VA3A 3ONQA 2DNLA 3R5JB 4N56A 3MHYA 3ZTOA 3DXSX 2ZD1A 5E7OB 4DV4F 1KTQA 2VBYA 1NK0A 3PYDA 3CJTA 3SQOP 2RJZA 2Z2YB 3RRKA 2WONB 3RV3A 2ZH8A 1IR1A 1TL1A 4O4IF 3H40A 3WX4A 4A8OA 2J70A 1FRIA 1ZYQA 1BQMB 1RTJB 4I7HA 1VJWA 3QSIA 2DR8A 3VAMA 3KLHA 2RKIB 4EZ9A 3LALA 4QW8A 1VQ4S 3V4ZA 4MAMA 3QJLA 4RW4A 3AHPA 3VQTA 3GP9A 5D4PA 1XNQJ 5J2PA 1PX2A 1CBKA 2K2PA 2YX7A 1G3OA 1HBUA 1N36F 1CJKB 1MU2B 4X64J 2GJFA 2HWHA 3RGIA 2RNEA 2HFZA 3MEGA 3PHTA 3DCAA 1FCAA 3DOMA 1BXRA 5KG5A 1HARA 4F4WA 3CDEA 3N28A 3MMBA 2B7CB 2B63G 4LJMA 3KK3B 1WI8A 2VA2A 1KDNA 1M0SA 4EK2A 4JI2F 3OHAA 4KHPF 1Y0HA 1PJ5A 3KUGA 2UP1A 2XO6A 1UFLA 2L08A 3OSPA 3A8KA 1YRXA 1SUQB 5IP9G 2MYFA 1WSVA 2HJWA 1GH8A 4I1TA 2F4VH 4JI8H 1V5VA 3B82A 4WKRA 1HBNB 4HDGA 3TWZA 4ZP7A 3C6TA 2C35B 3JSYA 2VUMG 4DR1H 3ADAC 4UUWA 4ZPAA 4KBIA 2BJDA 1CC7A 2OLWA 4I69A 1Q8LA 2IPOB 2IBKA 2OIHA 5IWAJ 4OHXA 4DR3H 4DV6F 3BO3A 1AT1B 4OYPA 4X62F 4RX6A 4ZVRB 1TL7A 3B4MA 3TZYA 3KTMA 1X5TA 5F8HA 2DO0A 2ZBCA 3ZNUA 1X0FA 4IWXA 2AJFE 2CPYA 4KT0C 3M8YA 2YKQA 4DV3J 3EZXA 2Q1LA 3HKZD 2P9EA 2IC3A 4R7RA 4BHQA 4OZ1A 4K4ZA 5HMYA 2I8CA 3FBBA 3K5PA 3I9V9 4PKDB 5ETVA 2IDEA 1NCLA 2YKNA 1VC0A 2ACYA 1Z2NX 3GTJA 4KPCA 5I3PA 3GWCA 5GMEA 4B3RH 4Y2CA 3NOGA 4B9NA 4ECWA 1NB7A 3M8SA 1W26A 1GK8A 3FMWA 1Y14B 2C3UA 3TZZA 4RWXA 2I80A 4ZVGA 5C3EG 4URGA 4C9DA 4DL4A 3PRBA 2YWKA 1E4EA 3UVJA 3EYZA 1BWVA 3NP5A 2JA5G 4TQRA 4USHA 1KWMA 4HT7A 3KLFA 1F3VA 4W92B 1RWMB 3IR5B 1REVB 4OHWA 1UAWA 3HCXA 1IKVB 2MLXA 2YKOA 1J5OA 5K9FA 3BJYA 3CD5A 2DY1A 1QSLA 4B3OB 1TAUA 3JRXA 1HNVB 4Q45A 2B6AA 3M6WA 4KV8B 3DI6A 1FKPA 3NS7B 2A10A 1N33H 3GIPA 2J7KA 4WP8A 1JLFA 3DRXA 3WZ0A 5KFVA 3HXLA 1FFWB 3DM2B 1I6JA 3BR9A 4LF9H 2CUYA 1VDHA 4QCLA 3RUBL 1RJQA 3QPIA 1FEEA 3G6ES 3JSLA 3ETOA 4F0MA 2W2MP 1RT7A 2PN6A 1T9WA 4CNYA 2J0SD 2DNZA 1CJUB 2B9WA 2CJXB 1T95A 1N34H 4QJFA 4URQU 2AYBA 3UDLA 2RIJA 1C1CA 3U7JA 4ECQA 3MF5A 4LSLA 3AYHB 4WBFA 3QWUA 1CJUA 2ZHAA 4HNTA 5CZXA 4X64F 2R7WA 3MM8B 5CA5A 2VG5A 3UWTA 1IBLH 2HIQA 4WYWA 3HT0A 3IG1B 3E01B 2RH3A 1DY3A 1I1GA 4OYZA 5C24B 4KE5A 2JEIA 4C5CA 2M52A 3BQ0A 3UD4P 4IDKA 4DWIA 1FJ7A 1T11A 2AU0A 4JI6H 4O0IA 4KGZB 3OXGA 1FESA 1HWIA 3QSYB 1BC6A 3LGMA 2ZD1B 1DURA 2JC0A 1KFSA 2J6ZA 4ZPCA 3PTWA 3D6FB 3MM9A 4ETXA 2HWIA 5JH7F 2B51A 4FYYB 5H80A 2X1FA 1R7IA 5JQWA 4LMZA 2V58A 2V5HG 2EFGA 3G82B 3TA0A 4DPXA 1NH7A 2HBQB 2J0WA 3HVAA 1R8JA 2ZE2A 4DPUA 1HMVB 1BXNA 2F8EX 1FKPB 2FLPA 3AOAA 1WOSA 4GKKJ 1ZS6A 2ROPA 3M6XA 2VONA 1C30A 4WPAA 3IVAA 3DM2A 1RAHB 4QIFA 2W9BA 4HACB 3CXCR 1O8BA 2CVIA 1A6LA 5KG0A 5J2MB 1V3RA 2IAJB 2DHXA 3RRHA 3Q23A 3T5LA 1JXVA 2HGMA 4NXMH 1RBAA 3R3TA 5A8WB 4ATNA 4QQBA 1LXJA 3SIPB 5DLGA 5DZ7A 1UW9A 5EDWA 3SEOA 1FNXH 3MUMP 3M6VA 3MECB 4F3QA 2ZJPQ 1L3TA 1XBWA 1Q4RA 3GE9A 4P73A 3CCVS 2R85A 3N44B 2AF6A 1KVJA 5FIIA 3OTEA 4OLPA 4MK9A 3MM5A 2Q43A 2DNPA 3AD8C 1DQ8A 4DN9A 2KXHA 1WC0A 1U1NA 2YL2A 3EVOA 2Q66A 5K8OA 4B3SH 1QUPA 4D3GA 4X4VA 2YQ1A 3Q8VA 4WTYA 3OFFA 1RE1B 2Q3PA 4Q0YA 3GCWP 3JSNA 1C0TB 3MWMA 4Y3CA 1XMQH 4AL5A 1D8YA 4F2RA 2E5LH 3C46A 3BBBA 5A8RB 3FJ2A 3CQZA 1U47A 2QLWA 1G2EA 2OP5A 3V4MA 1NZAA 3D7SB 4PEOA 4MKYA 1FVSA 