2D42A

Crystal structure analysis of a non-toxic crystal protein from bacillus thuringiensis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
249
structure length
249
Chain Sequence
AIINLLRELEIYGMQYANSHQYTYGSSYSDDTNPIRIAGLDARIPDPIVTDPVNHIVLDRRIITNTTSNSLEGVFSFSNAYTSRTSSQTRDGVTAGTNITGKYFANLFFEQVGLSGRIAFEGAVTNENKYTLDATQDFRDSQTIRVPPFHRATGVYTLEQGAFEKMTVLECVVSGNGIIRYYRTLPDNSYTEIVQRVNIIDVLQANGTPGFTISKEQNRAYFTGEGTISGQIGLQTFIDVVIEPLPGHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords non-toxic crystal protein
publication title Nontoxic crystal protein from Bacillus thuringiensis demonstrates a remarkable structural similarity to beta-pore-forming toxins
pubmed doi rcsb
total genus 48
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 2d42A01
3.10.450.380 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2d42A02
2D42A 1W3GA 1W3FA 1Z52A 3C0OA 3C0NA 3G4NA 3G4OA 1UYJA 3C0MA 1W3AA 1PREA 3ZJXA
chains in the Genus database with same CATH superfamily
3LT9A 2FNQA 1BRHA 3EQQB 2D1WA 4O3VA 1IVUA 3CNMA 1RLSA 1NWWA 2F86B 1D6ZA 3X41A 1E3RA 1Q7HA 1QAKA 2P0MA 4OK0A 1KWIA 3FG4A 4FMBA 4X2HA 5JPUA 1LNHA 3H3HA 1I2GA 1BVIA 1FUTA 3GZXB 1G02A 2CFKA 3T8NA 1RKYA 3GRDA 4HJLB 4N3VA 3CC23 3WA2X 1OGZA 2CX0A 1GOYA 3GWRA 2MC8A 4RZMA 4AKYA 1D6UA 3MSOA 1GMRA 1JBSA 3MPHA 4FCJA 4HAAA 4HM3B 1W2B2 3KSED 1UI7A 1DYUA 1SQWA 4AEQA 1N5PA 4HBRA 3JUOA 3CCL3 2WGQA 1BGSA 5G1KA 1BRIA 1YGEA 1JNQA 2Z77A 2RBIA 3OX9A 2BNGA 4N6NB 2C10A 1YJ93 2F5MA 1Q40B 1W01A 2C4BA 3OXAA 2GU3A 5BU4A 1EA2A 2OTL3 1N9EA 3NXJA 4FMDA 2CFDA 2HMJB 2Z7AA 2CIUA 1S5AA 3FGYA 1BAOA 3AMOB 1M904 3X40A 3NQYA 1Q7Y4 2K54A 3UL6A 1VQ43 3GZRA 1OHSA 1BNFA 3S67A 3F9SA 3CCS3 1BRSA 2HMNB 1YIT3 3Q2PA 4R80A 4LEHA 1BSAA 1ROAA 1TRPA 1FZUA 1UW1A 5JBSA 1W6YA 3OWSA 5LC6A 3G4NA 1WNHA 2F56A 4LGQA 2IUJA 2Z6BA 4WP5A 3JVCA 1RTUA 1AR0A 3WOEB 3RGAA 1UCKA 2OQEC 2W6JH 2GBXB 5FGOA 1STDA 2WOHA 3X42A 1US1A 5I97A 3N54B 4J9AA 3UNLA 3EN8A 3KN4A 1RJOA 2OOVC 5M1AA 3CME3 1B20A 1UGIA 2MF7A 1L5GB 3WMDA 1BSDA 1PFPA 2YX9A 1BOXA 1ROVA 3JUNA 4FCMA 4NHFA 3BNBA 4RBNA 1TP6A 3NBRA 1VQ73 2K0MA 4L8PA 3KIIA 5HGRA 3RGRA 5M19A 1BSEA 1LOWA 1GY6A 2Q07A 2QEX3 3PZWA 2IYJA 1V57A 2JDIH 2RGQA 3ECFA 2RCDA 4KFFA 1CEWI 1VQN3 3LYGA 4EV5A 3G0KA 1M1XB 3WDGB 1I3FA 2BHMA 4FMAA 1I3IA 5KP1A 3DH2A 1IV9A 3C0MA 3PCRA 4WWUC 1Q40A 2W56B 2W0QA 1FUWA 1ULJB 3KKGA 4J5GA 3EX9A 4LZIA 1FUSA 1JN5B 1PY3A 2H0IA 1I8VA 1B21A 1DMMA 1K28A 3AMOA 1I0VA 4N6MA 3VSYA 2H0GA 4I5QA 1O7WB 1PU4A 1KD14 2CG1A 1CYUA 1CYVA 3C0OA 1DMNA 5DREA 2A15A 1ZS7A 2OQEA 2ML6A 3SYUA 2W2CA 1FA3A 5IG0A 3CC73 2H0HA 1PREA 3V92A 4WFOA 4XBTA 2W9QA 1DVCA 1WMPA 1RMSA 1ZGXA 2XR8B 1RGHA 1GSPA 2STDA 1GMPA 2OTJ3 4R9KA 2OOVA 5AYSC 2XRXB 3K7CA 4HYZA 