3H20A

Crystal structure of primase repb'
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
288
Chain Sequence
RTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKKHTTYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLERRTALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKHEADYIERTVSKVMGLPSVQLARAELARAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein B
publication title Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
pubmed doi rcsb
source organism Plasmid rsf1010
molecule tags Replication
total genus 99
structure length 288
sequence length 303
ec nomenclature ec 2.7.7.-:
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16793 RepB_primase RepB DNA-primase from phage plasmid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.50 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 3h20A04
3.30.70.1790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h20A02
3.30.1490.240 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3h20A01
3H25A 3M1MA 3H20A
chains in the Genus database with same CATH superfamily
3V6HA 5D4LA 2HAIA 1FHTA 1Z2NX 1UW4A 2FHKA 1SC1B 1HYSB 3EM1A 4FXVA 4B3TH 2GGPA 4DR1F 1VBYA 5HV6A 1U6ZA 3CJ5A 1ZQ7A 2XYGB 1JJHA 3DRSB 2YKPA 4LF7H 5E3RA 2XG8A 5E3AA 2WBRA 2OEKA 3M2VB 3SEOA 5IWAF 4TUYF 3N5FA 1Q7YT 2WOMB 1DV1A 4B3MJ 2YX4A 3QT6A 2XLJA 2L08A 5IC4B 3E01A 2V2QA 3J81j 1PX2A 2HIYA 5AXNA 3EPGA 5HVGA 3IO1A 3HP6A 3DC2A 3Q2OA 4BHQA 5IYDG 2CJ9A 3KWMA 3PO4A 4A3KG 3IC1A 3E3XA 2UXCJ 1HW8A 2PVPA 3SDEA 4AD6A 3CSKA 4JP8A 4OZ5A 4KHPF 1Y3JA 1CQJB 1FT8A 4E4TA 3N5BA 1REVA 3UR3C 3NRBA 2J0SD 2OAUA 3J7A1 1K98A 1AT1B 1K47A 1NDCA 3LALA 4P10A 4D3GA 3RUBL 2EBEA 2FUG9 4NPOA 3TIGA 2AJ2A 1ZPVA 2YKAA 3HKZA 2E9ZA 4HVZA 4DV4J 3K0JA 1BGXT 1O0PA 4FPRA 4LF1A 1U09A 1N36F 1CJKA 3M8RA 4RBVA 1RT1B 1SVDA 4NX9A 3S7RA 2XI3A 5FPOA 3HDSA 1SCUB 1FE0A 2WVFA 3H0GG 2CPHA 1VQ8S 2Y8YA 2W4DA 4LRBA 1RZMA 1IBLJ 3MXHP 2JA6G 2G0JA 1UVJA 5KFWA 1URRA 2J0QD 4X65H 3LAKA 3N44B 5C2CA 1GXTA 3PNIA 4MIWA 5B0EA 4NLRA 3M2RA 1EETB 3NGKA 1FEHA 4DV0F 3E8OA 2B4VA 5JVHQ 1BWEA 4WKYA 3DHWC 2DIKA 1WKLA 4DV1H 2MJNA 1GX5A 3J81Y 1M7JA 4NOHA 4FYDA 3R7NB 3BR9A 2FMME 2DNHA 2CQIA 2VODA 3OTEA 2UVRA 2HVDA 3C16B 2G2OA 4KIAA 2AMCB 4FVMA 3G82B 4DLKA 2OFHX 4C8MA 3P6YC 1FRLA 4H4KC 4IQMA 5B0CA 1PGZA 2LDYA 1VQSA 2BJEA 2UVWA 3TP2A 5E33A 2R7KA 1JJ2R 1RWNB 2V94A 2J8AA 4HDHA 4QU6A 1C2PA 4L75A 1WTFA 2HHHF 1XNQF 1JKHB 3CIMA 1WI8A 1U8SA 1PIEA 3CUNA 4C0HA 3MECB 3ONQA 4JV5H 3KLHA 4DFMA 4WYWA 1JDBB 2AGPA 3R97A 2EPIA 1YZ7A 4NXMH 2MZRA 3NS6A 3UN2A 5KFDA 4L1KA 2RAQA 1SIZA 1HNXH 1J5OB 1IVZA 2XMKA 1M6VA 3H59A 2R7UA 1XERA 1VAJA 2PFDA 3WX4A 1NB7A 4DR4H 5D4PA 2HFNA 3IR6B 1WHWA 5KFBA 4KV8A 5E2QA 1N32H 1U6BA 3JSRA 1WJ9A 2DNQA 4C9DA 3TJAA 4GVLA 1WCMG 2PBZA 4K4VA 1N5VA 1RHRB 2E1RA 1I94H 1HIYA 3U9TA 2IVFB 3Q1KA 3RAXA 1RK6A 2QA4S 1S03G 1SYXB 4NXNH 4ID5A 2Y1IA 3Q8VA 5LL6d 1IQTA 2OJ3A 2OELA 2QYCA 2R8KA 5T41A 3MOJB 3HJFA 2I8CA 2YQ1A 4USIA 2UU9J 1N4LA 5B0DA 5AE3A 4ANDA 4C8LA 1JJCB 2RH3A 3S8SA 4BY7G 2F9JA 3W9IA 4CLFA 4O44B 3CEDA 5CA0F 7FD1A 1RT1A 4KGZB 2B51A 1IR0A 2IHR1 2X51A 2Z58B 3RB3A 3Q83A 2GO8A 2VICA 4ZHRB 4M9UA 3MUTP 2DNKA 4Y2KA 3HX9A 5BPHA 1IR1A 2JDJA 2ZKUA 1EETA 2JFDA 1JXVA 4KGVB 5KFEA 1Q81T 3BKTA 4M5JA 2FHOB 4RWWA 2LQ9A 2F4VJ 2XMUA 4E0DA 2BRKA 2HFUA 3AJ2A 3TQTA 4RNNA 2FJBB 4OYWA 2FPHX 1PYSB 4AQYF 3MTKA 4WP8A 4FF1A 2GVDB 4ZQIA 2DRBA 4X4QA 4TY8A 4DFPA 4UCTA 3J7ZT 1BUXA 3ZNJ1 1ZA1B 1Y5IB 3RFCA 1RQ0A 1UWBB 3UCUP 3E2EA 3R3TA 1BQMB 2M70A 1EYZA 1BWVA 2CNNB 1YJ9S 1NSQA 4U96A 3Q8QB 4EG0A 4NLUA 4C8ZA 5K9FA 2DXEA 3L4KA 3PO3G 1EP4A 1SKRA 4PWDB 2A0FB 2I0XA 5LJ3Y 3O3LA 3MMBA 1Y9OA 4DZDA 5DETA 1TWGA 3J80Y 3IAM9 3EUNA 4OFZA 4ZCLA 3DLLQ 2VDIA 3LP2A 2QLJB 2CYYA 3JXOA 3MPUB 4A3GG 2M9KA 5L9NA 2HS3A 2M3DA 4A3LG 1JX4A 2X1AA 4TYBA 5J2NB 3DMJB 3M9OB 1WC1A 2F7VA 2CZGA 2UVVA 4IOCQ 5ETTA 3HBLA 4USHA 1OSCA 3BBBA 4ZVSB 5J2PA 2KFZA 2V59A 3CC4S 2RJZA 4N41A 2AJQA 2FKLA 4MMOA 5AJ3J 3SBMA 2DGVA 4X2BA 1PKUA 4IFYB 2P6TA 3UN5A 1ZM4A 2C2RA 3IG1B 4G1QA 4UF4A 1HD0A 4LRFA 3BDPA 4ZPVR 1C0TB 1U45A 2R7OA 3UDCA 4YY3F 1XR7A 2DGWA 2CPXA 1SKWA 1GTHA 4I0WA 1WC6A 2M5YA 2PT0A 2IRUA 2VF3A 3KK2B 4P72A 4YR3A 1RWPB 1X4EA 2POKA 3LWLA 3GSDA 2ZDOA 4PG4A 2XGQA 1T9XA 2VBZA 4B3SJ 2EC0A 1P9YA 3F73A 3MWMA 2KB2A 1TA8A 2MQMA 4KY3A 1KBRA 4X64H 5CHCB 5E5NA 4Q7AA 4O44A 4P2MA 2N4CA 3M32A 4HACB 2VJUA 2ZOMA 4CLPA 1UVIA 3KUEA 2WBMA 3MJFA 2MZJA 3PW5A 3W7BA 5LSOA 1N34F 1A7GE 3DCAA 2J0WA 4MV6A 1TVRB 5L8RC 4DN9A 5IT9U 5F8JA 2MKJA 1X5OA 2RS8A 2D7SA 3I32A 4FF4A 1VHIA 5RUBA 4DR5J 1V4YA 2IDEA 1RABB 2DXDA 4KSEB 1M1KT 4DPTA 1XMOF 2FPIB 3SV4A 1H6KX 4YR2A 2G2ZA 1NB2A 4J5OA 1RDRA 2XLKA 2GVDA 2IMOA 2VBXA 3QT7A 2XYPB 4FS1A 2CJBA 3BN7A 4UUWA 2CPZA 2JLEA 5CCMA 1AB8A 2CW8A 5LMNH 4L73A 4ZVFA 1RT5B 1CG2A 1BQMA 3W2VB 1YJUA 2XI2A 1SV5B 3PDNA 4QW8A 1UVLA 3LW5C 3BREA 1WACA 1IN0A 1FDAA 4QU7A 1YK9A 4N76A 2CQDA 4R0JA 4LSLB 5C5EA 3QIPA 4KFBB 2CPDA 1LW0B 4B3MF 4W92B 1ICEB 5C25A 2WVDA 3CJKB 4NZ7A 2AQ4A 3UFCX 5J2NA 1RT7B 4DV5J 2YRWA 2W2QP 5M2UA 2JEJA 3LWBA 1FX2A 3Q2SC 1JIHA 4P9SA 2PGCA 4J9LA 3HVAA 1IJFB 2Z4PA 3T41A 3R5CA 5G0RB 2I6WA 1ZHQA 3RU0A 