3QRPA 4OV6A 1E4GT 4ZPVR 2XMAA 1V6HA 2ZE2B 1ZAWA 2XYHB 3KJQB 4K7QA 2AX1A 3J81W 1RTDB 2Y1RI 5HMZA 1YJVA 4B08A 3K5NA 4OYMA 4RNNA 1DV1A 2LXIA 3VR1A 4B3TJ 2HSEB 5M2RA 5KT4A 2IAJA 3SMZA 2K3IA 2YNHA 4UF4A 4WP3A 5AE3A 4FP9A 3H0GA 4HT5A 1I7NA 3PO5A 3R7SB 1YQHA 3D6TB 4FVMA 4KTQA 3FCHA 1MWYA 1M0TA 4YN3B 2JA6G 5DG8A 2KVIA 3QNWB 2KH9A 1TV6A 2WYOA 2MHNA 1RISA 3UQ8A 3HK2A 3TA2A 3H4DA 2RDDA 1Q5YA 2C2ZB 3VALA 4Q5VA 2Z2ZA 5CXTA 4LF8J 3T1HJ 2DITA 5DM7Q 1TTHB 4ZCLA 4DCOB 2E9RX 3NRBA 4G1PA 3HOVG 5KFIA 3Q8QB 4LF1A 2WB1A 1XEZA 2GPWA 4S0MA 2V8HA 4WXWA 3MXHP 2DTJA 2R7VA 4A8MP 3O8WA 4JI0J 3SCJE 3JAMY 5D3GB 3R2CJ 3SCKE 3C66A 2XTJP 1X4EA 3IA0A 4M95A 2FJEB 2EPIA 4TV8F 2VQEF 1IM6A 4K4WA 1AN7A 4RB1A 2FJXA 3PW5A 1VC6A 1NK5A 2YQ3A 1TELA 1C1BB 2RMLA 2SXLA 4FNHA 3K58A 4OZLA 4LRDA 4OI3A 1QAYA 4DL0C 2FJZA 2D1CA 1JLGA 1R0CB 3OVAA 2IFXA 4P74A 2DRBA 3EVWA 2ZKUA 4MAKA 2ASYA 4DV5F 4PQAA 5K8MA 1SKWA 2VF3A 4XX0B 1O75A 1U1LA 3FFIA 3NEKA 3ZZOA 3PW0A 4YJ3F 3VAIA 2KKHA 1D3WA 4ZMMA 4RAYA 4PWDB 4NYOA 2WSEC 3OFEA 4LT6A 4I55F 3BPDA 1OPIA 2W7PA 1NK9A 5KX5F 1WKJA 3D28A 3SDEB 2HQGA 2HLTA 2QEXS 2CNKB 3LGHA 3G9CA 3T3FA 1SJ1A 2QE5A 1YBUA 2XS2A 1JLFB 1RT5A 3MUVP 1FJEB 4LREA 3I31A 2KG0A 2FPIB 4LF7H 1UVNA 2X3GA 2V68A 1B7FA 3QGIA 3MR3A 5KFBA 2ZHBA 3DLJA 4NX9A 3QGGA 3OUYA 2J6SA 2YKNB 5KG6A 5C44G 1VOMA 2JLEA 4LSNB 3CMQA 2ZDQA 4GMKA 5IS2A 3RBXA 3D54A 3KMQA 3A3NB 2NXJA 3G8TA 1U26A 4LRBA 4N8NA 5CA0F 1BQXA 4DOZA 4C0BA 4DR6F 3B54A 5DDQC 3LWBA 3T1YH 1RP5A 1AUSL 2MGZB 3D5MA 3UO0A 3QGHA 1BQNB 5IWAF 4IFYB 3M1MA 2BKNA 2ZBIA 3HFVA 3MECA 3E01A 3MM6B 4LF9J 5H9EK 1S1XA 5A6PA 3G8CA 2V9WA 2QZ8A 1SJQA 4YAJB 3HFKA 1S1WA 1I94H 4FF2A 5BR8J 5IM0A 1PK8A 2HRYA 3U9SA 2E9TA 1CS0A 1N5VA 2B4UA 3A8JA 3Q1KA 1J27A 1EP4A 1OWTA 1R8HA 3JB9k 2L9NA 2QMWA 2PA3A 1HMVA 2OAUA 3NGUA 4MV3A 2E5LF 3QT8A 5CD4H 3IR7B 3PEJA 4IG3A 3H3VH 2W4PA 2DR7A 4NRUA 3TYTA 1VBZA 3GTOA 4E4TA 5L1IA 2ASJA 2VFTA 1G6BA 3AJ2A 1HR0F 2COLA 3FBEA 2W2OP 2GNKA 4LF8H 4YB5A 2BKPA 4A3FG 1R6VA 2B9EA 5KFCA 3GSDA 4E2FB 2VV5A 2XEXA 5J1NA 4DLGA 1JNRB 2M0GB 4JI4H 1T05B 3DRPA 5FPOA 5IT0A 1QDUB 3G2XA 2DYAA 4W4MA 1NSPA 5I42B 1K83A 3NCPA 5HN0A 3UCUP 2E5LJ 1X9NA 3KHHA 4TXSA 1FKAH 4GC6A 1LWEB 4KRWA 3PVXA 1RWOB 5BJRA 1QM9A 5BPFA 4QU6A 3H90A 2EW9A 4N76A 2XULA 3SXLA 3ZTPA 4PCQA 2J6TA 3PG9A 3RJMB 2IJNA 3BSNA 4C3KA 5E5NA 2W7OA 4L3NA 4LF8F 4MFBB 3EUNA 3DRSA 1RCOB 3TQEA 1NKCA 5K8NA 1M5SA 3TAPA 4ELUA 3IS9A 2YU9A 4FKXA 4WIIA 3K0JA 2XO7A 2V8VA 4CT8A 2AWZA 9ATCB 1DGSA 3E5NA 3R1LA 4DV3H 1YJ9S 5IQQA 4OYOA 1FFSB 4NLOA 3BGRB 1RAGB 2CQHA 3MOZA 4OJ1A 1S49A 4C8MA 1XDNA 4RR5A 3GLKA 1NKEA 3NMRA 1YX2A 1HBMB 1WHXA 1UC9A 5C1OA 4JI5J 4DR1J 4LH7A 3CNQP 2BRKA 5ETMA 2BW2A 3DOKA 2RQKA 4BDPA 2R7OA 2CWXA 4DV1F 2VPXB 3E2EA 2CWKA 4LH6A 3MCNA 2RE1A 3LMLA 1Q79A 2XGPA 4P2FA 4NYZA 1IBLF 2AP6A 4QYZJ 2NVYA 5E0OA 4APMA 1HLWA 4QIWD 2V4JA 1SIWB 2C2EA 3DF7A 1MZBA 4RU2A 4A3LG 1RHRB 3C6UB 5IYBG 3KJFB 3ENQA 4IH7A 1S6UA 2AJ0A 3L2PA 2R93A 3FQLA 3CCUS 3EXYA 2YPYA 2KFYA 2YZMA 2VJUA 1HBNA 5LT5A 1RU2A 5KOXA 4KH0B 5EOYA 3WDOA 3ZZRA 2V4QA 1K1SA 2VPYB 2MJNA 1T9UA 2QA2A 5KFDA 1VQMS 2ROEA 4ZDNA 2Y3YA 