1TU5A 2JQ5A 7GSPA 4BL2A 3EC9A 5M18A 4HM0B 4O8SA 4GL6A 1GY5A 1W5ZA 2K3DA 2L4VA 2KAAA 1YJW3 1JZOA 4BU4A 1I70A 1Z1SA 2RNTA 1AQZA 1HZ1A 1JZDA 3T8UA 3SX1A 1BU4A 4HZ9B 4MMXB 9RNTA 5A0OB 4GSPA 4U13A 3CCM3 4EV2A 3B8LA 1N5HA 2BT3A 4O2HA 1VQQA 3NBJA 4DKIA 3DGMA 2F4YA 2HMKB 1IVXA 1SIIA 5KP3A 1K9M4 3EBYA 1T3BA 1OGXA 1A2KA 1AY7A 1UCLA 1MWSA 2CKFB 2E2VA 8RNTA 1TTOA 3FF2A 3BU4A 5LC7A 1GYBA 1AVLA 1UUWB 3B4PA 1D6YA 1QVG2 5ELJA 2J8XB 1B2MA 3V98A 2UGIA 2AAEA 1JKGB 1IQ8A 1HU9A 3NUVA 1JBRA 2CC3A 3BB9A 4EW5A 4WHAA 1BRNL 2IUKA 2F99A 1NNVA 3WR2A 3KZTA 3AHWA 3MHEA 1OCVA 3ZJXA 1JN5A 1OUNA 1UCIA 3K0ZA 3LXUX 5DRVA 1W02A 5AIGA 3EB8A 3NV0B 1GY7A 1GMQA 3UB1A 4ORLA 3NQZA 2HMLB 2BMRB 5IERA 1I0XA 4CDLA 3LMLA 2M7OA 1WMOA 5EQLA 2XSHB 4K1VA 1IQYA 5AIFA 2GXFA 1Z52A 3F7XA 3BLZA 5IG3A 1LQGC 3EBTA 3LH4A 1DVDA 2CFWA 1RGCA 2UX0A 3GAXA 1C54A 1GD4A 4MMYB 1R4YA 3CNXA 3K9MC 3FZWA 3G6E3 1QMAA 4K90B 1PYLA 3NX0A 3K5TA 1W3GA 3FKAA 2XGLA 2Z76A 4XBXA 3FH1A 1O7PB 3DZLA 3MYTA 4K1UA 3S27A 1KQS2 1LVNA 1ISKA 3RDEA 1UCJA 5CXOA 1X1YA 1SPUA 3PXMA 1W00A 1TJDA 5IG5A 5BVBA 4HOHA 3VF1A 5EEOA 2WO0A 4XDVA 4HZBB 1ZX2A 3SOYA 2CWVA 3ZFZA 1IVVA 3H51A 1RGLA 3BNDA 2SARA 1JV2B 3EJVA 1IT8A 1JB4A 1X1XA 4CJNA 3FG3A 1RHLA 2ZL8A 1OACA 2XF3A 3FLJA 4N6TA 1K41A 1I2EA 1YVSA 1B3SA 1LOYA 1TUHA 1JB2A 2GEYA 2RSXA 2XFTA 4KVHA 4MEIA 4N6V0 1TIJA 4BIRA 3DGLA 1WTHA 2PNCA 3B7CA 1BNIA 3NM7A 5ELUA 3X3YA 1RGKA 5AIHA 1Q864 1BRGA 1N8R4 1BNEA 5G2GA 1RN1A 2CG0A 1O7HB 1BSBA 1X1UA 1FGMA 4X2OA 3V99A 1RRHA 1O7GB 3RNTA 2BO9B 3NV0A 3CCQ3 3I0YA 1VQ53 1NB5I 2P0XA 1RNBA 1NJI4 2GBWB 2KF5A 3MG2A 1UUGB 2YFIB 1YNVX 2XSOB 3SLUA 5EVHA 4AKZA 3DGYA 1J2BA 2F5WA 1LOVA 2I9WA 2QA43 1KC84 3LTAA 1U5OA 3HZPA 2Y74A 4N6LA 4WYKB 2HOHA 7STDA 4J5KA 4BTWA 3QK9A 1CQSA 4L8OA 4R9LA 1B2UA 1GOUA 3D3LA 2ZDJA 1JB5A 4HM5B 4XBYA 3DXOA 1W4NA 1BRKA 2UUGC 3GSPA 3D9RA 1MOLA 1BNSA 1MNLA 1QAFA 1BIRA 3O8YA 1T5YA 3HIIA 4NREA 1OH0A 4KT3B 3DMCA 3ROBA 3N8BA 3QRDA 4FCZA 1Q824 4OUQA 4N6OB 1B27A 5D82A 4BL3A 1FGRA 3K63A 3S29A 5CLKA 4GHOA 1G0TA 3CPOA 2CWTA 4IPBA 1E3VA 1OPYA 4MMZB 1Q9EA 3F8XA 1UYJA 5AEWB 3CCV3 1K8A4 3SVAA 3HOHA 1V74A 2XEPA 1BUQA 3AHSA 1RGGA 2F98A 3DM8A 3EE1A 5IF6A 2B1XB 2KF4A 3UL5A 3EN1B 3U97A 1IU7A 3TDGA 1TFOA 3LTDA 2CH9A 1A2PA 3E99A 4JRFA 1LQMB 1SIHA 2GSPA 3UJMA 5BIRA 3CCR3 3OV4A 3WODG 3NBBA 1LRAA 3S28A 4RNZA 1OHPA 1ASKA 3HIGA 1A90A 3ZG5A 3N9HA 4HVNA 2P09A 1VQP3 2XGNA 2GU1A 7RNTA 4HM1B 2R4IA 1W3FA 1RDSA 1BNRA 3KCHA 3OWUA 1DETA 4BTXA 1M9GA 1W3AA 2CK3H 3PCSA 1FGOA 4KFDA 1VQ93 2YFLB 1Q814 1FYSA 3KE7A 1AVKA 1ZO2A 2W56A 4EYCA 1W2ZA 3CXC2 1QVF2 1X1WA 4IIAA 3G713 1IQXA 2R41A 3KFQC 1FGQA 4RNTA 3SEDA 1BRJA 1O7MB 4R1KA 1K734 5IEOA 4IT7A 2INXA 3HX8A 4HKVB 2IA7A 4FR9A 2IMJA 5RNTA 1A67A 1UI8A 3L0RA 