2JNJA 3PVXA 3JSNA 3G8CA 1RA6A 3WC0A 1X4BA 2VG7B 2VQDA 1RAFB 4F36A 2NZ4A 3DFEA 1YG0A 5HROB 3GTLA 2ROPA 4NASA 1Y10A 2CQ2A 3H5XA 3NY0A 4NLGA 1EUCB 1U02A 3R23A 4U8YA 4DV4F 2VOBA 1S1TB 2B8QA 1FDBA 1HPZA 1UJ5A 2UUAJ 1B3TA 1A6LA 2HK2A 3FQLA 5KTQA 4OZ3A 4IAJA 4IH5A 3K89A 1S1XB 3D6TB 3KHGA 1BMTA 3G8QA 3R5XA 3MFIA 1IBLF 1RT6A 3GTQA 1O6XA 2MHNA 2VDHA 5LSLA 1REGX 2LP4A 3CJ0A 4OX9F 4DFKA 4CTAB 2AYEA 5E0OA 2JA6A 5JQWA 2DXFA 5C24B 1ZBTA 1N6QB 1VC5A 2OKQA 3NCQA 5HJXA 2OO4A 3CJ3A 1UEKA 4PXEA 3B6BA 4MIAA 4A48A 2E1MC 4ITSA 5ETOA 2FY1A 4ZA1A 2O1PA 1HQUA 1Y00A 1RGVA 4WBFA 3QYYA 1QTNB 1SC6A 4J9QA 4EI2A 4O3OA 4NMXA 4M5HA 3NKYA 2R42A 3VVTA 5HP1B 2IYGA 1U1OA 4JBCA 1EX8A 4RLEA 2WVCA 2EK1A 2LQJA 3W8GA 1RTIB 4OYXA 2BBEA 2ZD1B 4KQZA 2MJUA 2MKCA 3DLKA 1WELA 4TVAB 1JLGA 3PW7A 4HEHA 3LA0A 4DLEA 4W90B 4BS2A 3WBZA 2HRYA 2R2SA 4EBCA 3Q8PB 4WIIA 5EN1A 1WEXA 1NK0A 3A3NB 1OY9A 2VZ9A 3HK2A 3ORQA 1HMVA 3IRXA 4QR2A 2CZVC 3S6EA 1B6RA 1RTJA 2DGSA 4LSLA 1SPBP 2V63A 4KFBA 3WZ0A 4JI3F 2JEIA 2HZCA 2EFOA 1XDNA 2I8EA 1H7XA 1RCXB 1WC3A 2HWHA 2O67A 4USKA 3KXYT 2HGLA 2YS6A 2DD8S 2RSQA 3GV7B 1S72S 2HFSA 2ZNYA 2ASDA 4P71A 2E29A 3ENQA 3NWRA 1AUDA 3VGSA 1SC4B 2N7CA 2YQ3A 2QL5B 4C5BA 5I3UA 1WCMA 4GKJH 4LBHA 1VK8A 4QIWE 1L3SA 1HNVB 2RILA 1DQ9A 4DX8H 4C3KA 2R8JA 1HBMB 2XMAA 3DRPB 4WYLA 4ELUA 4HH3C 3I6PA 2UU9F 3MD1A 2YWHA 2IA6A 1FJGJ 3H20A 5DDQC 1WF0A 2JEGA 1IM6A 4Q0BB 3N0VA 2MEWA 3WHPA 3TZZA 2R93G 2ZH3A 1W2IA 3VF0B 2PE8A 2YH0A 3UD4P 3MR3A 3HSJA 1ZETA 2J6YA 3L95X 4RW6B 1FKPB 2AJ1A 4A3BG 3HZGA 1V6HA 1S1XA 2ZH6A 2CIMA 4KHMA 5J1PA 1LW2B 3I0RA 2GNKA 2RS2A 8ATCB 5CYMA 4DPYA 1N5YB 4B3RJ 2CWXA 5HSPA 1GSOA 2PD1A 3TIIA 4HT5A 4LSNA 2IBKA 2EXUA 1TL5A 4JI1H 2GS8A 3LWMA 1HLWA 3GYXB 2ZBCA 2COLA 3R5HA 2F4VF 5FJ8G 3AAWB 4GO7X 4OLOA 1M5VC 1HR0H 3H4BA 1NJWA 2VQEH 5F41A 4PXCA 4C11A 5IM0B 5HBMB 1WUUA 4MKVA 4DUZH 2B4PA 5GAGU 2K06A 1LOUA 2IVMA 3VPBA 2NSCA 2V0NA 4B3OA 4M5DB 5KFYA 3OR1A 1RK5A 1RAGB 1X9MA 2IC3A 2E5HA 3PRBA 3PJWA 2CQ0A 4LQ3A 2FDNA 3OBIA 2AWZA 3C6UB 1YITS 1XWLA 3MMCB 4TY9A 5D4OA 1NMEB 3IG0A 1DURA 4OYAA 1RTIA 1NK7A 4M5GA 1SEIA 3VTIA 3M8SA 2E66A 4LF4J 2L9NA 3SCIE 4OYBA 4TV9F 1F5AA 3G86A 2PIIA 5K8PA 1CULA 2HPUA 1RTHB 4JI0J 2R85A 1RBAA 2HHPA 2PA3A 2Z2LA 5C1OA 1U1QA 3RV3A 4CT8A 4RZQA 3KK3A 1F5CA 3LOUA 1NDKA 2X3GA 3UNYA 1YRTA 1TV6B 4QW9A 5KFXA 1RJPA 4OYPA 3FJ2A 4M1KA 1LK7A 3TR5A 4ZHQF 3FMWA 1X4AA 2QL7B 3K3PA 4NZ6A 2LFVA 3BR8A 3QZ8A 5LM7E 5AJ3F 3A12A 3QAEA 4XDDA 2VFSA 4DQIA 4O3PA 1VS0A 4LF7J 2MHEA 2W2MP 3OVAA 3HOVG 4CWBA 3OL8A 3BAAA 1S0VA 4X62H 4U7CA 3EVWA 1R0AB 4ZVRB 3KK1B 2RHSB 2V68A 1W25A 2E2IA 2OPPA 1E4FT 4RB1A 5AXKA 3DXBA 4HT7A 3SQGB 1VCTA 1MROB 4UCSA 1F2GA 1P8GA 3VAFA 3JTPA 1NUEA 1YJRA 1HBMA 1CS4B 2V34A 1S68A 5HMXA 3NMRA 2RNEA 3G87A 1GO3E 3UVJB 1S4EA 2R92G 4Y8VB 2DGQA 5A2QU 1EKRA 1Z2ZA 3KUGA 4CO1A 1MLAA 4ZKAA 2CUYA 1WC0A 2W2PP 3HHLD 4E98A 3CULA 2MSSA 2XMJA 5FLXU 4F7VA 1IKXA 1K9MT 3FZ2A 3N42B 3MCMA 4ED4A 1VQYA 2APOA 3UPFA 2W7PA 1KWMA 3AD8C 1RYSA 3FCWA 1HBOA 5DS7A 2PMWA 2XZDB 4UOHA 3J7YU 3GPAA 2E1CA 1GAOA 1NBEB 3BG5A 3TYTA 2NXUA 1OJ4A 3PTWA 2CZ9A 3HMJG 1A9NB 1KP6A 3C14B 3M8QB 3QMQA 3TQ1A 4ETZA 5LMUH 4I6YA 4ZP9A 1EUDB 4I2PA 1X7VA 1PG5B 3N79A 2RDIA 4RZRA 1U0HA 2Q3PA 2J0XA 2FK3A 4JV1A 4DZ6A 1N0UA 1OQ6A 4I2QB 2K2PA 3BKFA 2FVRA 4DV7F 1ZAXA 4MAKA 1S77D 3MCSA 3OTOF 4QWDA 4A8OA 2C2EA 1TAEA 1TKTB 2E44A 4MKAA 2QYGA 2O01C 4WTYA 5K14B 5FJ4A 2UUCH 4R8UB 1DJ0A 2Y1LB 1Y1VG 1FTCA 4C8KA 2PMZE 4K5RA 4O4RA 4QQBA 2A3JA 1BD6A 4M95A 3OXFA 1XBWA 2GLTA 2VH7A 1VMBA 4B9UA 4OV1A 4TU9A 4BWMA 3A8JA 3BB5A 3J81W 1WOSA 2V4RA 1TMJA 1T3NA 2I38A 4NCAA 3RBXA 3C46A 3SV3A 3ET6B 3U1MA 4ILMA 5DM7Q 3CNQP 4LF2A 2W8LA 1EZ1A 3RGZA 1TL3A 1RCOB 3D6HB 3MWBA 4DV5F 1HHSA 2J76E 1PJ6A 4C98A 1LFWA 3WNZA 4YOEA 2MY7A 2ZZTA 2PC6A 2J6UA 2AEMA 2I2XB 4ZP7A 2PDAA 3GLKA 4X4UA 3IBWA 2CVEA 4EWTA 2HVQA 1ZZFA 3QLHA 1RBLA 5IZHA 1VRQC 4OMFG 4L3KA 2KFYA 4DR7H 3NWGA 1FK9B 1ZAVA 4JV5J 2MQOA 4YFUA 2H65B 3H40A 1JLFA 3NOGA 4NXMJ 2JHEA 2RQMA 3JRXA 2HNYA 4DOZA 2DITA 4UZBA 3M6VA 2CG4A 2JVRA 1HBNA 3CJ8A 3GWCA 3THTA 1S49A 3MDFA 3SQGA 2ZKTA 2B3TB 1DAXA 2KRBA 2UUAF 2BANA 4QWEA 4DR4J 1Q5YA 1G4CA 4HHJA 5EWFA 1JWWA 1VIOA 5K20B 1N32J 2QG9B 3CIZA 1NXIA 3BULA 3BEGB 1DTQB 2WYOA 2DH9A 4CH1A 2NREA 3T1HH 3BQ2A 2GIFA 3BM7A 1R0BG 1OYDA 4QCLA 3FCVA 4IR1A 3EXCX 4NXNJ 5BYRA 1FRMA 1FKAF 3NNAA 2EEYA 1P8LA 3WC2A 3IGNA 2HFOA 2OIHA 3HJVA 1JNRB 1XMBA 1FRXA 1QM9A 5F0UA 1K0VA 5F8GA 4RB2C 1OMSA 3ZO7A 5DRKA 1T05B 2XEXA 2C2KB 2DHAA 4DX6A 2W9BA 5H1SV 3JAMU 3PEHA 4DSEA 3C14A 4IR9A 4HLBA 4J37A 3GTYX 2DHGA 3VR1A 3NGRA 4DV3H 4KBIA 4J9NA 4KTQA 2RU9A 3EYZA 2Y9HA 4IRDA 4K7QA 3KJFB 1RKIA 1F60B 4I4TF 3PM9A 5CXTA 3CDUA 3RR8A 1VHFA 3CD6S 3K5HA 5K14A 1RAOA 2YU9A 1TR0A 1G7CB 4AFFA 2ZVSA 2IJFA 2FHJD 3KYLA 1WD6A 4EUVA 5D0RA 4IHJF 1RISA 4HNTA 4AL5A 4WK3A 2PEHA 2NYHA 2SCUB 4DSIA 3UQ8A 4KKOA 1NRKA 2BJDA 5FD5A 1S9EA 4C8YA 2YPZA 3M1VA 4ED2A 1NSKL 1KQKA 5KG3A 3GFYA 3EGZA 3K58A 4QIWD 3CJRA 3NS5A 2UXCH 1UAWA 2WSFC 4I6WA 1H2UX 1L3KA 2BE7D 3TX0A 1OWTA 2WZ1A 1V5IB 4WFNQ 2QFJA 5IT9W 4NI2A 2HRTA 3ELHA 3OV7A 3AA9A 4NLQA 3LQVA 1T3OA 3T9NA 3GE9A 3OLBA 1S1UA 3FEXB 3FMAA 2FLLA 4ELVA 4ZLLA 1CJTB 