4Y6IA 2PSZA 4JV2A 5HP1B 1CS4A 2XLJA 2BYCA 3QGPA 1O0PA 4HVZA 4AQYJ 2XMJA 3PRDA 4HTIA 3G6XA 3AT1B 3VQSA 4DV5J 4FYVB 2WK4A 3OL7A 1WKLA 3K17A 1S99A 1RLCL 4IRKA 3DDKA 4F0HA 3K8WA 1XMOH 2G0CA 1Z2ZA 1RTIA 1EAYC 4Z2XA 3D0HE 2CA9A 4RB3C 4K50A 3V4SA 4WZMA 3C14B 2ZJRQ 3KLIA 1T03B 1N4LA 5IQ6A 3E8OA 2EI5A 4CLTA 1BE4A 3BKFA 4I56A 3AB2B 2AGPA 2FDNA 3QIPA 3UCZP 3AD7C 4J5OA 3QZ7A 3D0IE 4RUHA 3MJFA 2Y0SA 1DV2A 1UA0A 1HPZB 5KFHA 2RSQA 4RBVA 3BGLA 1S76D 1H98A 2YW2A 4PPZA 3J7AK 2E5JA 4QWDA 5L1LA 3QT7A 1BMQB 3IWNC 2WSCC 3BBCA 3CCES 4NLVA 2R7TA 5K20B 4IH6A 3HHEA 3OW2R 4M1KA 3C15A 4C3MA 1ZZFA 2NU7B 5HQ8A 4ED8A 5HBRB 3L7OA 1B04A 2VDIA 1ZA2B 1T8EA 3KTQA 2RB7A 4KGXB 5IT9Y 3H5UA 3EX7B 2MXYA 3IN5A 1WHYA 2ILYA 2E29A 2IA6A 1FJGJ 2GMLA 4NCGB 3LP2B 3TO8A 3AQOA 1P27B 1P1TA 2OGUA 3U1MA 2RF2A 1R0BG 2WRMA 3RFCA 2RRBA 2NR0A 1XMQJ 2LQ5A 1KLNA 2VASA 4FN5A 3GMGA 1VQPS 1DTTA 5F41A 1CJVA 3UQSA 4UCOA 1YLXA 3PACA 2HBYB 4IFVA 2B63A 3Q2TC 4OJHA 1HNVA 2IM1A 4I2PA 1WF0A 3KUHA 5CYJA 5LYJF 3I4MG 2R84A 1S0OA 4MV8A 1HIYA 1XR5A 4R8UA 5HMXA 1S1VA 3AAWB 4LFAH 2R7MA 5IP7G 3J7YU 2YWEA 3W2WA 4DV2J 1WCMG 4MV6A 3TAMB 1RTZA 4EZ6A 1I7LA 2DGSA 2XD4A 5GAHI 1FDDA 5DDOC 4KJIA 3BF4A 3JTPA 2BJ3A 5HLFA 4K5RA 1UTAA 3ZFVA 4PAAA 1RT3A 1EETB 2XMKA 1UMJA 1W2IA 1TL3A 1FWPA 1S7HA 4NXMF 4M5HA 1VGYA 2VICA 3GTGA 4MYTA 1JDBB 4M5LA 2PGCA 4J9MA 3I9ZA 3MFIA 2V4RA 4I4TF 4I4BA 3ZZUA 4JB8B 5IYZF 4DV0F 2K7KA 1Y1VA 1VIXA 2R3VA 4DL2A 4H4MB 1XQIA 5GAHU 3HD2A 5F8IA 2GCFA 2JVRA 3CE8A 1X9WA 1SFOA 4KAIA 2VIHA 3GJQB 4UY85 2EG1A 1U0SA 3DLEA 2WB1E 3NG8A 4K4VA 4GLXA 2BJ8A 4M0MA 4OX7A 4DJBA 1LW0A 3OR1B 3ISND 4U7UK 1FX2A 4DSFA 1D8ZA 1S72S 1T3NA 3WBZA 2HHXA 1KFDA 5KFZA 3OBIA 4C3LA 1FXDA 4HH3C 1LWFB 3POTB 1LWCA 4PG8A 5EWEA 2P9GA 3NCQA 2MQ8A 2V63A 3OT9A 2Y0SD 3OJSA 3QMQA 4O4HF 4N47A 2KZZA 1Y7PA 2FMAA 3H0PA 4XPCA 1W25A 1R8PA 2UVUA 1IR2A 4DR1F 1IVZA 2XWXA 4JI5F 1KC7A 3DOMB 1SB6A 1UTUA 3UD3P 2NPFA 2GO9A 3PX6A 3CWJA 3KHLA 3JZIA 2J7UA 2YCHA 3C6UA 5F8NA 1UNNC 4PABA 1W93A 5FD1A 2AHOB 1FRMA 2R8JA 1PYTA 3M8PB 2I38A 1JDEA 3N01A 1P6TA 5JVHQ 3KK2B 2WAQE 2EG2A 1GO3E 2OSRA 1HNXJ 4IKAA 3L4JA 1DRZA 4F4YA 3SE7A 2QLBB 2G1DA 4U95A 2UVRA 3DRSB 2G2ZA 1U8WA 3PW2A 3GLJA 2ZUGA 1PC4A 2KJVA 2Z2LA 3GV8B 3MPWA 4WU2A 2WONA 2WCXA 1VRUB 1J5EH 2Y8WA 1X4DA 1HD0A 2Y1LB 1BQMA 5ETQA 4Y2KA 2QN6B 1RBOB 4CP5A 2DNOA 2CIMA 5DETA 3J7Z5 5EX3A 2ZDPA 3NS6A 2V9KA 3IWLA 5L46A 4GC7A 3KG1A 4Q2LA 1V3SA 4GKJH 1RZMA 1GMWD 3ILOA 5KT6A 1SC1B 1MU2A 1R6YA 3VZIA 2KSWA 3TRGA 1RHUB 3MEGB 1UWAA 2CFXA 5U47A 4CLKA 3ILLA 1FT8A 1RTHA 1HNXH 2MZQA 3N42B 4DZ6A 2VPSA 3GFZA 3DLGA 1RSCA 1FK9A 2PT0A 2UXBJ 3BS9A 1B33N 1CULB 2UUBH 7FDRA 5A8WA 1EHWA 4P71A 4RNFA 2J5AA 4RNOA 2LKZA 4B3TH 1ZAXA 3MAQA 1T94A 3MMAB 1L3UA 1WUUA 2HS0A 1I3OB 3NCRA 3CJ0A 3WO0A 2NYIA 2AYEA 3FEZA 4KH1B 2PFFB 2W9AA 3SSQA 2ZBQA 4ZIVA 2M3DA 2GVDB 4EGJA 1S79A 1IBMH 1F5AA 2R6FA 4A8WA 4DR3J 3CUNA 2E9ZA 4QIVA 4ECTA 1FXRA 2ZBPA 4DHVA 4ZCKA 3IGNA 4RW4B 4X8QA 4O4GB 1IJEB 4J0MA 4AT1B 1V2ZA 2FC9A 2A18A 3JQMA 4AYBD 1IKXA 2MQQA 2RDJA 4KV8A 2HVHA 1FWLA 4CH7A 3KK1B 1R5QA 3PX4A 1U2CA 3UN5A 4PG4A 2Y8YA 4JGIA 2PEHA 