1RSNA 3U1WA 1ULIB 3CD63 5BXQA 1AV4A 1EKMA 3F8HA 4H3UA 1STFI 1OF5B 3WA3A 2BIRA 2CFGA 4R4KA 1GOVA 1N8QA 1VZZA 3ZG0A 3LTBA 3SOAA 5IENA 5CF1A 4BTYA 3J7Yd 1VQK3 3HK4A 1BNGA 3FSDA 3G16A 1BANA 3CU3A 1R4CA 6GSPA 1HYFA 2FXTA 1E97A 2BMOB 3G4S3 1JRQA 1W7CA 1S723 3D79A 1DMQA 2XFSA 2GEXA 3OWYA 4GB5A 3STDA 4CCVA 3FG1A 1JJ22 3LOYA 3FCSB 1MWTA 4Q53A 1MWUA 5STDA 2V1LA 4EBGA 2BMQB 3D4AA 3Q1CA 4TX4A 1FGTA 2BU4A 5AYRB 5JPPA 4QWTA 1IYYA 4O02B 2W04A 2Y73A 3FF0A 3JUPA 2ZHXB 3CMA3 1MGWA 2AADA 2ZA4A 1MGRA 3LZAA 3MG3A 2KF6A 3M8CA 8CHOA 2CX1A 1WMNA 1YVBI 2QIYA 1JKGA 1VQO3 2KXGA 3Q3FA 1B2SA 1O7NB 3S5CA 5IG4A 1IK3A 2KRTA 3T0UA 3MKIA 1LNIA 3HI7A 3DGNA 4K61A 2CHCA 5IEPA 3X3ZA 1VQ83 1NB3I 3BIRA 1RN4A 2KCDA 2WGOA 2CW9A 1RRLA 4N6UA 3C0NA 3VGNA 3JUQA 2HMOB 3JUMA 3I553 3I563 3LT8A 1YJN3 4JF8A 3B4OA 3GZYB 3PGBA 2QGUA 1IVWA 5D81A 1OF5A 3NM2A 3CCE3 1NO3A 4HM4B 2W9PA 3ALAA 1RCKA 5TGNA 1FW7A 2CWUA 1YIJ3 1LXEA 2O3OA 2P38A 4NPBA 1VQL3 1T2HA 2E2TA 1IV7A 3F14A 2P05A 4CPKA 1SJWA 3X3XA 1V58A 1B2XA 2OCTA 4OVMA 5HOHA 2W03A 1A2VA 5KP4A 4LYLB 3AGOA 3G8ZA 1W6GA 2D42A 2O9UX 1KSIA 1QALA 4HM2B 2YFJB 3F40A 1VQM3 2OWPA 3NHXA 1JBTA 1VQ63 2RFRA 1YHQ3 2FGTA 2L1SA 4PEJA 3IJEB 5IW9A 1C7HA 3CCJ3 2IY2A 2B24B 1SARA 1DE3A 4MJDA 1T2IA 1I2FA 1RCLA 1Y4KA 2WOFA 1BUJA 3IMAB 6STDA 4KZ1A 1RGFA 3PYJA 1EEJA 2C11A 4STDA 1YI23 3MWZA 1GD3A 3EF8A 1NDOB 3ER7A 1M1K4 2HMMB 1U8CB 4KFEA 1EQKA 1QJGA 3SXXA 5AEUB 4J8TA 5FW5A 3DY5A 3BNCA 4ILFA 3F7SA 1UUVB 1WQLB 2CFLA 2E2UA 2ML5A 1Q42A 1EG9B 2XH9A 3AGNA 1IT7A 3EHCA 5AI1A 1BSCA 1EUIC 1OHOA 3KSPA 1N9JA 1NU3A 2LYXA 4L7KA 3WOFB 5D83A 4EC6A 4EXRA 4FMCA 3D5IA 4RNYA 1F8NA 5GSPA 3Q90A 4I4KA 4HM7B 4WYKA 1B2ZA 3MG1A 1TRQA 4HM8B 2LQVA 3DUKA 3IPTA 3BNEA 4XB5A 4H61A 1RN7A 1UDII 1TFKA 5CK6A 4ZM8A 3CCU3 1IDPA 5AIIA 1G96A 3D5GA 1YGWA 4LSOA 3GZBA 4XM4A 1GS3A 2KF3A 1UGHI 3G4OA 3CC43 5CF2A 4HM6B 3A5EA 3URPA 3LTCA 4LMIA 1RGEA 3PS8A 1CH0A 1HKXA 1MWRA 5G1LA 3CPW2 3OW22 3A76A 6RNTA 1RNTA 2SBLA 1RGAA 4XDWA 3WHOA 1W6CA 4G1MB 2PZVA 1BNJA 1LOXA 3DGOA
chains in the Genus database with same CATH topology
3LT9A 2FNQA 3EQQB 2D1WA 4O3VA 1IVUA 3CNMA 1NWWA 2F86B 1D6ZA 3X41A 1E3RA 1QAKA 2P0MA 4OK0A 1KWIA 3FG4A 4FMBA 4X2HA 5JPUA 1LNHA 3H3HA 3T8NA 3GZXB 2CFKA 1RKYA 3GRDA 4HJLB 4N3VA 3CC23 3WA2X 1OGZA 2MC8A 3GWRA 4AKYA 4RZMA 1D6UA 3MSOA 3MPHA 4FCJA 4HM3B 1W2B2 3KSED 1UI7A 1DYUA 1SQWA 4AEQA 1N5PA 4HBRA 3JUOA 3CCL3 2WGQA 1YGEA 2Z77A 1JNQA 3OX9A 2BNGA 4N6NB 2C10A 1YJ93 1Q40B 1W01A 3OXAA 2GU3A 2OTL3 1EA2A 1N9EA 3NXJA 4FMDA 2CFDA 2HMJB 2Z7AA 2CIUA 1S5AA 3FGYA 3AMOB 1M904 3X40A 3NQYA 1Q7Y4 2K54A 3UL6A 1VQ43 3GZRA 1OHSA 3S67A 3F9SA 3CCS3 2HMNB 1YIT3 3Q2PA 4R80A 4LEHA 1ROAA 1UW1A 5JBSA 1W6YA 3OWSA 5LC6A 3G4NA 1WNHA 4LGQA 2IUJA 2Z6BA 4WP5A 