1AXQA 4B9MA 1K73T 5FDLA 2D1CA 1CLFA 4M63A 4RUAA 1R6VA 1Q6BA 1FJGF 3MAAB 4NA1A 2UV8G 2E5LH 3R2CJ 2WVEA 3T1AA 1Q6AA 5T14A 3PR5B 3NGSA 5HLFB 2V4JB 2AV5A 4RW7B 1DQ8A 5IT4A 4J91A 4MV4A 4RW4B 1QTMA 1KSPA 4C5AA 4BCAA 1HNWF 3GTGA 1KONA 1CSJA 3DXSX 1LQ9A 3PX4A 2NXEA 3FEZA 5LYJF 1K8AT 2R93A 1VRUA 3GMGA 3KDOA 3IA0A 1MWYA 1P9QC 5HATA 2HVIA 3LAMA 4RW9A 4CNYA 4K4SA 4CM2A 2GJFA 1VQ7S 2YTCA 2NUUG 5FIIA 1IWGA 4G65A 3ZZOA 3PYEA 5ETVA 2F5GA 3OD2A 1UWAA 4FBTA 5FLMG 2E1PA 2BKOA 2CFXA 4EEQA 2V9WA 1UETA 2ZITA 3F8NA 2N82B 1VBHA 1JQGA 4RU9A 1JDEA 2U1AA 2FGCA 1QAXA 3VAGA 3N4WA 4PAAA 1D9DA 1U49A 4PQUA 3IV9A 5BJRA 3G9CA 5LXYA 2DO0A 2ZBQA 2WSCC 3V6KA 4X64J 4URQU 5KG6A 1TL4A 3ETOA 4RUBA 1MN7A 4ECQA 4DS5A 2O3DA 2ZE2A 2F40A 2K8GA 4CLSA 4ECZA 1FRHA 2EWHA 1SH3A 3MM6B 3RAMA 5L1IA 2BM1A 2XNRA 1GLVA 2VR1A 3PIPQ 1WC4A 1TTHB 3Q8UA 4G6VB 3PG9A 1B0VA 5C7PA 4LF4F 2HVHA 2VOPA 2GMHA 4EBEA 2BJ8A 5D1PA 4R25A 3AHPA 1W26A 4JI0F 2Y3YA 2CWKA 1VC0A 2XSJA 4RO0A 2M0GB 5A0YA 3QGIA 1N8RT 1SQGA 4ECRA 1DZ5A 3B4DA 3OJSA 5DG7A 1FO1A 3MM5B 5KT2A 1Q82T 4LRAA 3AQOA 4K5SA 1KD1T 2IPOB 4I68A 4B3TF 3PO2G 5J1EA 1PC4A 3WHIA 2XLIA 4DV6H 2XM3A 3CCJS 5LMNJ 3I96A 4DL0C 4M5KA 2EI5A 2GVZA 4E2FB 3MEDB 3K17A 2ZH8A 3O6QA 1YJTA 1OS5A 4JB8B 2YKOA 3IFEA 3OSNA 2MLYA 4ECUA 2V8VA 2GCFA 1KJJA 3G6VA 3CCWA 4ZPTR 2BR0A 1HNIA 3MM7B 1DLOB 4UUXA 2LEBA 4X4SA 2LEAA 1TL1B 3GV8B 3DOMB 1QSAA 3MGJA 4YQWA 4UFZA 1X5SA 3DYAB 4YUDA 5HN0A 1K7YA 3TVKA 5KFMA 1RE1B 2IA0A 4X84A 1TP7A 3U27A 3GTMA 2YS7A 2C3UA 2R92A 1NNDA 5LSRA 1H74A 3I4PA 3AQPA 2DHSA 3AY0A 2JWNA 2DNOA 1AFIA 1BQNA 1B33N 1X31C 1SBRA 4CDIA 3JSMB 5IS2A 1FKOB 2KG1A 1PILA 2RF2A 5AXMA 4DUYH 3R5JB 2YKMA 5T7LB 3SCLE 3MM8A 4C4WA 5DJBA 4DR1H 1E6VA 2HBQB 4A8KA 3U9SA 5C1PA 4JI6H 1AA1B 3AH6A 2B43A 4UQTA 1T9VA 2RKIB 2PMZD 2B9YA 3W1YC 4LR7A 3MWEA 1CS0A 2ZFHA 3D3BJ 5EUHA 1R8BA 4FM9A 2LQBA 3HHEA 4X65F 1FDNA 4I69A 3AA8A 2ZM6H 4ZPBA 1HFEL 4I7FA 4ZLNA 4RNOA 4U8VA 1CJUA 1SXLA 1VC6A 3DF7A 1WSCA 4FNHA 5ETMA 4DV1F 1FEEA 2WTFA 1JLEB 1U48A 1TKDA 1Y1VA 3KLVA 5ITHA 4YHHH 3CPWR 2YNIB 2V8DA 1T8EA 2CPJA 5HMYA 3LP0A 2GPWA 2F3JA 1N33H 2UXDJ 2Y1RI 5HANA 1Q95G 3OT9A 2HYIB 1JMTA 2DYAA 3O2IA 3JTOA 2NPFA 5LOVF 2FZGB 4RW8A 2AD9A 3G8TA 4ZIWA 3HVRA 5CQGA 2LA4A 2HAFA 2HG4A 3OW2R 1LWFB 1L3VA 1RHQB 3OFFA 3D1HA 5I3QA 4YBZB 4ED5A 3TZWA 1C0UB 2YWWA 1RT4A 2HQ3A 3BBFA 3HKWA 1SJFA 1TAQA 3GIIA 4JV5F 2DR8A 1DTTA 2GHWA 2Z0GA 1X5PA 1C1CB 2X7IA 2W6NA 1HNXF 1AYEA 1BQXA 3HHLA 4P7VA 3WO1A 3TANA 2N3LA 4WZQA 4KT0C 3T5JA 3UO0A 3OUYB 2PBIA 2PEBA 1MSWD 5IYZF 1H73A 2LQ8A 4NLOA 5DDPC 1S1WA 4DX5A 2Z2YB 4DR4F 1TL1A 4A46A 2XZWA 1N32F 3DYAA 3OSPA 4DR3H 4ZI7F 4MIBA 4F0HA 3GLJA 1CJVA 1TL7B 1I94F 1LK5A 1P6TA 3DDNA 5HMWA 2FJWA 4NLVA 1O8BA 4MYTA 3KXDA 2JA5A 1U1KA 4IO1A 4M7EA 2JFKA 4ZK7M 4NXNF 4GKJJ 3HLUA 5KT3A 2UUBH 1ULZA 2M7SA 2KVIA 3BPSP 2HHVA 4FKYA 2YVSA 3FQKA 1FE4A 1AZSA 4V1Ak 2QA1A 1X4GA 1KVKA 1X8DA 4KH0B 2DO4A 3TO8A 3T9ZA 2H3EB 1X0PA 4O3QA 3OTCA 3DOLA 4AXJA 5BYSA 1K1QA 1QVFR 3T5LA 2QMUB 1GX6A 4Y2MA 4TXSA 3Q24A 4PZVA 1RU1A 2J70A 2OHDA 1FWKA 3FSYA 2ZWOA 2W6OA 3ENAA 3TJ8A 3W61A 5C42B 4DS4A 1JXEA 2HS4A 4ED8A 3IBCB 4R5PA 3DM2B 1SCJB 5JMNA 1NDLA 5KFSA 1S76D 4YB5A 2HRUA 5F9NA 2JA8G 1R31A 3SZ2A 5KFOA 4KYZA 4LVNP 2CW7A 4Q45A 2YNGA 1FNOA 3HFKA 4CYUA 1TK0A 3VAKA 2H51B 3RB4A 1KTQA 2VQEJ 3GR1A 4A3FG 1I6UA 1C3OA 3SCKE 1JLEA 1Z2LA 4DUZJ 5GMDA 2W4PA 4PRFA 4LF8H 5FLXW 1GMWD 4ENOA 4UT4A 1P27B 3CD5A 5ETRA 3DI6B 4OX8A 2EG1A 5U47A 4F02A 1RAAB 2A6OA 2GW8A 3I87A 3OUUA 2JA7G 3FSXA 2VHGA 1D9FA 1QJHA 1U0SA 2BKNA 3CMAS 3UNGC 4DG1A 2R8IA 3W5YA 2VONA 3ITHA 1X5TA 3OQ2A 1SC3B 2VBWA 2R82A 2XMTA 2H54B 1FXLA 1X4FA 4YP3A 3NNHA 2FB9A 2DGTA 3UCZP 4PWQA 4L74A 1MG7A 3RB6A 3MEGA 2BZ2A 3GYNA 2V5AA 3TVYA 3RAQA 3IS9A 5IP9G 4TNOA 3KLFB 2M4MA 1SKUB 2I5JA 5LA6F 5K8MA 5IT0A 3CC7S 4DR6H 3GONA 4OV6A 4EK2A 2Y1JA 3OUYA 1ZM9A 2UV8A 4KGKA 4K0KH 2ZZMA 3KHLA 2HGNA 2AYBA 4QPTA 1I7NA 1RJJA 4Y3CA 2ERRA 1LV5A 4XPEA 2G0CA 4F3MA 3MF5A 1U26A 4F2RA 2X3DA 2DJWA 4X62J 4PYDA 1TL7A 2MKSA 1UPPA 4CLKA 4F50A 1TKZA 2JSXA 3T6BA 1AROP 1EB0A 4EFAC 3HOYG 2I80A 4WE1B 3HVTB 1CC8A 1NJYA 1M5PC 1KNZA 5KFAA 2OPQB 5D4NA 3N6XA 1OY6A 1VS3A 3G6YA 1HD1A 1RYRA 1OPIA 2KTQA 2VUMG 1WDTA 2D9PA 4P73A 4EZ9A 2HW3A 5DQHA 4YS2A 2QFIA 3UD3P 4O3SA 2RQ4A 4X64F 5A8RA 3OHAA 2Z56B 3D6MB 2KM8B 1WHXA 3VHQA 2LECA 2EG2A 1F1BB 2FHJA 2C35B 1H7WA 2QRRA 2ZUAA 2PMHA 4MA5A 5IOLA 3DM2A 1JLCA 1PYOB 1HI1A 3EMTA 3TEHB 4V19X 1SJQA 2HNDB 1U2CA 2HIQA 5MLCV 3TA1A 3K5OA 1R8JA 2DGXA 4IG0A 4QIWA 4MTPA 3K5PA 2CVIA 2OEMA 3TAMB 4GO5X 2ACMA 3GIMA 4C0OC 2QN6B 4ZJQA 5LMUJ 4A4JA 3M8PA 1RT3B 1T03B 4IDKA 3BO4A 5J2QB 2PN6A 1EJ7L 4W98A 1KHVA 4NL5A 2YKNB 2W1BA 5KX5F 4P2FA 3RRKA 2W6MA 2BMBA 2ZVIA 3CW2C 1YGYA 4IOAQ 1AFJA 1XQIA 2MPUA 2UUCJ 1P1LA 4DCPB 1IXKA 1VBXA 3PYGA 1KDNA 1IKYB 2R86A 2V67A 2XZTB 3K8VA 4AUKA 4FF3A 3HO1A 1RT2B 1N48A 3T3FA 3DLEB 1UL3A 1YBTA 2L41A 2P5VA 5GVQA 3WO0A 2OTLS 5DZ6A 3VGUA 3A8IA 3K3VA 1UJ4A 3RTVA 4MK8A 5HO4A 1UTUA 2V2ZA 2RHQB 4MH8A 1N0VC 2R7LA 2NU8B 3GFZA 2BXJA 2OFGX 2ZH2A 2JVOA 2YNFB 3V2UC 3M4IA 2K1RB 2AJ0A 3NOCA 1FD2A 4NLXA 2IJRA 4B3RH 2RRBA 1JLBA 3DDKA 4DR7J 2OTJS 3A8KA 1TFYA 2YQ0A 1R9TA 1T9WA 