2JWNA 1K7YA 5A8KA 4CYUA 4ZHRB 4EO6A 4X4TA 1ZPVA 4L6V3 1EZZB 3KFWX 2MB0B 2R7LA 2XBPA 3I0RB 3M32B 4CCHA 1YBAA 4OIXA 2Q2UA 3GTMA 2Q6CA 1Z2LA 1QTMA 1U6ZA 1BHNA 3P5BP 2OKQA 4YMEA 4WFZA 4MA0A 4JI5H 4DV0J 3V2UC 2QSWA 1LOUA 1QD1A 3OSNA 4LFCF 1C1BA 2JHEA 1WSRA 1VQSA 3CJRA 3K57A 2AZ1A 2YZNA 3MMCB 2Q79A 4YHHF 2FJBB 4QWBA 1JLEA 4PUOA 4LF6H 1XNRH 1Q78A 3VAGA 3WO1A 2FQQB 2KDOA 2H5IB 1Q8BA 3C8YA 4LBPA 1IKYA 1NAQA 1TAQA 2F40A 1RABB 3KUEA 2FVQA 2B5JB 3RB0A 5C2CA 4P6QA 1QJHA 2X1BA 2YRXA 2FZGB 1RAAB 3H2UB 1PKUA 2JH3A 2GGPB 4IO9Q 4LF4J 1YWXA 1FTCA 3TUZC 1RWWB 1CVJA 4UZCA 1I3QA 5AJ3F 1SH0A 4M5JA 5HV6A 3D67A 1UFWA 3UI3A 1N5YB 1FJGH 1WR2A 2WOMA 3J81j 2NXEA 1T02A 1MNEA 1QVGR 1VJQA 2ZFHA 1E6YA 2B56A 1WC5A 4RW8A 5DS7A 1YK9A 1D9FA 3WC0A 4LSLB 2R2UA 4P2XA 3ZTRA 4A3DG 1NZ8A 1RJPA 1TWAA 5KOWA 3KLVA 3FUYA 4DXLA 4M5NA 2X0SA 2YNIB 1ZOTA 3FCVA 3ISNC 4DL3A 1WC4A 1TZ0A 2NU9B 2VFRA 3VHQA 1VS0A 2R7NA 4RW6A 4ZPWR 6AT1B 1H2VZ 4GVLA 2QMUB 4IAJA 2N4DA 5JVLA 3BSCA 1HNZF 5FLXU 4DV4J 4YB7A 3AQPA 1HHTP 2EEYA 2HNDB 1VBYA 5LMNJ 1YRTA 2VH7A 4ILRA 1Q53A 4BBSG 2C2MB 4NYPA 3V6DA 5LXYA 4A8QA 4FU0A 1Y10A 3C2PA 4I2QA 2VKRA 1DTQB 4OX9H 2L3MA 4Q2MA 4U9RA 5A0YA 1D0EA 1WCMA 1O51A 3MD1A 4TLRA 2V2VA 3PN1A 5CCMA 5BYQA 4HHHA 1R31A 2R8HA 2GVZA 3NNAA 4XTTA 1YVFA 1GYFA 4AQYH 1NK7A 1TU0B 2RGRA 3JS9A 3TJ9A 2CNLB 2HQFA 1FA0A 3CCJS 1I94F 4RBUA 2P9CA 2CW8A 1YTYA 4NCAA 4WE1A 3NAHA 2D69A 3W2VB 3A3OB 2IRYA 2CQ2A 3UDEA 2W9CB 2BE9B 2QT7A 4DPWA 4KO0A 2UXDH 4ZLLA 1FVQA 4LFCJ 1UA1A 6FD1A 3Q83A 1RT6B 1GSHA 4AD6A 3ETHA 4CM2A 4MV9A 1JXLA 2P0AA 3M9MB 4EO8A 1U09A 4MYUA 5KG4A 3CULA 4J9OA 1BGXT 2E1RA 3UW1A 4LFBF 2BBEA 2R4FA 2CJBA 5F0WA 3QIDA 1AUDA 4DPYA 5IWAH 5GONF 2OO4A 5HJYA 4X4OA 2K06A 1TR0A 2MQOA 3FKIA 3Q89A 1B0TA 4FYXB 1FRKA 3CJSA 2C2KB 3MI7X 1VLOA 5HROB 5LOQA 4MTPA 2AKWB 1ZM3A 5BXIA 3TARA 1G4CA 4TYBA 2WW4A 1EX8A 3V81A 2CKWA 1U24A 5HJXA 1AFJA 3M4XA 4NLYA 1RTHB 4OZ0A 2HVRA 2MJUA 2DRDA 4JI4F 2EVZA 1Y9OA 2O66A 5JVDF 2ZZNA 1SCUB 5G0RA 5DDPC 1WSCA 1IJFB 1B99A 4YY3H 3LW5C 5HSPA 2HRTA 2B4OA 4PWWA 2F65A 3FMAA 2RS2A 4LR7A 1HR0H 2BOAA 5F3TA 2H51B 1N56A 4CO1A 2IYIA 4KHPH 4ZVSB 3QBCA 3UR3C 2ZZMA 1KJ9A 3O5TB 1SQEA 4RBTA 3PYFA 2CQGA 4HH1A 1CQIB 4DFMA 3HP6A 2OELA 4NCGA 4WIQA 3F41A 3BN7A 5GAEU 2K7JA 2HFOA 4RUAA 2V2QA 1NHUA 2CXEA 4DUZJ 1U0HA 4O2BF 1VRUA 1VQOS 4GKJJ 5EZYF 1XR6A 2FJDB 3ZXWA 1X5SA 2AEFA 3OR2A 1SQFA 4AXIA 2F4FA 2IY5B 5KFFA 2V8PA 5AXNA 3OL6A 2MHEA 2GV1A 1XC9A 4JOUA 2CPZA 3BGRA 4P75A 3JYTB 4DG1B 4C11A 2HWTA 4RO0A 1L3SA 1WELA 1HD1A 4XK8C 1I51B 2YWGA 3BYPA 2ZC4A 2R93G 2WB4A 1D09B 2IYGA 4CLUA 3R5HA 4JBCA 1N36J 3KK1A 3JTNA 4NOHA 1JNZB 1X7VA 3NKYA 5KG3A 1RWKB 3I5AA 1T3OA 2FK2A 2HGLA 5KG2A 3KNGA 2XYGB 2FIUA 3N43B 4F2SA 4CZCA 3MMJA 4ZA1A 3J80W 3QAUA 2FC8A 4NLXA 2BW7A 2V4JB 4MA5A 3IAS9 1KS2A 2QJ3A 4TU8A 4DV7J 1PIEA 4N7TA 2FY8A 5E2QA 3MEEB 3H42A 2DCLA 1VLYA 4D3HA 3FRZA 2NREA 1SV1A 1KKHA 4EGLA 4PYDA 3W9JA 5MAOA 4ZOLF 1UCNA 1MWZA 2AD9A 3MEDB 2AYGA 3HFZB 3I0SA 5J2TF 1N0VC 4PQUA 3EVMA 2B5JA 1KN6A 1XR7A 5IYCG 5HK4A 3BSOA 3HBLA 3M6UA 4CO0A 2UUWA 1IKYB 1XNRJ 1S77D 3C19A 1VBGA 4KGKA 2P6SA 4WTOB 3GYNA 