3JVCA 1AR0A 3WOEB 3RGAA 2OQEC 2W6JH 2GBXB 5FGOA 1STDA 2WOHA 3X42A 1US1A 5I97A 3N54B 4J9AA 3UNLA 3EN8A 3KN4A 1RJOA 2OOVC 3CME3 2MF7A 1L5GB 3WMDA 1PFPA 2YX9A 1ROVA 4NHFA 3JUNA 4FCMA 4RBNA 3BNBA 1TP6A 3NBRA 1VQ73 2K0MA 4L8PA 3KIIA 5HGRA 3RGRA 1GY6A 2Q07A 2QEX3 3PZWA 2JDIH 2RGQA 3ECFA 2RCDA 4KFFA 1CEWI 1VQN3 3LYGA 4EV5A 3G0KA 1M1XB 3WDGB 2BHMA 4FMAA 5KP1A 1IV9A 3C0MA 3PCRA 4WWUC 1Q40A 2W56B 2W0QA 1FUWA 1ULJB 3KKGA 3EX9A 4LZIA 1JN5B 4N6MA 4RNYA 1K28A 1DMMA 3AMOA 3VSYA 1PU4A 1CYUA 1O7WB 1KD14 2CG1A 1CYVA 3C0OA 1DMNA 5DREA 2A15A 2OQEA 2ML6A 1FA3A 2W2CA 5IG0A 3CC73 1PREA 3V92A 4WFOA 4XBTA 2W9QA 1DVCA 1WMPA 2XR8B 2STDA 2OTJ3 4R9KA 2OOVA 5AYSC 2XRXB 3K7CA 4HYZA 1TU5A 2JQ5A 3EC9A 4HM0B 4O8SA 4GL6A 1GY5A 1W5ZA 2L4VA 1YJW3 1Z1SA 3T8UA 3SX1A 4HZ9B 4MMXB 5A0OB 4U13A 3CCM3 4EV2A 3B8LA 1N5HA 2BT3A 4O2HA 3NBJA 3DGMA 2HMKB 1IVXA 1SIIA 5KP3A 1K9M4 3EBYA 1OGXA 1A2KA 2CKFB 2E2VA 3FF2A 5LC7A 1GYBA 1AVLA 1UUWB 3B4PA 1D6YA 1QVG2 5ELJA 3V98A 1JKGB 1IQ8A 1HU9A 3NUVA 2CC3A 3BB9A 4WHAA 2IUKA 2F99A 3KZTA 3MHEA 1OCVA 3ZJXA 1JN5A 1OUNA 3K0ZA 3LXUX 5DRVA 1W02A 5AIGA 3EB8A 3NV0B 1GY7A 3UB1A 4ORLA 3NQZA 2HMLB 2BMRB 5IERA 4CDLA 3LMLA 2M7OA 1WMOA 5EQLA 2XSHB 4K1VA 1IQYA 5AIFA 2GXFA 1Z52A 3F7XA 3BLZA 5IG3A 3EBTA 3LH4A 1DVDA 2CFWA 2UX0A 3GAXA 1GD4A 4MMYB 3CNXA 3K9MC 3FZWA 3G6E3 1QMAA 4K90B 3NX0A 3K5TA 1W3GA 3FKAA 2XGLA 2Z76A 4XBXA 3FH1A 1O7PB 3DZLA 3MYTA 4K1UA 3S27A 1KQS2 1LVNA 1ISKA 3RDEA 5CXOA 1SPUA 3PXMA 1W00A 5IG5A 5BVBA 3VF1A 5EEOA 2WO0A 4XDVA 4HZBB 1ZX2A 3SOYA 2CWVA 1IVVA 3H51A 3BNDA 3EJVA 1JV2B 1IT8A 1JB4A 3FG3A 2ZL8A 1OACA 2XF3A 3FLJA 4N6TA 1K41A 2GEYA 4KVHA 1TUHA 2RSXA 1JB2A 2XFTA 4MEIA 4N6V0 1TIJA 3DGLA 1WTHA 2PNCA 3B7CA 3NM7A 5ELUA 3X3YA 5AIHA 1Q864 1N8R4 5G2GA 2CG0A 1O7HB 1FGMA 4X2OA 3V99A 1RRHA 1O7GB 2BO9B 3NV0A 3CCQ3 3I0YA 1VQ53 1NB5I 2P0XA 1NJI4 2GBWB 3MG2A 2YFIB 2XSOB 3SLUA 5EVHA 4AKZA 1J2BA 2I9WA 2QA43 1KC84 3LTAA 1U5OA 3HZPA 2Y74A 4N6LA 4WYKB 7STDA 4BTWA 3QK9A 1CQSA 4L8OA 4R9LA 3D3LA 2ZDJA 1JB5A 4HM5B 4XBYA 3DXOA 1W4NA 3D9RA 1MOLA 1MNLA 1QAFA 3O8YA 1T5YA 3HIIA 4NREA 1OH0A 3DMCA 3ROBA 3N8BA 3QRDA 4FCZA 1Q824 4OUQA 4N6OB 5D82A 1FGRA 3K63A 3S29A 5CLKA 3CPOA 2CWTA 4IPBA 1E3VA 1OPYA 4MMZB 1QVF2 3F8XA 1UYJA 5AEWB 3CCV3 1K8A4 3SVAA 1V74A 2XEPA 1BUQA 2F98A 3DM8A 3EE1A 5IF6A 2B1XB 3UL5A 3EN1B 3U97A 1IU7A 3TDGA 1TFOA 3LTDA 2CH9A 4JRFA 3E99A 3UJMA 3CCR3 1SIHA 1S723 3OV4A 3WODG 3NBBA 3S28A 4RNZA 1OHPA 1ASKA 3HIGA 1A90A 3N9HA 4HVNA 2P09A 1VQP3 2XGNA 2GU1A 4HM1B 2R4IA 1W3FA 3OWUA 4BTXA 1M9GA 1W3AA 2CK3H 3PCSA 1FGOA 4KFDA 1VQ93 2YFLB 1Q814 3KE7A 1AVKA 1ZO2A 2W56A 4EYCA 1W2ZA 3CXC2 4IIAA 3G713 1IQXA 3KFQC 1FGQA 3SEDA 1O7MB 4R1KA 1K734 5IEOA 4IT7A 2INXA 3HX8A 4HKVB 2IA7A 4FR9A 2IMJA 1A67A 