3PV8A 2GX8A 2BQUA 3IWXA 4MFBA 4JI5H 1ZHSA 4NCGA 3R1LA 4RL1A 3IN5A 3MEEB 1NH8A 1WOPA 3NCPA 4ECXA 3EICA 5DDOC 2P0AA 5H9FK 4CH7A 5BMVF 3TWZA 4K4UA 2CADA 2QX0A 4NMLA 2IDLA 3M2UB 3OTBA 3ORRA 2OMLA 2I87A 3VAHA 4JI4H 2HLUA 2N4DA 4ES2A 3IVAA 1HA1A 3KLEA 4IG3B 2YZGA 3V4ZA 2QMWA 3BH7B 2HMIA 4DL2A 1NHUA 2ZOFA 3TZXA 2CKZB 3PKMA 4JGIA 2MQ8A 4ICLA 3I0SA 4ZCMA 2VFUA 4RJVA 1JNZB 3ETHA 4DEZA 7AT1B 3JSYA 2CJKA 3J7AK 2VG6B 3CDEA 4ALZA 1NU4A 1Q5VA 4TQSA 5LP6F 1SJ3P 2DRAA 3FZBA 3MCNA 3TW0A 3ILJA 1F6TA 5D0GA 4LMZA 5KFGA 4FYXB 4F3OA 2P9EA 2FYXA 2OGUA 1D9AA 1CQIB 3H90A 4DV3J 3KFWX 5F8MA 3IAS9 4KR0B 3EPIA 2VC1A 3N9UC 2E7WA 5AE2A 4ECYA 1FX4A 1WF2A 1AUSL 5GAGI 2G2YA 2W70A 1E4EB 2MQPA 2MGZA 3DU6A 1C4AA 3FC9A 1SUQA 3ZC4A 3CQZA 3PFOA 5LL6b 1RTDB 1OO0B 4RX6A 2OSRA 4ZJLA 2K7JA 3OJUA 5KG4A 1MWZA 3GR0A 1B0PA 3F0NA 3MMAA 2Y0SE 2QSWA 4OJ1A 2ADCA 4DSFA 3T1YH 4UCRA 1RA7A 4UCOA 3JQJA 2QLFB 4PUOB 2HHXA 4XDCA 3TOQA 2CPYA 1NHVA 1F9EB 1IKWA 2IM1A 2DNPA 1MMNA 2NS1B 5MAOA 1FXDA 3W63A 3V81B 4MKYA 4V19J 2HVEA 3PW2A 1QAJA 5IQQA 1NJIT 2HQDA 2X1BA 3DGPB 2YNFA 2Z30B 1VRTB 5KFHA 2R7NA 3FKBA 5B0BA 3G8SA 2C2DA 5I47A 3LH2S 3GJRB 3G71S 2QIFA 4GKJF 2GIRA 3J7AN 1S5ZA 2KHDA 4O4IF 1S7HA 4ZVPB 1WWHA 4F25A 1UC8A 2BJ7A 1RHKB 3GJQB 1Y5NB 3M1MA 3MHYA 4OZ2A 2PMZA 3NAIA 1U7LA 5A8WA 5L46A 1IBCB 4IOBA 2FJAB 5KOXA 2E5LJ 1SUYA 2B6AB 4ZVHA 1I7LA 4X4NA 4NCBA 1PYTA 1TUGB 3THPA 3MPDA 4WPAA 4ZPDA 4EFBA 4FXDA 2D3OR 3KHHA 3I4MG 3HZEA 4K50A 3KJQB 4A3CG 1PO6A 4CM0A 1UEVA 3OFHA 4PXBA 3MAQA 1Y5LB 1AUVA 2CXEA 3BSAA 3KLIB 1KEKA 1RJQA 3LF0A 5B08A 1NDPA 4OHYA 2OPRB 2ZDGA 2AZ1A 1ZM2A 4JI8H 2MQNA 4CLWA 3QSIA 4KJIA 3QGGA 3PO5A 3ILIA 1Y3KA 4JI1F 1R43A 4J9VA 2HVSA 8AT1B 4OZNA 1HR0F 1AN7A 2WVBA 1X4CA 2VQEF 4O4GA 3I9V9 1PBUA 4WF9Q 1R89A 2VG6A 3H42A 3KKFA 3LPYA 2KXFA 3GZ7A 4DUZF 1S10A 3DRRA 2HHWA 2MLXA 3QPIA 4HR2A 3ULHA 2VFTA 5C8YF 3PR4A 2R7XA 5GAEI 1D0EA 1KLMB 4LH7A 4ME6A 3TAQA 4MV3A 2XYHB 2R3VA 1L3UA 3NP5A 1NK4A 2AJ4A 3PYDA 1E6YB 3GU0A 1M0WA 4CC6A 2ZBRA 2CQ4A 2IIHA 3TVZA 2WB1E 1HYSA 4Q5VA 1CBKA 1LWEB 2O5DA 2JA7A 2AIRB 3JYTB 1IBKF 1RADB 4K4XA 3DRSA 2XBPA 2JL9A 3UCGA 2AEJA 5I4MA 1GH8A 2DZDA 2KSWA 4CLTA 3P4UB 4P2XA 2ZEJA 2Q43A 1GSAA 3CXCR 2ROEA 4LBIA 3HOZG 1RTDA 2A18A 5DGAA 4USWA 3M2VA 1QSYA 4OX6A 2YL2A 2WOMA 2A1BA 2YX1A 4C6AA 4HH1A 3CCLS 1G6BA 5JVGQ 5IFMA 2CDQA 5E41A 1HNZH 1QSSA 1VQ4S 4D3HA 3MR6A 3GG1A 1Q79A 2M05A 3SIPB 4KPCA 2NPIA 4DV6J 3ENWA 2CQHA 3UW1A 4UQGA 1S57A 2W7OA 4X62F 2R6FA 2Q6CA 3BGRB 2YNHB 3DN9A 4YAKB 3GSIA 4OZJA 1S79A 2GO9A 1IOVA 1K44A 4NYOA 5A8KB 3C8YA 1KS2A 1IJEB 3KLGB 2CNLB 2FPPB 4LUBA 4BBSG 3LGNA 4LFCH 3C3LA 5GADI 2E7VA 2QE5A 4E8UA 2G1HA 2KXHA 4MKBA 3TUPA 3SFGA 3B54A 2DNLA 1XNRF 1NHKL 1TFWA 4LF6H 2VUMA 3J81U 2WE6A 3H5YA 5GAHU 4H54A 3O44A 4RB3C 3DOKB 4F4AA 1XC9A 4CO0A 5KT7A 5HQ8A 4XO0A 3OUZA 3H5SA 5IV3A 4A3DG 1J27A 4DHVA 2IAJB 4L76A 1DIKA 1XR5A 2NUAB 1S6PB 1WTBA 1GMWA 3AD9C 3US5A 4LSXA 2M88A 4DUYJ 2GQQA 3HF5A 5EOYA 4DR1J 1M0TA 3R6LB 5IXUA 2RT3A 2U2FA 2WONB 3D9BA 4ED6A 4JI6J 3UWTA 4K59A 2W6ZA 3C16A 1J5EH 2DKOB 2F9DA 2BW2A 2JZ5A 3G82A 1SB6A 3MR7A 4CLUA 1KLMA 4J7CA 3GYGA 2NLWA 4N7TA 2LA6A 5IWAJ 2V8HA 4JYAH 2V8GA 4FDFA 1FFWB 2ZM6J 2D9OA 2UUCF 2R7WA 3OFEA 1PCAA 2PO4A 1EHIA 2V58A 2R2UA 1GQEA 1JKHA 2C3MA 6FD1A 4X8QA 2Z2MA 1S9GB 4DSKA 3MECA 2OP5A 2V2VA 3MPYA 1E4GT 3SCJE 4YHHJ 2HHQA 3UDLA 2WSEC 4F8RA 2R7ZG 3FNNA 2CPEA 2HBYB 2FVSA 1N33J 4ED1A 2J9GA 4O3NA 1J5OA 4K4WA 2HHUA 1BC6A 1WORA 1QE1B 4BLGA 4U7UK 5F8LA 4Z7CA 1H3DA 3BO2A 2R7TA 3GIDA 4YDXA 3ZZ0A 4HL9A 1YHQS 4DCOB 1S6OA 1AUXA 2NVYA 2OI2A 2V69A 3A8EA 3Q86A 4ZIVA 2BOAA 3CJTA 2D69A 3PIOQ 3KUHA 1QVGR 3RRGA 3H3VH 1HWIA 3V4MA 1WH2A 3HHLC 2RRNA 1G3OA 5LXRA 3MURP 4CH0S 3SSRA 4LRCA 4C97A 1IOWA 2C00A 4F4YA 2C1EB 2VG5B 1L3TA 2P2CB 4ZVUB 4DV7H 5D77A 4IRCA 4F04B 2P8IA 2DY9A 1BNCA 1UVMA 3V6JA 5A8KA 1GXLA 3KLGA 2H1YA 3NBPB 1R0CB 3H2UB 2AW0A 2IJNA 4Q43A 4XX0B 4DV0J 2KZZA 1Z2PX 2GJ2A 1MNEA 4RB0A 2XB2D 3IXQA 4MK9A 2KHCA 1KJQA 1BHNA 4DR3J 1PK8A 1W7WA 4A3EG 4X4RA 4N56A 3MZIA 4ECSA 4OI0A 3DU5A 1KOHA 3ETJA 3T1HF 4ZHRA 3M9NB 3DGVA 2HZAA 5CYQB 1CEZA 2NU7B 3FVYA 3C6TB 2V4QA 2J6SA 2UUBJ 2J9CA 4GLXA 3G96A 2IAJA 4A93G 1KC8T 2CNOB 1Y14B 4WKRA 2GA7A 3X1LB 3M8ZA 4J9PA 4JI2H 2OPSB 4RUHA 1OY8A 5HJYA 1HARA 4ZP6A 3I31A 3BYPA 3MM9B 2G13A 5EDWA 1S1VB 2DR9A 4TKTA 2DHHA 4MK7A 4EEYA 1U4BA 3UR0A 3V4IB 4NEYA 4MTEA 3J80U 1LXNA 4OX7A 1UMJA 2KL8A 5CD4H 4ZITA 2WONA 4MYUA 1S6QB 2B56A 3CT9A 4DV3F 2NXJA 3M8YA 4WFYA 1OQ3A 2EC2A 4B9SA 2YWEA 7FDRA 2BEFA 3BYRA 4K2JA 1XMQH 2Y0SD 4LIWA 5KT5A 4JI7H 1UWBA 4XPCA 2MQQA 1RAHB 3HXLA 3PKYA 3QQCD 3IGVA 2MDAA 4PWDA 1ZOTA 4EBDA 4F0KA 2WCXA 1YBUA 4MAMA 2QLWA 4GVBB 1RLDA 2MTLA 2W9AA 1WDDA 4R7RA 1S9GA 2NXCA 2H4YB 3AOAA 2J8SA 3PX0A 3M8WA 4LF8J 1XR6A 2B8PA 3HULA 3JTNA 5L1KA 3OXGA 3DMJA 3P8BB 1BLUA 5DZ7A 1Y0HA 1F5BA 1ZYQA 2AX1A 2BKPA 3BSOA 5D78A 2UXCF 4QWBA 2UXBH 3NEKA 5JVLA 1NO8A 2CJQA 5CZVA 2XULA 5L9XA 2EK6A 3NNCA 2MCTA 2H5JB 4C3MA 2YPYA 4DXLA 4A3JG 4C0BA 2C22A 1NPKA 4J9SA 4IFYA 3FBFA 2W7AA 2BOPA 1SL1A 2W2NP 1LWXA 2BYCA 3LANA 1SKSA 3GCWP 3IG1A 3QGPA 4O2AF 4LH6A 2J7KA 2D3O1 1EHWA 2OLWA 5F0WA 2VPZB 3EDQB 3ZTOA 1C0TA 1CQMA 2C2NA 4Y0FA 