3MDFA 4QWEA 2VQFF 5JJBA 2VHGA 4ANDA 5J1PA 1URRA 2ZM6H 3CJ4A 3K5IA 4A3BG 2YKMA 1K47A 1V5IB 1GTHA 4B9TA 4C8YA 1CPZA 4NPOA 3PCOB 4DV0H 2XY7A 3OTOJ 2OEJA 2E7WA 1KLMA 1OQ3A 1AUVA 3VV2B 4USKA 2V2ZA 4WFNQ 2MMYA 4V1Ak 3TNVA 3OFHA 3N79A 3CIMA 3KLGB 2XS5A 2ZH4A 2CG4A 2HHHF 2OPPB 4O3QA 4FXVA 4QIGA 2ILZA 3IGVA 4A3CG 2FKLA 4A2AA 3AJ1A 5LXTF 5SUHA 2I8EA 1F60B 4RUCA 1VQ9S 4Q0BA 3M8PA 2CYYA 3MAAA 1YJNS 4CLZA 1VQ8S 3R7NB 5B0GA 3O3LA 3QRQA 1K44A 3M8ZA 2WVEA 2BVZA 4O4RA 4ELTA 3KJNB 4DR4J 4M7EA 5D0GA 3A13A 3J7A1 2CQ3A 2YBVA 3HI9A 2YNFA 1R3NA 4CM0A 4DPTA 1ROFA 5LL6b 2MKJA 3US5A 4M5KA 3MR6A 1FJCA 3UFCX 1IM4A 2CQYA 3QZ8A 4A2BA 4HNVA 2JFDA 4A3GG 4O2AF 1OJ4A 3CIZA 1WD6A 3HDSA 4DSJA 2UV8G 3MCSA 5B09A 4IR1A 2ZDOA 3RYLA 4O23A 3V5RA 1EKSA 3LP0B 4IG3B 1NUEA 1R43A 2QSFA 3DLEB 4F36A 4M94A 2W6OA 4CT9A 4RZQA 2R8IA 4A46A 2MZSA 2ZH6A 2HAFA 2P2CB 1TK8A 2B8QA 2FP4B 5B0CA 3VZHA 1XNQF 3OVSA 2EKYA 1YBTA 3LAKA 4NXNJ 3DKDA 1OS5A 1IBKJ 3UN3A 1SLYA 1QE1A 1QAIA 3OL9A 1N33J 1OQ6A 2WBMA 2VOBA 3W1YC 4O44B 5B0AA 4ZN3A 3HKZA 1Q16B 4J9PA 1GSOA 3NNCA 2R7XA 1A7GE 2G4BA 1SCJB 1NXIA 3GFXA 1XTZA 1Y5LB 1NO8A 2JDJA 1S0MA 2BV3A 2HAIA 4DSEA 2OWOA 5HLFB 3VAJA 5HVGA 3KNAA 1OO0B 3X1LB 4OZJA 3DYAB 3PJWA 2UUCF 2WDTA 4F0KA 1B4SA 3M8RA 1JJ2R 3BJDA 5CB4F 1EUDB 3ICLA 2M2BA 3T1YJ 4JI7H 2YNFB 2VG6A 2VZ9A 2RKIA 2Z57B 1RWUA 1RT1B 2OPRB 1RTJA 1W53A 1X31C 1S68A 5RUBA 3CCTA 4QWCA 4WZQA 2MKSA 1FKOB 5J2PB 4P52A 3SI8A 5KT5A 3TIGA 5KFUA 3D1OA 1ULZA 2QX0A 3L95X 5EUHA 4DEZA 3LP1A 4ILLA 1RYRA 4DSKA 3G87A 5LJ5Y 3PZPA 2HS4A 2BA9A 3CDWA 2DIVA 3PJ9A 4QIWE 2CQ1A 2XNRA 3ZO7A 4DSIA 4HI2A 5DRKA 3IXQA 1CC8A 1RU1A 1T7PA 2OEKA 1V9OA 4C0OC 4A93G 4B9SA 2W25A 3Q86A 4YB8B 1NDCA 4ZPTR 2IRUA 2DBBA 1FHTA 2DB1A 2YNGB 4RL1A 2HQCA 2JFKA 1N5TA 2A6OA 1Y1WG 1X4BA 2CZGA 3TQTA 1EJ7L 5GVQA 3L09A 3B78A 5JMNA 1XNRF 4UCRA 3LQVA 5H9FK 1KEKA 1LEOA 1S6PA 3ULHA 2VBWA 4Q8EA 2X7IA 2W8KA 3R5FA 3C6TB 1ZM9A 3FZ2A 5CA1F 4FZVA 1HYSB 4YB6A 3HO1A 3HOWG 1NH8A 1B6RA 1OIAA 2XMUA 2I9SA 1NMEB 3UR0A 4DX5A 3HHKA 1HNIA 2PMWA 4ICLB 2QLFB 4OHVA 2I2XB 1U6FA 3F44A 2HS3A 2AJQA 2VPZB 3PYGA 3PKMA 1VK3A 3E3XA 2KYXA 1XWLA 4I6WA 4DG1A 2OPRA 1X4CA 5D4NA 1LV5A 3CD6S 1EB0A 4RNHA 3W65A 1ZQ7A 2CZVC 2MZTA 5LL6d 1U1PA 3LOUA 1RWNB 3G8QA 3FDSA 1TQLA 2YWWA 1PSDA 2DGVA 3HT3A 3TX8A 1DTTB 4R0EA 3GJTB 4A3KG 1IKWB 4NXNF 3BM7A 1RWVB 2X51A 4JI8F 5E3CA 4ME6A 4HHJA 4A3JG 1GX5A 3P3DA 3GQCA 3D68A 1U1KA 2NXNA 2DH7A 2FB9A 4EU0A 1IKWA 4I64A 5JUMA 1Q81T 4X4UA 1PAUB 3MPYA 4OZNA 3PXGa 1TKTA 3E51A 1ZPWX 2AW0A 3TA1A 3CCSS 2ZJQQ 2MCTA 1BJTA 3IRXB 4ETSA 2YKPA 4IOCQ 2E1MC 4DF4A 3I32A 2EC2A 1JLCA 4PXEA 3OFGA 3T5KA 2AMCB 4QZVB 2CDQA 1RDRA 2L9DA 3N40P 5L39A 2BMBA 4ZCIA 4JI7J 3TVZA 3HSDA 3BQ1A 2QYCA 3ZZZA 4J9SA 1SEIA 2IVFB 2GVDA 2HHTA 4TY8A 5EGYA 4EBDA 3VAFA 2BR0A 3BN4A 4ALZA 5D8DA 2FUG9 4FF1A 2DNGA 1GSAA 1FRLA 3N6MA 1T9TA 4NZ6A 3HVRA 1N32H 3R5GA 2D74B 3W66A 2U2FA 4MKBA 4HH0A 1Z1ZA 3BQ2A 3QFWA 2C3YA 1SKSA 3TZWA 4K4TA 4UTGA 4W98A 3DU6A 1KVKA 5D3GA 1RAFB 1DQ9A 1MMDA 1RK8A 1MROB 1TKZB 2RHSB 5L1KA 2I0XA 1KLMB 1P8GA 5HANA 3ZTSA 1HQUA 4ECZA 3OPKA 1LW2A 3K3PA 3ELHA 1VQNS 4KC5A 3CF5Q 