1UI8A 3L0RA 3U1WA 1ULIB 3CD63 5BXQA 1AV4A 1EKMA 3F8HA 4H3UA 1STFI 1OF5B 3WA3A 2CFGA 4R4KA 1N8QA 1VZZA 3LTBA 3SOAA 5IENA 5CF1A 4BTYA 3J7Yd 1VQK3 3HK4A 3FSDA 3G16A 3CU3A 1R4CA 2FXTA 1E97A 2BMOB 3G4S3 1JRQA 1W7CA 4CCVA 1DMQA 2XFSA 2GEXA 3OWYA 4GB5A 3STDA 3FG1A 1JJ22 3LOYA 3FCSB 4Q53A 4EBGA 5STDA 2V1LA 2BMQB 3Q1CA 4TX4A 1FGTA 5AYRB 5JPPA 4QWTA 4O02B 2W04A 2Y73A 3FF0A 3JUPA 3CMA3 3LZAA 3MG3A 3M8CA 8CHOA 1WMNA 1YVBI 2QIYA 1JKGA 1VQO3 2KXGA 3S5CA 1O7NB 5IG4A 1IK3A 2KRTA 3T0UA 3MKIA 3HI7A 4K61A 3DGNA 2CHCA 5IEPA 3X3ZA 1VQ83 1NB3I 2KCDA 2WGOA 2CW9A 1RRLA 4N6UA 3C0NA 3VGNA 3JUQA 2HMOB 3JUMA 3I553 3I563 3LT8A 1YJN3 4JF8A 3B4OA 3GZYB 3PGBA 2QGUA 1IVWA 5D81A 1OF5A 3NM2A 3CCE3 1NO3A 4HM4B 2W9PA 3ALAA 5TGNA 2CWUA 1YIJ3 1LXEA 2O3OA 2P38A 1VQL3 2E2TA 1IV7A 3F14A 2P05A 1SJWA 3X3XA 2OCTA 4OVMA 2W03A 1A2VA 5KP4A 3G8ZA 1W6GA 2D42A 2O9UX 1KSIA 1QALA 4HM2B 2YFJB 3F40A 1VQM3 2OWPA 3NHXA 1VQ63 2RFRA 1YHQ3 2FGTA 4PEJA 3IJEB 5IW9A 1C7HA 3CCJ3 2B24B 4MJDA 1Y4KA 2WOFA 3IMAB 6STDA 4KZ1A 3PYJA 4STDA 2C11A 1YI23 3MWZA 1GD3A 3EF8A 1NDOB 3ER7A 1M1K4 2HMMB 1U8CB 4KFEA 1EQKA 1QJGA 3SXXA 5AEUB 4J8TA 5FW5A 3DY5A 3BNCA 3F7SA 1UUVB 1WQLB 2CFLA 2E2UA 2ML5A 1Q42A 1EG9B 2XH9A 1IT7A 3EHCA 5AI1A 1OHOA 3KSPA 1N9JA 1NU3A 2LYXA 4L7KA 3WOFB 5D83A 4EC6A 4EXRA 4FMCA 1F8NA 3Q90A 4I4KA 4HM7B 4WYKA 3MG1A 4HM8B 2LQVA 3DUKA 3IPTA 3BNEA 4XB5A 4H61A 1RN7A 4ZM8A 1TFKA 5CK6A 3CCU3 1IDPA 5AIIA 1G96A 4LSOA 3GZBA 4XM4A 1GS3A 3G4OA 3CC43 5CF2A 4HM6B 3LTCA 4LMIA 3PS8A 1HKXA 3CPW2 3OW22 3A76A 2SBLA 4XDWA 1W6CA 4G1MB 2PZVA 1LOXA 3DGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D42 A;  1W3G A;  1W3F A;  1Z52 A;  3C0O A;  3C0N A;  3G4N A;  3G4O A;  1UYJ A;  3C0M A;  1W3A A;  1PRE A;  3ZJX A; 
#chains in the Genus database with same CATH topology
 3LT9 A;  2FNQ A;  1BRH A;  3EQQ B;  2D1W A;  4O3V A;  1IVU A;  3CNM A;  1RLS A;  1NWW A;  2F86 B;  1D6Z A;  3X41 A;  1E3R A;  1Q7H A;  1QAK A;  2P0M A;  4OK0 A;  1KWI A;  3FG4 A;  4FMB A;  4X2H A;  5JPU A;  1LNH A;  3H3H A;  1I2G A;  1BVI A;  1FUT A;  3GZX B;  1G02 A;  2CFK A;  3T8N A;  1RKY A;  3GRD A;  4HJL B;  4N3V A;  3CC2 3;  3WA2 X;  1OGZ A;  2CX0 A;  1GOY A;  3GWR A;  2MC8 A;  4RZM A;  4AKY A;  1D6U A;  3MSO A;  1GMR A;  1JBS A;  3MPH A;  4FCJ A;  4HAA A;  4HM3 B;  1W2B 2;  3KSE D;  1UI7 A;  1DYU A;  1SQW A;  4AEQ A;  1N5P A;  4HBR A;  3JUO A;  3CCL 3;  2WGQ A;  1BGS A;  5G1K A;  1BRI A;  1YGE A;  1JNQ A;  2Z77 A;  2RBI A;  3OX9 A;  2BNG A;  4N6N B;  2C10 A;  1YJ9 3;  2F5M A;  1Q40 B;  1W01 A;  2C4B A;  3OXA A;  2GU3 A;  5BU4 A;  1EA2 A;  2OTL 3;  1N9E A;  3NXJ A;  4FMD A;  2CFD A;  2HMJ B;  2Z7A A;  2CIU A;  1S5A A;  3FGY A;  1BAO A;  3AMO B;  1M90 4;  3X40 A;  