5C8DA 1L5UA 2VG5A 1RAEB 3DLJA 4OIXA 2E5LF 1X4DA 3BA8A 5G4DA 5B7WA 5ETKA 1N52B 3LP1B 4AYBD 4DR6J 1HQEB 2F63A 3NBPA 4MV8A 3JSLA 3KK2A 1VISA 3CDWA 2VFRA 4WXOA 4K0KJ 5M2PA 2VPSA 3OL6A 1F0XA 1PJ7A 4MA0A 4RAZA 1KHWA 3FBCA 2VPYB 1G1XA 4ZVQB 2LXFA 4QZVB 1D09B 4YN3B 5ETSA 4HACA 4L72B 3D0HE 4N47A 4AQYJ 2DIVA 4MV1A 3FRYA 2ASJA 2FY8A 4Y34A 3AJ1A 4EGQA 2DIUA 3QRRA 3CE8A 3PRDA 5F3ZA 2AT1B 1M0SA 1TVRA 1V51A 4YAJB 1ZA2B 1CVJA 3P96A 3I12A 2OPSA 4P52A 3CDBA 2WB1D 1RI7A 5KG7A 2AHOB 4KHRA 2UXDH 4K2XA 5C4XG 2GAGC 1U2RA 1Z2OX 2ZNZA 3RGIA 1NZ8A 3D68A 1S4FA 1ZPWX 1O75A 1B6SA 4BXXG 3GTOA 4P7TA 4DQQA 4JV2A 1S6QA 4LT6A 2VD3A 4DSJA 3E01B 5IV4A 3M7VA 5I42B 1Q8LA 1KQFB 1SH2A 2UUWA 4EGJA 2W71A 1EQMA 1RT5A 4OI1A 1F3FA 3SDEB 3W2VA 4PPZA 3LMLA 1SV5A 3RB0A 1REVB 3KJNB 1ZS6A 4OI6A 4GVBA 3HOUG 3OXLA 1O51A 2A10A 4JOUA 4ZP8A 2O03A 5ADZA 1LW0A 2V2KA 3EZ5A 3P3DA 2ZDQA 4J9OA 2IRYA 3CJKA 4LFBH 1A0IA 3C15B 2M8HA 1RT7A 2JC0A 3JQMA 2QLBB 3I82A 1YRUA 1NSPA 4B9LA 1NLKL 2DB1A 4RKUC 3QJPA 3N28A 2NCKL 4URSA 3ZTRA 2IM2A 1CJKB 2V6AA 4DV6F 4DL4A 1I6JA 2W4CA 2ZH5A 2E7XA 2YCHA 1MZBA 4CQ1A 2IFXA 5G0RA 1I50A 1DV2A 1KQGB 1QDUB 1UW9A 2VG7A 3CCQS 1EARA 1U25A 4A8FA 4A8SA 5HROA 3R7SB 2CPFA 3D1OA 2VV5A 3M2RB 4Z2XA 4IZOA 1HWLA 4PWWA 1NKCA 1UP1A 4YB6A 2DNGA 3TUJC 1BXNA 4WIQA 1VBGA 2BM0A 4NLSA 4NRTA 1S1TA 2MYFA 1SFOA 1WR2A 3VALA 4RPFA 3E5NA 2NR0A 3JZIA 5E7OB 1N88A 1OYEA 2PI4A 5AXLA 4QR0A 2R4FA 2QTWA 2VA3A 2XD4A 1F3VA 2B0GA 2ASYA 1NJZA 4DUTA 2VASA 5EWGA 4DI6A 2YWGA 4PG5A 3CTRA 2ATLA 4Q8EA 4CTAA 2OMOA 1N5SA 2X1GA 5C24A 3RTXA 1N6QA 2HFZA 3QT8A 5E3PA 4JI5J 5D0HA 4DUYF 4X66H 3DLHA 3PJ9A 3KMSA 3O5TB 2ZJTA 1QSLA 3OHBA 4JI6F 3BF4A 2BUNA 4UY85 4BC7A 4M5LA 3KLHB 4DR2H 1WKJA 1M5HA 2KM8C 1M5SA 2WB4A 5HP1A 2FVQA 2DISA 3FSIA 2B5JB 1Q53A 2BE9B 4HHHA 4ER8A 4JI4J 5CA5A 3D66A 3EX7B 3ZZTA 3PN1A 1Q4RA 2KT3A 3TNVA 3BJDA 4P6QA 2ZM6F 2ZD1A 2R7VA 3BSNA 1IQZA 2FIUA 4BBRG 4KV8B 3W66A 2GPSA 3QWPA 5I42A 3UD5A 2RDJA 2XWYA 3FK4A 5SUHA 1RHUB 1HW9A 4W4MA 4HEA9 5KFJA 3C19A 1X9SA 5A6WA 2OUGA 4L6V3 1TZ0A 4YHHF 3O8WA 2IM0A 3GIRA 5I3PA 3W65A 3Q22A 1N33F 2QA4G 4ID5B 1B0TA 2LYVA 1S59A 4FN5A 3S01A 1NK6A 1XEZA 4QJFA 2R7ZA 3PFEA 3GIQA 4EO8A 1TQLA 1SI9A 4WU3A 2NYIA 3C15A 1MU2B 2ZBIA 2V50A 1C1BB 1T0TV 2CQ3A 4XK8C 1NAQA 2CQGA 3HHNB 4A47A 2YRXA 2ILZA 3HSGA 2J5AA 1UVKA 4F4KA 1VQLS 3GCXP 4C3LA 2D74B 1FTRA 2XMVA 3VZIA 1GSHA 5B0GA 3MPWA 1VK3A 4MV7A 5D8HB 1YX2A 1HNVA 4ED0A 3B82A 1S0OA 1W53A 3HFVA 1GXUA 3DRPA 1U1PA 3T1YJ 1R8CA 2YKQA 4OX9J 5EZYF 3L9TA 1KOOA 1UA1A 2WAQE 4ZVGA 2ZHAA 2KKHA 3I4NG 4Q0BA 4B3SF 3GTPA 1F9HA 4F0MA 4QWAA 2XHWA 2ILYA 2C3OA 2QEXS 4WJBA 1I1GA 2RDDA 4DR3F 5EX3A 4A8XA 4RW6A 1FKPA 1S0MA 4UY8T 1KR4A 3RW7A 2DRDA 4ATNA 4F4ZA 4O3RA 4F3QA 1LW2A 3MR2A 5K2MA 4DFJA 4TY8B 3THVA 2OWOA 1NH7A 5IYBG 2UUBF 1QLNA 3RGXA 1N5YA 5BYQA 3BKUA 2JX2A 2FLNA 1J2VA 3ILOA 3FRZA 4TN2A 3D5MA 1GGOA 3TARA 4WFZA 2HHSA 3H2LA 3W5ZA 1P1TA 3SYZA 4DR5F 1H38A 3DDIA 1UZHA 4U7UD 1EP4B 6FDRA 3S1TA 2CKWA 3BGFA 5IM0A 3MMBB 5HBMA 4PG8A 3NAHA 4WZMA 4G1IA 2MB0B 4Y65A 5JXSA 3CCZA 4OJHA 1AW0A 3LP2B 4NZ0A 5KFCA 4WFXA 2E1AA 2IY5B 4M5DA 3LGMA 3TZYA 3VMMA 1M5KC 3MWDA 3POTB 4CO4A 3VAMA 2WW8A 1UFWA 3JQKA 3VZHA 4ZN1A 1TELA 3C6UA 2B5JA 2E5GA 3IR7B 4I4BA 3J7Z5 3CO9A 3MMCA 4JI8J 2EFGA 4JI3J 5H9EK 5J2PB 3F41A 2GJIA 3I5BA 1ZAWA 2AKWB 2SXLA 2Z2ZA 5CAAA 4TU7A 5HL7Q 2KJWA 4GKKH 5DQIA 1EQ0A 1RU2A 2QK4A 1GTEA 2E5IA 4ETXA 1RTHA 4G1QB 2IP4A 4YB1P 1GK8A 4DV2H 4LF8F 4PPDA 2DLNA 2UZAA 1W96A 3G2XA 4PQAA 1TV6A 5DQGA 3H7HB 5HK4A 2FC9A 2ZUGA 4DLGA 1FVQA 5GMKa 2OH2A 2C2MB 3B78A 3TA0A 1MU2A 4Y00A 2I2YA 2RQCA 1C1BA 1IKVB 2BV3A 2CJXB 4CRJA 1IR2A 1TK8A 3D3CJ 2AP6A 5E3CA 3MPVA 3VGTA 1YRXA 1D3WA 2F4FA 2JOQA 3L7UA 4JUZA 3SSQA 5AT1B 3C0FB 3I9ZA 1R0AA 2GV1A 3M32B 5J1NA 3KK1A 1WF1A 3RW6A 2XIGA 3PYFA 2VPXB 4OYIA 2QLXA 1DRZA 4A3MG 3MR5A 3LUYA 2W24A 1MROA 1G2EA 3TJ9A 2XCAA 1YWXA 1R6YA 3AJDA 5CABA 1CS4A 3AXMA 5H9EJ 4DR6F 2F65A 4DPXA 3NL0A 2E9TA 1YIJS 1FESA 3EGWB 3T6JA 4UCUA 2P6SA 3MD3A 2ADBA 3EYYA 3UVJA 4K0KF 1HNZJ 4DX7A 5CAEB 4FYWB 2AX0A 4WWSA 4NYPA 2JA5G 1TAUA 3R5FA 1EAYC 3CCVS 2VFVA 2AF6A 3ZXWA 4FYYB 3ZFVA 3KG0A 4KGXB 2B7CB 4A2BA 1Z1ZA 1RP5A 3NGDA 2XQCA 3PJXA 2HNZB 2G9OA 2YYAA 3AD7C 1K83A 2MXYA 2DVIA 1VQKS 4TLRA 2EFQA 3NMAA 4C8NA 4LFCJ 4DN0A 3K7RA 3QAUA 5IT9Y 2HJWA 5H80A 3SE7A 4LFAH 4F4XA 3FGVA 4NE9C 2Y0SA 3M8QA 4PCQA 2HKEA 3GTKA 4LF6J 2DHXA 2HZVA 3A13A 1ITPA 3QIPB 1RAIB 4ZVTB 3JSBA 1UC9A 2LU2A 2O66A 4I2QA 5B09A 3CCMS 3AXKA 5KFIA 5C25B 8RUCA 2A2DA 1APSA 5BR8H 1ZH5A 4Y2CA 1S7IA 1DHMA 3POTA 3KG4A 1JJ4A 4PXDA 1TKTA 3D4JA 2N3OA 2LEPA 2NU6B 2DR5A 1T94A 4R8UA 1HI0P 3M30B 2DNNA 1HWUA 1HWKA 2VB6A 1GMUA 2XY7A 5JVDF 3GIPA 2KI2A 2XS2A 1KVJA 3OVBA 3K2YA 2MZQA 2JRSA 3I5AA 3ISZA 3EGVA 4ECWA 3RUPA 4OI3A 3RBDA 3BH6B 2ZWPA 3CJ4A 3BGUA 1J5EJ 3ET6A 3UFXB 1T9YA 3K59A 5C2GA 1YI2S 1RHMB 4HI2A 1ZZNA 1RWUA 1JLQB 4FYVB 2KH9A 4JYAJ 1HPZB 3R5BA 2R7MA 1M5OC 3PXGa 2Y0BB 3R1HA 2QMXA 3PW4A 3CDAA 1GMVA 3QRPA 1IKVA 4XIUA 1RT6B 3DRXA 3SI8A 3NS7B 4AYBA 1FK9A 3M9MB 4ZOLF 3J80W 2CPIA 3CWJA 2F8MA 1VQ5S 1H2VZ 1W2BR 5KT6A 2XO7A 1SIWB 2HWTA 4DQSA 4I7HA 2BJ3A 4XYLB 4WK1A 3CCTA 1TMMA 4O23A 2NVXA 1B7YB 1FA0A 