3KJVA 2IBOA 1VRQC 2D9PA 4P7VA 1MN9A 1CJTA 5CYMA 4NEZA 2CJKA 3GSIA 4CO4A 1SVDA 4I6YA 1NJIT 3JSMB 1FD8A 1T36A 3MWEA 5D0EA 1XK8A 4DR6H 2CQCA 3KJVB 2R2TA 2CQ4A 2KXNB 2E5GA 1JJHA 1T9VA 1WEYA 4HR2A 1F2GA 1RACB 2DXDA 1VRTA 4CO2A 1HWLA 2RU9A 3NGTA 4B3OA 1NDPA 5EWFA 1YKWA 1FXLA 4Q44A 5K5MA 4ZLPA 4LF7J 3PO3G 1WACA 4LF5H 4F26A 1YJUA 4Y0FA 1WWHA 2ZEJA 5ADZA 3UFXB 3VGVA 5KFYA 3PNIA 1HWKA 4NMXA 2YH0A 2JA7A 3SYZA 1NK8A 1X8DA 4NXMJ 2M88A 2ZBRA 3IRWP 4UUXA 1JLAB 5J2NB 4DV3F 5A2QU 2EK1A 4DMZA 2UV8A 3RBEA 4TVAB 3CGIA 1LW0B 1YRUA 2WB1D 1ZZNA 4EFBA 3D6MB 1BNCA 4DV2F 3NOCA 1UVIA 5C8DA 1Q5VA 4BC7A 3I4HX 4KGVB 3B4DA 2H54B 2FVRA 2C2RA 4QW9A 4HR7A 2LYVA 2W6NA 4HLBA 4NLWA 2AZ3A 5C25A 3H4BA 2ZWOA 4TN2A 2Y1JA 4KYZA 2JLGA 2EFPA 1U1OA 3MPVA 4YR3A 2W01A 2H5JB 2JL9A 4DV7H 4RLEA 1WEZA 3R5AA 2YWHA 1LK5A 4K4UA 1M1KT 2WVBA 1JJ4A 4FS2A 2VQEJ 4R5PA 2ZM6J 4QPTA 1Y3JA 2MLZA 2V5AA 1QTEA 2BQUA 1UEVA 5ETOA 3HZEA 5FDLA 1X9SA 5LMNF 2WVDA 4J90A 4JI0F 3L4KA 1WOOA 4FYWB 1SV5B 4P10A 5ETSA 1HNZJ 3QAEA 1X4GA 2XZWA 4NRTA 2R86A 3FKIG 3H8YA 4JYAH 5LSRA 1U4BA 5EHHA 1NBEB 1SH2A 3T19A 4NZ7A 4JI3F 4QU7A 2FMME 3EYYA 5KAKA 4WKYA 2XYPB 5LSLA 3RAMA 1TL1B 2H9ZA 5D15A 2M8DB 2GHWA 4PG7A 2ATLA 1IBKF 3SBMA 2FHOB 3MURP 2KG1A 1UL3A 2OPSB 2K1RA 4L76A 1FEHA 2SCUB 1TL4A 1H0HB 4JI4J 1IOWA 3GTPA 3H5SA 4A8FA 1KSPA 1CQMA 3M1VB 3K5OA 1U2FA 1IXKA 5ETRA 3V81B 5AJ3J 1KRPA 3CO9A 3LWLA 1QSSA 1FI4A 5CQGA 1UPMB 1OSDA 2DVIA 2EK6A 4N77A 5AXMA 3OUUA 3RTVA 1QVFR 1VHIA 3LH2S 3CW2C 4YY3J 3J81U 1REVA 4NMLA 2QV6A 3JXOA 1LWEA 1U48A 1ITPA 4DN0A 5G0RB 1OYDA 4K2JA 3NBPB 2HHHH 3IR6B 2W6PA 3RUPA 5I47A 1RLDA 2ATCB 3CJKB 2X1GA 4DR4F 3I87A 5AE2A 1RT2B 2QG9B 2B4VA 2MSSA 4O3NA 3TEHB 1PAEX 3IO1A 1VYAA 4DR7J 2HIYA 1PILA 4LRFA 3R5CA 1FNMA 5L9XA 2IHR1 2FVSA 2J6UA 1CLFA 4FXWA 2A6MA 2BE2A 4O3PA 4QIWA 1JB0C 2VQEH 1IKXB 3HSZA 5LJ3Y 2DD8S 2V6AA 2KJWA 4NE9C 5D78A 3Q8PB 4ZOSA 2BANA 2CQBA 4O4GA 4X4RA 3Q8SB 4ED3A 2PBIA 4DUTA 4DCPB 4B9LA 2HK3A 3ZC4A 1M5HA 3KHGA 3L3CA 3D1QA 2RRAA 1WDDA 1K0VA 2QA4G 1U1QA 1OY9A 2EFQA 5DG7A 2DPJA 4P2SA 2VG7B 4IO1A 2YWFA 4U8VA 4YAKB 4EI2A 3NAIA 4BY1G 1Y3KA 2E5IA 1M5KC 4O3RA 1TL3B 1P9YA 2R92G 1B3TA 2UU9F 1RA7A 3H2VE 3HULA 1R8BA 3QJJA 3JSRA 2OLSA 1Z2OX 2H5EA 2MGZA 1NSKL 1GFWB 2R7UA 3IP0A 2OI2A 1NSQA 1H73A 2PE8A 1Q86T 2OTLS 4LFCH 1MN7A 4U96A 2NZ4A 1GGOA 3R27A 2JZ5A 3RIZA 3OTOH 4GKKH 2XS7A 8ATCB 3EE3A 3MGJA 4K8RA 2U1AA 2LQJA 2DR5A 4LF5F 3R97A 2E2HA 5DQGA 2XSFA 3NS5A 1UWBB 1FNOA 2CQPA 1TKXA 2H4YB 3GZ7A 5AXKA 1TV6B 4IFVB 3DC2A 3KOAA 2FLNA 5F8JA 2QFJA 2DO4A 1B64A 2PMZD 2JC1A 4PXCA 4ZJLA 2EC0A 5IFMA 4G65A 4CRJA 1A9XA 2KT5A 3QJPA 3WX8A 1KC8T 3QYYA 1A0OB 3RV4A 4JI6J 2C00A 3NGSA 3WNZA 1UVJA 4AE5A 1JLGB 1HQEB 3UE2A 1ELOA 2IM3A 2VFVA 2O67A 5ETKA 2G0JA 3DLLQ 3CCQS 1NHKL 3GYGA 4O44A 1GT8A 4NI2B 1WNEA 5IC4B 3VVUA 2NQPA 2F1FA 4MIBA 4X84A 3BZQA 4ED4A 3J80U 2LEPA 1UZDA 4UW2A 1Q8KA 3SQGB 3IC1A 2ALZA 1BQNA 1CG2A 3QLHB 1KJJA 4DQRA 5CCLA 1N34J 1FERA 1KEEA 2OMLA 2Z56B 2CNNB 2FHKA 2LA4A 4B17A 2D41A 1KONA 2B0GA 1WC1A 1F9EB 3OVBA 2XLIA 2W71A 2M7SA 3I12A 1LFPA 4DU8A 4DF8A 3MEDA 3TIIA 1HNXF 3ITHB 4IDKB 4H4OA 