The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
108
|
sequence length |
467
|
structure length |
451
|
Chain Sequence |
PVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDLNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAGLRLEIPLDAQELSGLGFNNVSLSVTPAAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of Proaerolysin at 2.3 A Resolution and Structural Analyses of Single-site Mutants as a Basis for Understanding Membrane Insertion of the Toxin
rcsb |
molecule tags |
Toxin
|
source organism |
Aeromonas hydrophila
|
molecule keywords |
Aerolysin
|
total genus |
108
|
structure length |
451
|
sequence length |
467
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2005-03-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01117 | Aerolysin | Aerolysin toxin |
A | PF03440 | APT | Aerolysin/Pertussis toxin (APT) domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Proaerolysin; Chain A, domain 3 | Proaerolysin, chain A, domain 3 | ||
Alpha Beta | Roll | Pertussis Toxin; Chain B, domain 1 | Aerolysin/Pertussis toxin (APT), N-terminal domain | ||
Alpha Beta | 2-Layer Sandwich | Proaerolysin; Chain A, domain 2 | Proaerolysin, chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 1PRT B; 2D42 A; 1UYJ A; 3ZJX A; 1BCP C; 1PTO C; 1PTO H; 1PRE A; 1W3A A; 1W3F A; 3C0M A; 1PRT C; 1Z52 A; 3G4N A; 3C0N A; 3C0O A; 1W3G A; 1BCP B; 1PTO B; 3G4O A; #chains in the Genus database with same CATH topology 1PRT B; 2D42 A; 1UYJ A; 3ZJX A; 1BCP C; 1PTO C; 1PTO H; 1PRE A; 1W3A A; 1W3F A; 3C0M A; 1PRT C; 1Z52 A; 3G4N A; 3C0N A; 3C0O A; 1W3G A; 1BCP B; 1PTO B; 3G4O A; #chains in the Genus database with same CATH homology 1PRT B; 2D42 A; 1UYJ A; 3ZJX A; 1BCP C; 1PTO C; 1PTO H; 1PRE A; 1W3A A; 1W3F A; 3C0M A; 1PRT C; 1Z52 A; 3G4N A; 3C0N A; 3C0O A; 1W3G A; 1BCP B; 1PTO B; 3G4O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...