2AJFE 3WDOA 3H4DA 2MZSA 4Y6IA 3BABA 1SL0A 2FTRA 4ZCKA 2HK3A 1KBLA 1R3NA 1HQUB 1VR6A 4J90A 3OFGA 1W93A 2Q2UA 1XJWB 2QJ3A 3Q23A 1TWAA 4CO3A 4M5NA 4BWJA 1DTQA 3M6XA 1C30A 2RVJA 2EVZA 3F56A 4OHWA 4B3RF 1RWKB 1TWCA 1GNKA 2WB1A 5JUMA 1LKZA 4HNVA 1KJ8A 3KJVB 4JI5F 4DV7J 3DLKB 2HNZA 9ATCB 1DARA 1B4SA 3F44A 2YY3A 1U8WA 1JLGB 1SJ4P 3OTOJ 2IM3A 1HWJA 2AGQA 2DNZA 4QYRA 1NEEA 1FF2A 1T05A 4FKXA 5F8IA 2CRLA 2VQFH 4KH1B 5CZXA 2W57A 2C42A 1VI7A 4RNFA 5J2UF 2QYZA 3HXMA 2XMMA 4DL7A 4BBYA 4Q44A 4LF5H 1HMVB 3IRXB 2JLFA 3Q0AA 1KTVA 1F9FA 1RTJB 3EVOA 4JI4F 4BC9A 3L09A 2W2OP 5LJ5Y 2R9LA 4PG6A 4QWCA 3GFXA 4KRWA 2NXNA 5ETQA 2KN4A 4LMYA 4NA3A 2XS5A 4XTTA 2FVCA 4JI2J 1RKJA 2A2CA 2ZOGA 3M30A 4HHUA 4LSAA 2R7RA 2R8HA 3HI9A 3EXYA 2WRMA 1FJEB 2BW7A 3TINA 5I3UB 2H9ZA 3QSYB 3CMQA 1T36A 1X0FA 5HVHA 3TUIC 4RWXA 5EHHA 2LQ5A 1Y4ZB 1V3RA 3W64A 5DO2A 2ZHBA 2BX6A 2Q79A 3OVSA 4ECVA 2HQGA 2FC8A 1XMQJ 3I55S 2ZJRQ 2HBZB 3CO0P 1JLQA 2J9DA 4JI7J 4LF7F 1Z4UA 4HYKA 2WAQD 5CB4F 4MJKA 1H72C 3ZZUA 1VQ6S 3WIVA 3W9JA 1NPRA 3R2DJ 1WHVA 4OZ1A 3I0RB 4DQRA 1CJTA 2RB7A 2I1RA 3TI0A 5CYMB 3H0GA 3T1YF 2ABYA 2RUSA 3ENVA 2XHCA 4QJVA 4LSNB 3MAAA 1DBDA 4C48A 4OZLA 1FD8A 4K4ZA 2WK4A 1V3SA 3HCXA 3DNCA 2OD4A 3SQOP 5HLFA 2V4JA 3P5TL 5HMZA 4RW7A 4RW4A 3NGTA 5D3GB 2UXBJ 2IBOA 4EFEA 4C11B 4ELTA 2ZH1A 2DWCA 3W9HA 3Q2TC 1TU0B 4LF9H 2LMIA 4OYZA 4GMKA 2MKIA 3BQ1A 1ACMB 4NRUA 4B3OB 1IBMH 4KO0B 3OR1B 1YJNS 4CI0B 3I5CA 1YJ7A 2IC3B 2GHVC 2BRLA 5DDRC 4IQXA 1UEUA 3MUVP 3OL7A 2FP4B 4X4OA 3G6XA 4ZPCA 3ZNUA 3MUMP 4ZPWR 1FFGB 3KJVA 2FPGB 3ZTQA 3VCDA 3VPCA 2CJYB 1I3QA 1JLAB 4EYHB 4I1TA 4U67Q 4N8NA 2LVWA 1CULB 4B9VA 2YH1A 1D1UA 1X60A 4DU7A 4USUA 1YQHA 5IWAH 2RRAA 9RUBA 3KK3B 3H98A 4PKDB 4WD3A 5BXIA 1WSRA 4ZLJA 4JV0A 1ELOA 4CC5A 3QJLA 2MKHA 2R2RA 4DSLA 3MM6A 4JI8F 3K57A 5C5JA 1NZAA 3QFHA 5GAHI 1UZDA 2X0SA 3PCOB 3HT3A 1S6UA 5DLFA 3D1QA 2MZTA 4CLYA 2HEKA 3FBEA 4KHPH 2DGOA 2EFNA 2VJVA 3TA2A 4O0IA 3RJMB 5THWA 4X4TA 1B64A 2L9WA 4A8QA 5FD6A 2OPPB 3EGNA 3OR2B 2LDIA 1LWCB 4HR7A 3MM5A 5HQMA 1WEYA 1KRPA 1VFJA 5DM6Q 5J2MB 2YWFA 4NLDA 1Q8IA 3H25A 3W2WB 4A8WA 4RAYA 4OQJA 3L3CA 2VPQA 1RLCL 1N36H 4ZJOA 4RNMA 3MEDA 1TWFA 5JJBA 1HNWJ 2OLSA 3EDRB 2R87A 4NXMF 1QD1A 1IKXB 3Q8RB 3AODA 5KFVA 2XY6A 3CD7A 4B17A 5B0AA 4B9TA 1VLYA 4NLTA 4BDPA 4HQ6A 1SH0A 2BVZA 4LR9A 3MM7A 1DLOA 4WFAQ 1HBOB 4OZ0A 1Q16B 4CLZA 4DV0H 2G0IA 1BJTA 3HFZB 1WEZA 4O4HF 3QNWB 3MAHA 4KB7A 3DOMA 4LFBJ 1B70B 4K4TA 3EZOA 3N40P 1HNZF 5A2QY 2MSTA 1FI4A 4USVA 2PA8D 3MEKA 1B99A 5IYCG 2VL1A 2FZKB 2AYGA 5D3GA 2FLOA 4HI1A 1V2ZA 1DQAA 5FLXY 4LBPA 4I2PB 1Q1KA 1SL2A 4KE5A 1DFDA 1U0HB 4LQ9A 4U9RA 2L3MA 3Q8SB 3PX6A 4DF4A 1KQSR 4KO0A 3C66A 3KNAA 3JSMA 4CT9A 1FKOA 2H5EA 1YLXA 4U6PA 4LFCF 1VDHA 5T7LA 2R7SA 2YXLA 2FZCB 2XGPA 1IBKH 2HHHH 1XNQH 1U1MA 3ISNC 2ZZNA 4Y2IA 1S97A 5K8OA 1TK5A 4LF6F 2E5JA 1JLAA 1RWMB 1FVIA 2RKIA 4FBUA 2YBVA 1CC7A 1KKHA 3M4XA 5KFFA 2H48B 1UPMB 4PYAA 4ZVOB 5KT4A 2XSFA 2RGVA 1VQPS 4B08A 3M6WA 3N8DA 2FK1A 1TL3B 3UE2A 3CMES 4F26A 3BBCA 1Q8KA 2BACA 1DY3A 1HHQA 2KT2A 2KU7A 4J9RA 3EVMA 3TEGA 4URGA 1VBZA 4LR8A 2LXUA 4X66J 4B3TJ 1YDLA 3ETMA 2HSEB 3K5IA 3IR5B 3QLHB 2F8HA 2LLZA 2R8GA 2L48A 4WBNF 2YNIA 2CAJA 4AE5A 3U1LA 4DR2J 5IC6B 3A1YG 1J5EF 1JLFB 3H0PA 2HNYB 1QAYA 4BY1G 2KT5A 5B0FA 2EFVA 1HBNB 4HH0A 3OR2A 1LWCA 1I51B 2VKZG 1NKBA 1BMQB 4JYAF 5J2MA 2BANB 4Z7YA 2MY8A 1VLOA 1IWAA 1FRKA 1O5JA 2ACYA 1LWFA 1MMDA 3P5BP 3W2WA 1LNQA 4KC5A 3ZTSA 2KYZA 4YDDB 1VQMS 2JH3A 1XNRH 1C0UA 5F9LA 4M5IA 2XCPA 1BGWA 5KFUA 1V5VA 3AOBA 2DT9A 4ES1A 1BE4A 3PACA 5ETNA 3HOXG 3BZQA 1C1CA 4EU0A 3A3PB 3DHXA 2GQCA 3OTDA 5KG0A 3GP9A 3K8WA 3PW0A 2N7YA 5GAEU 4TU8A 3RBZA 2B63G 1BXRA 2W9BB 3MFHA 3PHEA 2CG8A 1VIXA 4EYIB 1UKUA 5CCLA 2GAHC 1KC7A 4QIEA 4IUFA 4AQYH 3ADAC 3CGIA 4DDFA 2DEIA 2B4UA 4OL8A 1WNEA 1FNMA 3VV2B 3D67A 3W3SA 3RIZA 2R84A 4X65J 2VOOA 4YEAA 2ZC3A 4PWUA 4AT1B 4Q2LA 2DR6A 5HVFA 1BY9A 3JAMY 3HD1A 1WI6A 4NWBA 3HKZE 2DK2A 2C2ZB 5JH7F 4DV1J 5IP7G 2XTJP 5LOQA 1R8HA 3OLAA 4YR0A 2ZDPA 4KKOB 2CZ4A 1S9EB 3H8YA 2B9XA 2DCUB 1N5QA 1OPZA 5C42A 2Z8QA 2P9CA 2NUHA 3M1VB 1UTAA 2YZNA 1NSAA 3PHTA 4A8YA 4ZCIA 3NG8A 1T9TA 3QT5A 1T9UA 4G1PA 5KFKA 3IMQJ 3D28A 4JI2F 3CCRS 3R6GB 4IO9Q 4UOGA 1MWQA 1OSDA 1RHJB 3VPDA 1RB0A 2GZOA 5L38A 4NI2B 3JRWA 3PRVA 3KMQA 1S1UB 4ID8A 5GADU 1MW7A 3IM8A 4CIOA 4NLWA 1NCLA 5FDLB 1VOMA 3DI6A 3BA9A 5CA1F 1QTEA 3QWUA 4YY3H 1XMQF 3W62A 4GC7A 1HNXJ 5BPFA 4WU2A 4OJGA 1T7PA 4ETSA 2V9KA 4JI7F 2UP1A 5LMNF 1TUVA 1RWXB 2LCWA 1YZ6A 4RBUA 2XCLA 4NYZA 3TQEA 1VRUB 4MT1A 5GMEA 2QZ8A 2L9DA 3N43B 1B04A 1T11A 4GKKJ 1FDDA 2KVQE 2QGFB 3IWNC 4O4LF 4RW9B 3RR7A 2HHTA 1RSCA 2BDPA 1CE8A 2RGRA 1I94J 3KLFA 4DV2J 3CCES 1GT8A 4I55F 4FP9A 4OI2A 2FE3A 4FXWA 1N34H 2HFVA 4YMEA 4CP5A 1R8AA 5KAKA 3AB4B 3D0GE 4Q8FA 2UXBF 2AZ3A 2BE2B 3MMJA 3VVUA 3SXLA 1U24A 4ILLA 2EW9A 5KOWA 2AYMA 3N01A 4PQUB 3N6NA 1XMOH 2GHPA 3HHDA 4FVCA 1WG5A 4P2SA 3U1NA 2ROGA 2BJ9A 1RACB 2HWIA 2ZE2B 3NCRA 1WOOA 3SSSA 2PFFB 2DBBA 2HLTA 3FDSA 4WE1A 3HVTA 3CJSA 4OLPA 1Y1WG 4OYMA 4N8OA 4UZCA 1PAUB 2OPQA 4IWXA 2ALYB 5E3QA 1HI8A 3TRGA 2E9RX 3UI3A 1UNNC 2FHMA 1MN9A 2VA2A 1S99A 4CZCA 2WW4A 4TV8F 1Q78A 3G4SS 1EIYB 2XSJB 2FJZA 