2W6QA 2H1YA 1N32J 5A8RA 5LXRA 2WTFA 4H4KC 3KYLA 2QL5B 1EP4B 1EHIA 2FZKB 1S1TB 7FD1A 3Q8YA 2HLUA 5FLMG 3MM5B 4YQWA 2ZWPA 3N6LA 2AYMA 1TVRB 4DBQA 3BG5A 4PWQA 3J7YI 5ETNA 2APOA 3SSRA 2DGUA 2OJ3A 2HYIB 1UZ3A 1TMMA 3M2RA 4H4MA 3SV4A 4I6AA 4DL5A 1IOVA 5LOVF 2KTQA 1ACMB 2YRWA 2HGNA 2ZOFA 3A8IA 2GQ2A 3A1YG 2IP4A 4M9UA 4X66H 2ERRA 2DNMA 2IVMA 2QMXA 2H4WB 2HHUA 2GO8A 2PEBA 4I7FA 4USWA 3POTA 1SPBP 5HVFA 2W7AA 5KFMA 5D0HA 2PMHA 5C42B 1WTBA 3ISZA 3LP8A 1TWFA 1WDTA 2AX0A 2CNOB 1JX4A 1X4FA 3OUYB 3T5JA 4QYRA 1K0TA 5CYQA 4ZHQF 1SBRA 3FEYB 2LFVA 4WXOA 1FE4A 1VRTB 2PD1A 4ZVTB 3MM8A 4DR5J 2GQCA 4USJC 3HHNB 3L4BC 5DGBA 1LXNA 4FKYA 1K9MT 2KO1A 4RKUC 1M5VC 2Z8QA 3H7HB 5DO2A 4Z37A 1TWHA 3TJAA 3PIPQ 5IOLA 4X4QA 3OUZA 3VMMA 4WBNF 4LVNP 3C3LA 1FD2A 3RW7A 1GLVA 5A6WA 3BYRA 1ZHQA 5T41A 1SQGA 3UCGA 1DQAA 3PO4A 4U67Q 3DN9A 2CPEA 2JNJA 3ITHA 3M2VB 2EKNA 4N41A 3R6LB 3DYAA 1IN0A 1AFIA 5C2GA 5B7WA 2C28A 2G9OA 3L7UA 4RZRA 4BLGA 3I0RA 2XMTA 1FF2A 4KKOB 1WG4A 4OZ3A 2BXJA 2DK2A 4EUVA 4USIA 1ZM2A 4PRFA 3ENWA 1LWCB 3LP1B 3HJVA 2XMMA 2XZDB 2IM2A 4WE1B 3CJ5A 1BWEA 1S6QA 4LIRA 4YBZB 1HQ2A 3KXYT 2GFFA 2GA7A 2W2NP 1L2ZA 4DR5H 1OY6A 1RTDA 1WHVA 5GMDA 1S9GA 4DX7A 1S9FA 1NPPA 3CJ3A 4N5SA 2HQIA 3W5ZA 1FK9B 4JI7F 1DLOB 2MQLA 2XMVA 4DSLA 3M05A 2G0IA 2WVFA 4GKJF 1SKUB 2XB2D 4LF2A 3S1TA 4PWUA 4NLGA 2C2DA 1Q1KA 1UVKA 3K59A 5B0EA 1U45A 4AFFA 3C16B 4EEQA 2V94A 4BC9A 4J37A 5B0FA 4MIAA 2V67A 3OTCA 1HA1A 4C11B 2V2KA 4DDFA 4X62H 1NJYA 1D9DA 4F4ZA 3GIQA 3FZBA 1PG5B 1HYSA 4Y2MA 2F5GA 4KB7A 4EYIB 5T7LB 4A4JA 2GMJA 2MQMA 1Q82T 4LMYA 1NPKA 1T9YA 3U27A 2HHSA 4ETZA 3EGWB 3UNGC 2GIRA 4G1IA 1UEKA 2HZCA 5DJBA 1X5PA 4B3TF 3CJ8A 4RU9A 1KTVA 2VUMA 3MAHA 2MY8A 4ILMA 3F8NA 5IXUA 1F9FA 4TKTA 2W57A 2ZNZA 2DGWA 1VHFA 5AT1B 1W96A 4BY7G 3KLGA 2LP4A 4EWTA 1DARA 4WU3A 3WQPA 2YPZA 4USMA 1ZH5A 4Y2AA 3MM6A 1IBKH 4USUA 2HVDA 1FDNA 4ZKAA 2I2YA 3KLFB 3CJKA 3DGPB 4ES3A 3TQ1A 4E0DA 2PMZA 5DQIA 3THPA 4LSZB
chains in the Genus database with same CATH topology
1SQEA 4MK8A 1KVJA 5FIIA 4RBTA 3OTEA 3LUYA 1RJJA 2CQGA 2HW3A 4OJ3A 4HH1A 4LFBH 4OLPA 4MK9A 3HP6A 2RRNA 3MM5A 4DFMA 2Q43A 3KG0A 2DNPA 4NCGA 1JXEA 3BN7A 3F41A 5GAEU 2K7JA 1DQ8A 2HFOA 4DN9A 4G1QB 4RUAA 4NZ0A 2KXHA 3DMJB 3I0SB 1NHUA 4ZP9A 1U1NA 1R0AB 1VRUA 2EFNA 3M8QB 1VQOS 3P49B 3JTOA 3EGZA 5B08A 1XR6A 2FJDB 1U2RA 1X5SA 2Q66A 3BEGB 1GTEA 5K8OA 3OR2A 4B3SH 4ZCMA 1QUPA 4AXIA 4D3GA 4X4VA 4WTYA 4LQ3A 4OX9F 1MMNA 2N4CA 3OFFA 4WYLA 5G4DA 4DV2H 5KFFA 5AXNA 3OL6A 2ZH2A 2MHEA 2ZVSA 2GV1A 2Q3PA 4GO7X 4Q0YA 1XC9A 2BUNA 3Q24A 4JOUA 3JSNA 1C0TB 2CPZA 2GHPA 3MEKA 4Y3CA 3MWMA 1XMQH 3HHDA 2QA1A 2C22A 2KU7A 3MM9B 4CC5A 1Y5IB 3BGRA 4B9VA 4AL5A 4RB0A 2DNHA 1D8YA 2KXFA 3JYTB 4EEYA 4DG1B 4C11A 4F2RA 2E5LH 1QLNA 2HWTA 5KTQA 1L3SA 4U7CA 3CSKA 3C46A 2XIGA 5A8RB 3K5LA 3FJ2A 1WELA 1HD1A 3KAKA 1U47A 5A2QY 4H4KA 3ZZPA 4XK8C 2YWGA 5K14A 2ZC4A 4ECRA 5I3UA 4M63A 1TVRA 1OPZA 2QLWA 1HQUB 2WB4A 3BGUA 2AGQA 1FKAF 1G2EA 2OP5A 2OD6A 4YEAA 3V4MA 2IYGA 1NZAA 4ZVFA 1WTFA 5KG7A 2GJIA 4YR2A 4MKYA 4JBCA 1FVSA 2BRLA 3SDEA 1AXQA 3KK1A 1RI7A 1E4GT 4ZPVR 3JTNA 4NOHA 1JNZB 2KT3A 1X7VA 