3NQY A;  1Q7Y 4;  2K54 A;  3UL6 A;  1VQ4 3;  3GZR A;  1OHS A;  1BNF A;  3S67 A;  3F9S A;  3CCS 3;  1BRS A;  2HMN B;  1YIT 3;  3Q2P A;  4R80 A;  4LEH A;  1BSA A;  1ROA A;  1TRP A;  1FZU A;  1UW1 A;  5JBS A;  1W6Y A;  3OWS A;  5LC6 A;  3G4N A;  1WNH A;  2F56 A;  4LGQ A;  2IUJ A;  2Z6B A;  4WP5 A;  3JVC A;  1RTU A;  1AR0 A;  3WOE B;  3RGA A;  1UCK A;  2OQE C;  2W6J H;  2GBX B;  5FGO A;  1STD A;  2WOH A;  3X42 A;  1US1 A;  5I97 A;  3N54 B;  4J9A A;  3UNL A;  3EN8 A;  3KN4 A;  1RJO A;  2OOV C;  5M1A A;  3CME 3;  1B20 A;  1UGI A;  2MF7 A;  1L5G B;  3WMD A;  1BSD A;  1PFP A;  2YX9 A;  1BOX A;  1ROV A;  3JUN A;  4FCM A;  4NHF A;  3BNB A;  4RBN A;  1TP6 A;  3NBR A;  1VQ7 3;  2K0M A;  4L8P A;  3KII A;  5HGR A;  3RGR A;  5M19 A;  1BSE A;  1LOW A;  1GY6 A;  2Q07 A;  2QEX 3;  3PZW A;  2IYJ A;  1V57 A;  2JDI H;  2RGQ A;  3ECF A;  2RCD A;  4KFF A;  1CEW I;  1VQN 3;  3LYG A;  4EV5 A;  3G0K A;  1M1X B;  3WDG B;  1I3F A;  2BHM A;  4FMA A;  1I3I A;  5KP1 A;  3DH2 A;  1IV9 A;  3C0M A;  3PCR A;  4WWU C;  1Q40 A;  2W56 B;  2W0Q A;  1FUW A;  1ULJ B;  3KKG A;  4J5G A;  3EX9 A;  4LZI A;  1FUS A;  1JN5 B;  1PY3 A;  2H0I A;  1I8V A;  1B21 A;  1DMM A;  1K28 A;  3AMO A;  1I0V A;  4N6M A;  3VSY A;  2H0G A;  4I5Q A;  1O7W B;  1PU4 A;  1KD1 4;  2CG1 A;  1CYU A;  1CYV A;  3C0O A;  1DMN A;  5DRE A;  2A15 A;  1ZS7 A;  2OQE A;  2ML6 A;  3SYU A;  2W2C A;  1FA3 A;  5IG0 A;  3CC7 3;  2H0H A;  1PRE A;  3V92 A;  4WFO A;  4XBT A;  2W9Q A;  1DVC A;  1WMP A;  1RMS A;  1ZGX A;  2XR8 B;  1RGH A;  1GSP A;  2STD A;  1GMP A;  2OTJ 3;  4R9K A;  2OOV A;  5AYS C;  2XRX B;  3K7C A;  4HYZ A;  1TU5 A;  2JQ5 A;  7GSP A;  4BL2 A;  3EC9 A;  5M18 A;  4HM0 B;  4O8S A;  4GL6 A;  1GY5 A;  1W5Z A;  2K3D A;  2L4V A;  2KAA A;  1YJW 3;  1JZO A;  4BU4 A;  1I70 A;  1Z1S A;  2RNT A;  1AQZ A;  1HZ1 A;  1JZD A;  3T8U A;  3SX1 A;  1BU4 A;  4HZ9 B;  4MMX B;  9RNT A;  5A0O B;  4GSP A;  4U13 A;  3CCM 3;  4EV2 A;  3B8L A;  1N5H A;  2BT3 A;  4O2H A;  1VQQ A;  3NBJ A;  4DKI A;  3DGM A;  2F4Y A;  2HMK B;  1IVX A;  1SII A;  5KP3 A;  1K9M 4;  3EBY A;  1T3B A;  1OGX A;  1A2K A;  1AY7 A;  1UCL A;  1MWS A;  2CKF B;  2E2V A;  8RNT A;  1TTO A;  3FF2 A;  3BU4 A;  5LC7 A;  1GYB A;  1AVL A;  1UUW B;  3B4P A;  1D6Y A;  1QVG 2;  5ELJ A;  2J8X B;  1B2M A;  3V98 A;  2UGI A;  2AAE A;  1JKG B;  1IQ8 A;  1HU9 A;  3NUV A;  1JBR A;  2CC3 A;  3BB9 A;  4EW5 A;  4WHA A;  1BRN L;  2IUK A;  2F99 A;  1NNV A;  3WR2 A;  3KZT A;  3AHW A;  3MHE A;  1OCV A;  3ZJX A;  1JN5 A;  1OUN A;  1UCI A;  3K0Z A;  3LXU X;  5DRV A;  1W02 A;  5AIG A;  3EB8 A;  3NV0 B;  1GY7 A;  1GMQ A;  3UB1 A;  4ORL A;  3NQZ A;  2HML B;  2BMR B;  5IER A;  1I0X A;  4CDL A;  3LML A;  2M7O A;  