4RUCA 2CNKB 5A0YB 4B3MH 3T5KA 3FFIB 3K5NA 4FZVA 4DL5A 1ZTTA 5HI7A 4YB7A 2RF4A 1R5QA 1CPZA 2ZBPA 5K8NA 5J1EB 3ZTPA 2KO1A 1HQ2A 2CQCA 2HNDA 5KFTA 5D8DA 2GVZB 3VQTA 3CCSS 1VJQA 3X3UA 4DU8A 1KFDA 2UXDF 1RUSA 4LFAJ 3TAMA 2GIQA 4EO6A 1TKXB 2HQIA 4C2MA 3HM9A 2D3UA 4A2AA 2DPIA 2ZDHA 4KGMA 2FK2A 1RT3A 2I9SA 1T03A 3V5RA 2FLPA 1HNIB 5J2QA 4IWYA 1VKZA 2WAQA 1PBAA 2G1DA 3JS9A 2Q1LA 3SMZA 4UW2A 2YKNA 4C7QA 5KG1A 4WP9A 4DV4H 4OI4A 5BR8J 3R5DA 4APMA 4J9MA 3V4SA 2A6MA 3BGLA 5H9FJ 2CQ1A 1RBOB 4NLYA 1I5OB 1PSDA 1ZTWA 1UJ6A 3KNGA 1HHTP 1IKYA 1RXOB 1V9PA 2MZ1A 3QFWA 2GC8A 1IBLH 1UZ3A 4UTGA 4GC6A 6AT1B 1RT2A 3P45B 3DLEA 2DNRA 2UUTA 4OX9H 1BQNB 4LREA 4AXIA 2FJDB 3BPDA 3M05A 1HL6A 1B7FA 1FXRA 4M5MA 2B9WA 4FNIA 1H98A 3C2PA 3KAJA 2VPWB 4LFBF 2RF2B 1YVFA 1PC5A 3EZUA 2YKMB 2R2TA 3MM8B 1Y11A 3BN4A 5AE1A 2VIHA 1E6VB 4N77A 1PJ5A 3JB9k 4EGLA 5KFRA 2K1RA 4KPYA 2BE2A 2FJVA 3I4HX 5KFLA 4FU0A 3HD2A 3T19A 2G4BA 2BA9A 1WG4A 1L2ZA 1HKAA 1TUWA 3IM9A 4WP3A 1UFLA 4DJBA 1NKEA 3KOAA 1U6FA 4F4WA 2H4WB 1KVIA 4I7FB 3MEEA 4H4KA 1T02A 4ERDA 1CJUB 2W6QA 1CQNA 1LXJA 2AU0A 1URNA 3HSZA 2XS7A 4I56A 2RQKA 1TWHA 4QIVA 1UFKA 1VQOS 2X1FA 3KTQA 3FMBA 3LP0B 1N5TA 2M8DB 5DGBA 3M2UA 1WC5A 4AYBE 1GEHA 4CNZA 4DWIA 3KHRA 1KEEA 2RD5C 4JI3H 3HOWG 4DPUA 4ED7A 1WSVA 4IG3A 3FFIA 4I64A 3VWSA 3ISND 4RW8B 4O2BF 1NM2A 4K8RA 5ETLA 5A6PA 1Y7PA 3LO3A 2J6ZA 4X66F 5LXTF 2E2HA 4HDGA 2RMLA 3KALA 4RBTA 1NK5A 1RT4B 1FVSA 4C5CA 3J7YI 4O0NA 1NJXA 4WTOB 4DR2F 2VQFJ 4IKAA 3ZZYA 1EZZB 3O1LA 1TKXA 1DTTB 2YW2A 1K0TA 2P9GA 4R0EA 4LF5J 1S48A 3L4JA 4TYAA 4Y2AA 3IRWP 1M90T 3HHLB 2Q6BA 4A8MP 2UU9H 3VAIA 5K5MA 3RYLA 3EE3A 1S1WB 3RV4A 2WDTA 3BV8A 1E4EA 3DLGB 2QSFA 4GRSA 1Q0NA 4B02A 2ZC4A 4DBQA 3W8PA 3WX8A 3IBFB 4CLLA 3TX8A 1YJVA 2WHOA 1CJVB 2K3IA 4ANCA 1R27B 3TAPA 2OEJA 3D6FB 3Q89A 4ZN3A 4ED3A 3LPEA 5C3EG 2LXIA 5FD1A 4PUOA 2B4OA 3HB9A 2HQFA 1AZSB 3SFUA 1RJRA 3DOLB 3GIJA 3V81A 2F4VH 3CCUS 1JXLA 3BQ0A 2KXNB 2XO6A 3L7PA 3BS9A 4CO2A 3DGPA 3W60A 1GYFA 1NK8A 2LKZA 3MCOA 4ES3A 1FCAA 3HT0A 2DNYA 1VBKA 2IYIA 1VRTA 2DTJA 2VBYA 2B63A 5J2TF 3PY8A 1FERA 5EWEA 3U02A 2Q2TA 3BJYA 3H2VE 1YJWS 4YJ3F 2R7QA 3CC2S 2M52A 3HKZD 2DH7A 3QRQA 2RU3A 5KFNA 3E51A 3AT1B 1C4CA 5A76A 3VAJA 4R5PB 5KFPA 2Q66A 3VGVA 3N6LA 2Y8WA 3GTJA 1SQFA 3G6ES 4X4PA 2B6AA 4DPOA 1KN6A 5LT5A 2XWXA 3BGOP 1JLLB 1FJCA 2YNGB 1XN9A 2PSZA 4CYUB 5CYJA 3FKIG 2J9DE 2GQ2A 4LIRA 3W5XA 1QUVA 4M94A 3QBCA 5KKNB 2QL9B 2IVYA 2VU5A 2MKKA 1VGYA 3AB2B 3PZPA 4LF9J 3UQSA 4ZOSA 1A9XA 2FD2A 1T95A 4ZPAA 3KLIA 1IBMJ 3FBBA 2OPRA 3A4TA 3L9ZA 5KG5A 4H4MB 3QJJA 3D54A 5CH7B 2GMJA 4USJC 2ZJQQ 5HQLA 1SJRA 2JC1A 1D8ZA 1KLNA 4DG1B 3EZXA 2PI5A 3FUYA 2EKNA 1RWVB 3ITHB 4LJMA 4DPWA 2V8PA 3ZZPA 2DGUA 3MI7X 5LMUF 2YWKA 3T5HA 1UVNA 3V6DB 3HPOA 3MEGB 2XNQA 5D1OB 3L4BC 4RR5A 5L39A 3IS9B 1VJWA 1A0OB 5ETPA 3B4MA 2W9CB 2I5JB 2ASLA 3KG1A 1R8PA 1E6YA 2ZH7A 3L7OA 4OJ3A 3ZZZA 1SQEA 1NPPA 2MKYA 1JB0C 2VUGA 4QIGA 3GFHA 4MTDA 2FQQB 1I3OB 2QO3A 2JEFA 1LWEA 3JYTA 1YSJA 4B3SH 3KDNA 1SLYA 3DLGA 4J9KA 1M1GA 1KJ9A 2CJAA 4Z37A 2KZMA 3NGUA 4KHPJ 4Q2MA 2BQRA 1H2TZ 4USTA 4GKKF 1IUJA 4DCJB 1N56A 4BWSC 2GMLA 3ICLA 4MV9A 1U1NA 4FPIA 3HVWA 4DV2F 3M6UA 2ZJPQ 1TKZB 5D6GA 4RU2A 4F67A 5L1LA 2MLZA 2KFNA 4IFVB 4B9NA 2HVZA 2OSQA 1U1LA 3RZAA 2RIJA 3MOZA 1SV1A 2B9EA 1S12A 2J6TA 1F2HA 4DR5H 2FB0A 4YB8B 2BQ3A 1N36J 2J7WA 3TUZC 4DR7F 4AL6A 3R5AA 2DCLA 5A8RB 2W01A 3BGRA 2MQLA 2YNHA 1U2FA 1VYAA 2HGMA 3MTJA 3QFFA 2ZHOA 5KG2A 3OTOH 4Y28C 4M0MA 4ZVEA 4I50F 4IH7A 2NZCA 5EX0A 1LEOA 1JLCB 4ECTA 1RK8A 2JLGA 1WHYA 1GFWB 1Y1WA 1XTZA 2NQPA 4XAKA 3K5LA 4IYQA 3RF2A 4JI1J 4IG0B 2J7UA 1UA0A 4UOCA 5A2QW 3GQCA 1HR0J 3DOKA 2EBGA 3U7JA 4LVOP 3M8PB 4P74A 4IDKB 3LP8A 4DL3A 1D8YA 2FJXA 1NK9A 2KG0A 4DV5H 1U47A 4H4OB 4NEZA 1QAIA 1S6PA 4H4MA 2HQCA 3GV5B 4USMA 2DH8A 3CJ2A 4XZ3B 1XK8A 4I6AA 3KTMA 4PDBA 3Q8YA 1OWXA 3FCHA 5CD4A 2C2OB 1YBAA 3D2WA 1IBKJ 2HHHJ 4LFAF 1XNQJ 3ZZRA 3DRYA 2DNMA 2KJVA 5F8HA 1EKSA 3D0IE 4WXWA 3V6DA 3VQSA 5D1OA 4I67A 3RJ0A 3RRHA 1K1SA 5D15A 5F3TA 2FMAA 2W9CA 3CF5Q 2OD6A 1Q86T 1X9WA 5BR8F 3GG0A 2UUAH 2FGOA 4UCVA 1X9NA 2ZH9A 2DR7A 1UCNA 2K3KA 5DLGA 4X4VA 3LGHA 3K5MA 4DL6A 2W25A 1FRIA 4J9UE 3UN3A 1XIQA 3GJTB 3BDEA 5DG9A 3H5UA 1JLBB 1RWWB 1YTYA 2H5IB 2C28A 3R7BB 2ATCB 4OYOA 3P49B 2W8KA 4RNHA 1FKAH 2HBRB 2EFPA 4FS2A 5M2RA 1MMLA 4MFBB 4PABA 3BSCA 5D0EA 4NCGB 1WG1A 1ROFA 2CQBA 3DLBA 2D41A 2V5HG 2FVPA 2ALZA 4IFVA 3GJSB 1QE1A 5HAOA 1QUPA 1S9FA 3QO9B 2GFFA 4A3IG 1RTZA 4ZMMA 2HURA 5SZTA 2HS0A 4CO5A 1XNRJ 4WFBQ 1LFPA 5C44G 3NXZA 2F8EX 2M2BA 3NLCA 3RG6A 2HGSA 4QIFA 2MMYA 3GB0A 3KLEB 4QBUA 1V3ZA 4XYMB 2HVRA 3IP0A 2UVUA 2HMIB 2XC9A 2CA9A 2B7BB 3D7SB 1R7IA 1WKKA 4ICLB 1HBUB 3GILA 3I0SB 4QR1A 3QGHA 1IM4A 2NU9B 4NA2A 3OL9A 3CD0A 4HKQA 1N54B 3AOCA 1H0HB 2DPJA 2XY5A 4ZLPA 5DG8A 4TLQA 2F1FA 3PEJA 2AEFA 5CYQA 1VQ9S 3C6TA 2QC3A 4U95A 4DQPA 2GGPB 3CJQA 4OHXA 3I56S 2VC0A 4H4OA 1PAEX 2CDRB 4C8OA 4J0MA 2MGZB 3HSDA 3KAKA 2CQPA 5GONF 4ZS6A 3CVKA 1JK9B 1FWLA 1SUQB 4QYZK 2QA2A 3MM9A 4IRKA 3IWLA 1S1VA 4PEOA 4WCEQ 2DY1A 2VKRA 3ILLA 2QT7A 2Z57B 2VQFF 4L3NA 4DF8A 4CCHA 3N6MA 3V4IA 2AGOA 2YZMA 3MMAB 3JAMW 2FJEB 4LF5F 4Q0YA 2C3YA 3LTOA 3CVZA 1JKJB 