1V6HA 3NKYA 2ZE2B 5KG3A 3MTKA 2HHPA 1WEXA 1ZAWA 2DH8A 4R8UB 2R8KA 2W9BB 3F56A 1JKHB 3I5AA 1T3OA 2AX1A 3VF0B 1RYSA 3J81W 1OWXA 1RTDB 2Y1RI 5HMZA 1TL5A 1YJVA 2YVSA 4B08A 1VI7A 2HGLA 2LVWA 5KFXA 5KG2A 3K5NA 5HO4A 4RNNA 2XSJB 2W4CA 2DNYA 3KNGA 2FIUA 2LXIA 3G86A 3U1NA 1RGVA 3VR1A 3N43B 1C0UA 3I5BA 4F2SA 3BDEA 2DHAA 4CZCA 3MMJA 5T14A 4ZA1A 3J80W 3QAUA 4AXJA 5M2RA 2FC8A 5HBMA 2KYZA 2WSFC 3GIIA 4NLXA 5CH7B 1N5YA 5KT4A 2V4JB 2IAJA 3SMZA 2K3IA 3H98A 2KFZA 3N0VA 2YNHA 2OPQA 3IAS9 4DR3F 1NU4A 5AE3A 2BJEA 4FP9A 3GR1A 2EBGA 4XDDA 1KS2A 4TU8A 4HT5A 3PO5A 5E2QA 1YQHA 3MEEB 2DCLA 4H54A 4RW8B 1SV5A 4K0KF 2BQ3A 3NMAA 4FVMA 1VLYA 4D3HA 4RAZA 3PW7A 3FRZA 4KTQA 2RUGA 3FCHA 5CYQB 2NREA 1DFDA 1MWYA 4NLQA 1WH2A 2FJWA 4EGLA 2VKZG 5MAOA 4X66F 1MWZA 2AD9A 1M0TA 3MEDB 1FJGF 5DG8A 3LP2A 2KVIA 2KH9A 1TV6A 2WYOA 2MHNA 1RISA 2AYGA 3UQ8A 3I0SA 5EX0A 1R0AA 3HK2A 3TA2A 1N0VC 4CIOA 2O01C 3H4DA 2R7SA 4PQUA 4OHZA 3N6NA 1QSYA 4PUOB 2B5JA 2HFNA 3P96A 4PXBA 3TANA 1KN6A 3K3VA 1XR7A 3VALA 4Q5VA 4TU9A 5CXTA 3O1LA 3BSOA 1HI0P 2DITA 5DM7Q 3M6UA 4ZCLA 1QAJA 4CO0A 2UUWA 2E9RX 1IKYB 1S9EB 3G71S 3M30A 1BLUA 1PGZA 2N3OA 3NRBA 4G1PA 2LEAA 1U49A 5KFIA 3Q8QB 1S77D 3OTBA 2UXBF 4KGKA 1TAEA 2P6SA 4TY8B 1XEZA 3GYNA 2MKKA 2BE2B 1XMBA 1IUJA 3MDFA 3TVKA 4QWEA 2VQFF 3B8HA 4B3MF 4GO5X 5JJBA 2V8HA 2OPSA 5H9EJ 4WXWA 3SSSA 2J0QD 3MXHP 2DTJA 5J1PA 2R7VA 1HW8A 1URRA 2KHDA 1VFJA 3PIOQ 2ZM6H 3CJ4A 2FJVA 4Y00A 4A8MP 2YKMA 3O8WA 5THWA 1SYXB 2O1PA 3SCJE 1GTHA 4B9TA 2UZAA 2CJQA 4C8YA 1CPZA 3GB0A 2HNYB 2DNKA 3JAMY 5D3GB 4OI4A 4NPOA 2KRRA 3EXCX 4DV0H 4JYAF 3SCKE 2XY7A 2YX1A 3C66A 4BWMA 3BO2A 3N9UC 4NXNH 1X4EA 2E7WA 3IA0A 1KLMA 4M95A 3DOLA 2FJEB 2EPIA 2O03A 5E41A 1OQ3A 2VQEF 4K4WA 1YSJA 1H38A 1AN7A 4KKOA 4RB1A 4WFNQ 2FJXA 1VQ6S 3PW5A 2RILA 4DFPA 1VC6A 2MMYA 4LSNA 3TNVA 1NK5A 3OFHA 4K0KH 2YQ3A 3N79A 1N36H 3CIMA 4QWAA 3KLGB 2XS5A 1C1BB 2RMLA 2SXLA 2ZH4A 3LF0A 2F9DA 4FNHA 2CG4A 1UP1A 4WK1A 3K58A 2HHHF 4OZLA 3T9NA 1YJRA 4OI3A 1QAYA 2OPPB 2ZHOA 4DL0C 5KT2A 3U1LA 1LW2B 2IMOA 4O3QA 4FXVA 1DJ0A 4JI0H 4QIGA 1ZM4A 2ILZA 3IGVA 2RS8A 1RT3B 1JLGA 1HBUB 2D1CA 5C25B 4IQXA 4A2AA 3SCIE 1RT7B 3AJ1A 3OVAA 5SUHA 3MFHA 4K4SA 2I8EA 1F60B 1U6BA 2C42A 2IFXA 4RUCA 2UUAH 5H1SV 5C42A 2CJAA 1VQ9S 4Q0BA 3M8PA 3LAMA 2DRBA 3RF2A 2CYYA 2EWHA 2HHVA 3D0GE 1E6VA 4MV7A 1YJNS 2ZKUA 4MAKA 1VQ8S 2ASYA 1Q7LB 1SL0A 2HGSA 2AJ4A 3T9ZA 5B0GA 3O3LA 4F02A 1P9QC 4TYAA 4DV5F 4PQAA 5K8MA 3TUJC 1UETA 1KHWA 1SKWA 2BVZA 4O4RA 3BDPA 4X65H 3NLCA 1YJWS 1U1LA 1O75A 3FFIA 4ELTA 4V19X 2J9EA 3ZZOA 3PW0A 4DL6A 2GW8A 2LMIA 4M7EA 2ADBA 2R2RA 3VAIA 2FVCA 4J9NA 4MH8A 2KKHA 2HVSA 2M8HA 1D3WA 2XI2A 2FLLA 4ZMMA 3J7A1 2CQ3A 1HNWH 5J1EA 4RAYA 1DLOA 3HI9A 4F50A 2YNFA 4PWDB 1S6PB 1R3NA 4NYOA 1HWUA 2K3KA 2WSEC 1KD1T 2A3JA 3OFEA 1ROFA 5LL6b 2LQBA 2FD2A 4LT6A 5D1OB 2JJ4D 2MKJA 3WC2A 1S0NA 1N34F 4OV1A 2R2SA 4UQGA 3US5A 1OPIA 2HRUA 2W7PA 1NK9A 1M5OC 1UVLA 3M30B 3DLBA 2GQQA 3MR6A 1FJCA 3IS9B 1IM4A 3UFCX 1V9PA 1GX6A 3QZ8A 4A2BA 2YKAA 2JFDA 4CH1A 2HNZB 2VODA 4W90B 3D28A 3SDEB 4QR2A 1YHQS 4JV1A 2LXFA 1JLBB 2HLTA 4HDHA 3CIZA 2QEXS 1WD6A 3HDSA 4DSJA 5KFAA