1WMO A;  5EQL A;  2XSH B;  4K1V A;  1IQY A;  5AIF A;  2GXF A;  1Z52 A;  3F7X A;  3BLZ A;  5IG3 A;  1LQG C;  3EBT A;  3LH4 A;  1DVD A;  2CFW A;  1RGC A;  2UX0 A;  3GAX A;  1C54 A;  1GD4 A;  4MMY B;  1R4Y A;  3CNX A;  3K9M C;  3FZW A;  3G6E 3;  1QMA A;  4K90 B;  1PYL A;  3NX0 A;  3K5T A;  1W3G A;  3FKA A;  2XGL A;  2Z76 A;  4XBX A;  3FH1 A;  1O7P B;  3DZL A;  3MYT A;  4K1U A;  3S27 A;  1KQS 2;  1LVN A;  1ISK A;  3RDE A;  1UCJ A;  5CXO A;  1X1Y A;  1SPU A;  3PXM A;  1W00 A;  1TJD A;  5IG5 A;  5BVB A;  4HOH A;  3VF1 A;  5EEO A;  2WO0 A;  4XDV A;  4HZB B;  1ZX2 A;  3SOY A;  2CWV A;  3ZFZ A;  1IVV A;  3H51 A;  1RGL A;  3BND A;  2SAR A;  1JV2 B;  3EJV A;  1IT8 A;  1JB4 A;  1X1X A;  4CJN A;  3FG3 A;  1RHL A;  2ZL8 A;  1OAC A;  2XF3 A;  3FLJ A;  4N6T A;  1K41 A;  1I2E A;  1YVS A;  1B3S A;  1LOY A;  1TUH A;  1JB2 A;  2GEY A;  2RSX A;  2XFT A;  4KVH A;  4MEI A;  4N6V 0;  1TIJ A;  4BIR A;  3DGL A;  1WTH A;  2PNC A;  3B7C A;  1BNI A;  3NM7 A;  5ELU A;  3X3Y A;  1RGK A;  5AIH A;  1Q86 4;  1BRG A;  1N8R 4;  1BNE A;  5G2G A;  1RN1 A;  2CG0 A;  1O7H B;  1BSB A;  1X1U A;  1FGM A;  4X2O A;  3V99 A;  1RRH A;  1O7G B;  3RNT A;  2BO9 B;  3NV0 A;  3CCQ 3;  3I0Y A;  1VQ5 3;  1NB5 I;  2P0X A;  1RNB A;  1NJI 4;  2GBW B;  2KF5 A;  3MG2 A;  1UUG B;  2YFI B;  1YNV X;  2XSO B;  3SLU A;  5EVH A;  4AKZ A;  3DGY A;  1J2B A;  2F5W A;  1LOV A;  2I9W A;  2QA4 3;  1KC8 4;  3LTA A;  1U5O A;  3HZP A;  2Y74 A;  4N6L A;  4WYK B;  2HOH A;  7STD A;  4J5K A;  4BTW A;  3QK9 A;  1CQS A;  4L8O A;  4R9L A;  1B2U A;  1GOU A;  3D3L A;  2ZDJ A;  1JB5 A;  4HM5 B;  4XBY A;  3DXO A;  1W4N A;  1BRK A;  2UUG C;  3GSP A;  3D9R A;  1MOL A;  1BNS A;  1MNL A;  1QAF A;  1BIR A;  3O8Y A;  1T5Y A;  3HII A;  4NRE A;  1OH0 A;  4KT3 B;  3DMC A;  3ROB A;  3N8B A;  3QRD A;  4FCZ A;  1Q82 4;  4OUQ A;  4N6O B;  1B27 A;  5D82 A;  4BL3 A;  1FGR A;  3K63 A;  3S29 A;  5CLK A;  4GHO A;  1G0T A;  3CPO A;  2CWT A;  4IPB A;  1E3V A;  1OPY A;  4MMZ B;  1Q9E A;  3F8X A;  1UYJ A;  5AEW B;  3CCV 3;  1K8A 4;  3SVA A;  3HOH A;  1V74 A;  2XEP A;  1BUQ A;  3AHS A;  1RGG A;  2F98 A;  3DM8 A;  3EE1 A;  5IF6 A;  2B1X B;  2KF4 A;  3UL5 A;  3EN1 B;  3U97 A;  1IU7 A;  3TDG A;  1TFO A;  3LTD A;  2CH9 A;  1A2P A;  3E99 A;  4JRF A;  1LQM B;  1SIH A;  2GSP A;  3UJM A;  5BIR A;  3CCR 3;  3OV4 A;  3WOD G;  3NBB A;  1LRA A;  3S28 A;  4RNZ A;  1OHP A;  1ASK A;  3HIG A;  1A90 A;  3ZG5 A;  3N9H A;  4HVN A;  2P09 A;  1VQP 3;  2XGN A;  2GU1 A;  7RNT A;  4HM1 B;  2R4I A;  1W3F A;  1RDS A;  1BNR A;  3KCH A;  3OWU A;  1DET A;  4BTX A;  1M9G A;  1W3A A;  2CK3 H;  3PCS A;  1FGO A;  4KFD A;  1VQ9 3;  2YFL B;  1Q81 4;  1FYS A;  3KE7 A;  1AVK A;  1ZO2 A;  2W56 A;  