1OIAA 1X4HA 1DGSA 2BJ1A 2K7KA 3EWGA 4PG7A 1FJGH 3WIUA 4HTIA 1VQNS 3AYHB 3RBEA 1IKWB 3A3OB 1S0NA 4EZ6A 4HNUA 1KJIA 2C3PA 2XMWA 3L2PA 3R5GA 2RUGA 5F8NA 2IMWP 1HNWH 3AFGA 4N5SA 1ULRA 3R27A 4PR6A 1Q7LB 3BO3A 5EGYA 2IRXA 4IH6A 4TQRA 2ZH4A 4M8LA 5HBRB 1QY7A 3QIDA 1SJ1A 1FJ7A 5A8WB 4K4YA 4EMDA 4YY3J 2NSBA 4ZDNA 3EJMA 4S0MA 4NLPA 3FEYB 3OPKA 2CQYA 4ILRA 3UDVA 1ZM3A 1RWOB 4QYZJ 2J9EA 1Q8BA 5L1JA 2KRRA 3QO9A 4OHZA 4DMZA 2KDOA 1FFSB 2EKYA 4LSZB 3QZ7A 3CB4A 1M1HA 4P75A 1U1RA 4KAIA 4QOTA 4HTJA 1V9OA 4LRDA 2YX7A 3B8HA 3T1HJ 1FWPA 2D3ZA 1FRJA 1FNXH 3GIKA 2QV6A 2LU1A 4AL7A 3R8YA 1N34J 3LP1A 2DEJA 4YJ2F 4ANEA 4F2SA 2W6PA 3N41B 1YKWA 4LF4H 1HQEA 1HBUA 3WQPA 5KFZA 4O4GB 3R9LA 4UOFA 3UDEA 4JI0H 5KFQA 3DRRB 4G86A 3DKDA 4OHVA 2KYXA 4LF9F 4G3IA 3FKIA 1XMOJ 1KFSA 5FPRA 2PN1A 4FF2A 4QPXA 1IBMF 2JJ4D 5IQ6A 2RE1A 1RAJA 2BABA 3HHKA 3QATA
chains in the Genus database with same CATH topology
4I6WA 3V6HA 1S6OA 1DFDA 5D4LA 2HAIA 1FHTA 1H2UX 3A8EA 1Z2NX 4LQ9A 4U9RA 2L3MA 3Q8SB 3PX6A 1L3KA 1UW4A 3PIOQ 4DF4A 2FHKA 1KQSR 1HYSB 1QVGR 4B3TH 4FXVA 3RRGA 2GGPA 1HWIA 4KO0A 3C66A 4WFNQ 2QFJA 3V4MA 4DR1F 3KNAA 5IT9W 1VBYA 1WH2A 3OV7A 3HHLC 3JSMA 1U6ZA 2RRNA 3CJ5A 1G3OA 3AA9A 4CT9A 5LXRA 3MURP 1JJHA 3DRSB 1FKOA 2YKPA 1T3OA 3LQVA 4NLQA 2H5EA 3SSRA 3GE9A 3T9NA 4CH0S 3OLBA 4C97A 4LF7H 1S1UA 5E3RA 3FEXB 4F4YA 4U6PA 3FMAA 2FLLA 2VG5B 4LFCF 1L3TA 2XG8A 4ELVA 5T7LA 2R7SA 4DV7H 5D77A 5E3AA 4IRCA 4B9MA 1AXQA 2WBRA 1K73T 1UVMA 2XGPA 3V6JA 5A8KA 1IBKH 1GXLA 2HHHH 1XNQH 1U1MA 3ISNC 5FDLA 3KLGA 2ZZNA 3NBPB 2D1CA 3H2UB 4Y2IA 1S97A 1CLFA 4M63A 5K8OA 2AW0A 1TK5A 4RUAA 4LF6F 3M2VB 2E5JA 2IJNA 1JLAA 3SEOA 4Q43A 4NA1A 2UV8G 1FJGF 2KZZA 1FVIA 2E5LH 5IWAF 1Z2PX 3N5FA 2RKIA 3T1AA 2GJ2A 1Q7YT 4FBUA 5T14A 1CC7A 1MNEA 2WOMB 3M4XA 3PR5B 5KFFA 4RB0A 5HLFB 2YX4A 2XB2D 2V4JB 2XLJA 2AV5A 4RW7B 2L08A 1DQ8A 5IT4A 3IXQA 5KT4A 4RW4B 4MK9A 2KHCA 1QTMA 1KSPA 3E01A 4BCAA 2XSFA 1HNWF 5AXNA 3EPGA 2RGVA 4X4RA 1KONA 1VQPS 4N56A 1CSJA 3MZIA 3IO1A 4ECSA 4B08A 3M6WA 3DXSX 1LQ9A 1KOHA 3DC2A 3DU5A 3HP6A 3PX4A 4OI0A 1TL3B 3UE2A 3CMES 3FEZA 4BHQA 4F26A 1K8AT 2CJ9A 3KWMA 3T1HF 1VRUA 4ZHRA 3M9NB 3PO4A 3GMGA 3IC1A 3E3XA 2BACA 5CYQB 1CEZA 3FVYA 1HW8A 3IA0A 1MWYA 1P9QC 3C6TB 2V4QA 3SDEA 3CSKA 2J6SA 2KT2A 2KU7A 2HVIA 3LAMA 4OZ5A 4KHPF 1Y3JA 2J9CA 4RW9A 4GLXA 4CNYA 3G96A 4J9RA 4K4SA 2IAJA 1FT8A 1KC8T 4URGA 1VBZA 4WKRA 2LXUA 2GA7A 3X1LB 1VQ7S 3N5BA 1REVA 3UR3C 4J9PA 4JI2H 2OPSB 3NRBA 4RUHA 2J0SD 2YTCA 2NUUG 2OAUA 3J7A1 3IR5B 5FIIA 3QLHB 3ZZOA 2F8HA 2LLZA 1HARA 4ZP6A 2R8GA 3I31A 4FBTA 2L48A 3MM9B 2G13A 2YNIA 5EDWA 1S1VB 2DR9A 4AE5A 2CFXA 4EEQA 2V9WA 3U1LA 4TKTA 1UETA 2ZITA 3F8NA 3A1YG 3LALA 4MK7A 2N82B 4EEYA 1J5EF 4RU9A 1JLFB 1U4BA 2U1AA 2FGCA 4D3GA 2HNYB 3UR0A 3V4IB 4MTEA 1QAXA 1LXNA 4OX7A 1UMJA 3VAGA 1QAYA 2EBEA 2FUG9 4NPOA 2KT5A 5B0FA 3N4WA 2EFVA 5CD4H 1HBNB 4HH0A 1ZPVA 3OR2A 1D9DA 2WONA 2YKAA 4MYUA 2E9ZA 4HVZA 1S6QB 1LWCA 2B56A 3K0JA 3CT9A 4DV3F 1U49A 4PQUA 1BGXT 1O0PA 4WFYA 4FPRA 5BJRA 2VKZG 1OQ3A 3G9CA 1NKBA 1U09A 4B9SA 2YWEA 2ADCA 4JYAF 1N36F 5J2MA 5LXYA 2DO0A 4RBVA 1RT1B 3M8RA 2BANB 7FDRA 2MY8A 4NX9A 3T1YH 2WSCC 3V6KA 1XMQH 3S7RA 4URQU 1FRKA 1TL4A 1O5JA 2ACYA 3ETOA 1LWFA 1MMDA 2XI3A 5KG6A 5FPOA 2Y0SD 3HDSA 4LIWA 4KC5A 3W2WA 1FE0A 2KYZA 4YDDB 2CPHA 4ECQA 1VQ8S 5KT5A 4JI7H 4DS5A 1UWBA 2O3DA 2ZE2A 1VQMS 2F40A 2W4DA 2JH3A 4XPCA 1XNRH 1C0UA 5F9LA 2K8GA 2MQQA 2XCPA 1FRHA 4ECZA 3MXHP 1UVJA 2EWHA 5KFWA 3HXLA 3PKYA 1URRA 1SH3A 3MM6B 3RAMA 5KFUA 5L1IA 2J0QD 1BGWA 4X65H 2BM1A 3IGVA 3LAKA 2XNRA 3N44B 2MDAA 3PIPQ 1GXTA 4PWDA 1ZOTA 4EBDA 3PNIA 4MIWA 5B0EA 4NLRA 3M2RA 2DT9A 4G6VB 1EETB 1B0VA 2WCXA 3NGKA 4ES1A 1FEHA 4DV0F 2QLWA 3PACA 4LF4F 2HVHA 3BZQA 1C1CA 2VOPA 2W9AA 2GMHA 3E8OA 2B4VA 5JVHQ 4EBEA 1BWEA 4R7RA 1S9GA 5D1PA 4EU0A 4R25A 4WKYA 3DHWC 3DHXA 2GQCA 3AHPA 4JI0F 3PX0A 4DV1H 3OTDA 1VC0A 5KG0A 1XR6A 3K8WA 2XSJA 3PW0A 2MJNA 3JTNA 1GX5A 3J81Y 5L1KA 3OXGA 2M0GB 3DMJA 1BLUA 4NOHA 5A0YA 1Y0HA 2N7YA 3QGIA 5GAEU 4FYDA 4TU8A 1F5BA 1N8RT 3BR9A 4ECRA 1DZ5A 2FMME 2DNHA 2CQIA 3B4DA 3OJSA 1ZYQA 2VODA 3OTEA 2AX1A 5DG7A 3BSOA 5D78A 1FO1A 2UVRA 2UXCF 4QWBA 3MM5B 4KIAA 2W9BB 5KT2A 1Q82T 2UXBH 3MFHA 3AQOA 3PHEA 1NO8A 4FVMA 2CJQA 5CZVA 2XULA 1VIXA 2EK6A 5L9XA 4EYIB 1UKUA 3NNCA 2MCTA 4C3MA 2OFHX 5CCLA 4QIEA 4IUFA 4AQYH 4K5SA 4C8MA 1KD1T 4I68A 3P6YC 1FRLA 4H4KC 4B3TF 4IQMA 3CGIA 5B0CA 1PGZA 2LDYA 4C0BA 2C22A 5J1EA 1PC4A 4DDFA 4J9SA 1VQSA 2BJEA 2B4UA 4IFYA 2UVWA 2XLIA 4OL8A 2W7AA 1WNEA 4DV6H 2BOPA 3TP2A 1FNMA 1SL1A 5E33A 3CCJS 2BYCA 3I96A 3LANA 4DL0C 1SKSA 1JJ2R 2EI5A 3IG1A 2V94A 3QGPA 3MEDB 3W3SA 4LH6A 2J7KA 2J8AA 2OLWA 2ZH8A 3O6QA 5F0WA 4HDHA 1YJTA 2VPZB 1OS5A 4QU6A 3RIZA 1C2PA 1WTFA 2YKOA 3IFEA 3OSNA 2VOOA 2HHHF 1C0TA 1CQMA 1XNQF 4Y0FA 4YEAA 4ECUA 1JKHB 3CIMA 2V8VA 1WI8A 2ZC3A 4PWUA 2GCFA 3G6VA 1U8SA 3CUNA 1L5UA 2VG5A 3CCWA 4Q2LA 4C0HA 3MECB 3ONQA 4ZPTR 3KLHA 1HNIA 2BR0A 4JV5H 3DLJA 4DFMA 4OIXA 2E5LF 4WYWA 1X4DA 3BA8A 5G4DA 5B7WA 1N52B 3LP1B 1BY9A 3MM7B 2AGPA 3JAMY 2EPIA 4NXMH 4AYBD 2MZRA 1DLOB 3NS6A 4UUXA 5KFDA 4X4SA 2LEBA 1WI6A 2LEAA 1HQEB 4NWBA 3NBPA 2DK2A 1SIZA 3JSLA 1TL1B 1HNXH 3KK2A 3CDWA 2VFRA 3GV8B