4EYC A;  1W2Z A;  3CXC 2;  1QVF 2;  1X1W A;  4IIA A;  3G71 3;  1IQX A;  2R41 A;  3KFQ C;  1FGQ A;  4RNT A;  3SED A;  1BRJ A;  1O7M B;  4R1K A;  1K73 4;  5IEO A;  4IT7 A;  2INX A;  3HX8 A;  4HKV B;  2IA7 A;  4FR9 A;  2IMJ A;  5RNT A;  1A67 A;  1UI8 A;  3L0R A;  1RSN A;  3U1W A;  1ULI B;  3CD6 3;  5BXQ A;  1AV4 A;  1EKM A;  3F8H A;  4H3U A;  1STF I;  1OF5 B;  3WA3 A;  2BIR A;  2CFG A;  4R4K A;  1GOV A;  1N8Q A;  1VZZ A;  3ZG0 A;  3LTB A;  3SOA A;  5IEN A;  5CF1 A;  4BTY A;  3J7Y d;  1VQK 3;  3HK4 A;  1BNG A;  3FSD A;  3G16 A;  1BAN A;  3CU3 A;  1R4C A;  6GSP A;  1HYF A;  2FXT A;  1E97 A;  2BMO B;  3G4S 3;  1JRQ A;  1W7C A;  1S72 3;  3D79 A;  1DMQ A;  2XFS A;  2GEX A;  3OWY A;  4GB5 A;  3STD A;  4CCV A;  3FG1 A;  1JJ2 2;  3LOY A;  3FCS B;  1MWT A;  4Q53 A;  1MWU A;  5STD A;  2V1L A;  4EBG A;  2BMQ B;  3D4A A;  3Q1C A;  4TX4 A;  1FGT A;  2BU4 A;  5AYR B;  5JPP A;  4QWT A;  1IYY A;  4O02 B;  2W04 A;  2Y73 A;  3FF0 A;  3JUP A;  2ZHX B;  3CMA 3;  1MGW A;  2AAD A;  2ZA4 A;  1MGR A;  3LZA A;  3MG3 A;  2KF6 A;  3M8C A;  8CHO A;  2CX1 A;  1WMN A;  1YVB I;  2QIY A;  1JKG A;  1VQO 3;  2KXG A;  3Q3F A;  1B2S A;  1O7N B;  3S5C A;  5IG4 A;  1IK3 A;  2KRT A;  3T0U A;  3MKI A;  1LNI A;  3HI7 A;  3DGN A;  4K61 A;  2CHC A;  5IEP A;  3X3Z A;  1VQ8 3;  1NB3 I;  3BIR A;  1RN4 A;  2KCD A;  2WGO A;  2CW9 A;  1RRL A;  4N6U A;  3C0N A;  3VGN A;  3JUQ A;  2HMO B;  3JUM A;  3I55 3;  3I56 3;  3LT8 A;  1YJN 3;  4JF8 A;  3B4O A;  3GZY B;  3PGB A;  2QGU A;  1IVW A;  5D81 A;  1OF5 A;  3NM2 A;  3CCE 3;  1NO3 A;  4HM4 B;  2W9P A;  3ALA A;  1RCK A;  5TGN A;  1FW7 A;  2CWU A;  1YIJ 3;  1LXE A;  2O3O A;  2P38 A;  4NPB A;  1VQL 3;  1T2H A;  2E2T A;  1IV7 A;  3F14 A;  2P05 A;  4CPK A;  1SJW A;  3X3X A;  1V58 A;  1B2X A;  2OCT A;  4OVM A;  5HOH A;  2W03 A;  1A2V A;  5KP4 A;  4LYL B;  3AGO A;  3G8Z A;  1W6G A;  2D42 A;  2O9U X;  1KSI A;  1QAL A;  4HM2 B;  2YFJ B;  3F40 A;  1VQM 3;  2OWP A;  3NHX A;  1JBT A;  1VQ6 3;  2RFR A;  1YHQ 3;  2FGT A;  2L1S A;  4PEJ A;  3IJE B;  5IW9 A;  1C7H A;  3CCJ 3;  2IY2 A;  2B24 B;  1SAR A;  1DE3 A;  4MJD A;  1T2I A;  1I2F A;  1RCL A;  1Y4K A;  2WOF A;  1BUJ A;  3IMA B;  6STD A;  4KZ1 A;  1RGF A;  3PYJ A;  1EEJ A;  2C11 A;  4STD A;  1YI2 3;  3MWZ A;  1GD3 A;  3EF8 A;  1NDO B;  3ER7 A;  1M1K 4;  2HMM B;  1U8C B;  4KFE A;  1EQK A;  1QJG A;  3SXX A;  5AEU B;  4J8T A;  5FW5 A;  3DY5 A;  3BNC A;  4ILF A;  3F7S A;  1UUV B;  1WQL B;  2CFL A;  2E2U A;  2ML5 A;  1Q42 A;  1EG9 B;  2XH9 A;  3AGN A;  1IT7 A;  3EHC A;  5AI1 A;  1BSC A;  1EUI C;  1OHO A;  3KSP A;  1N9J A;  1NU3 A;  2LYX A;  4L7K A;  3WOF B;  5D83 A;  4EC6 A;  4EXR A;  4FMC A;  3D5I A;  4RNY A;  1F8N A;  5GSP A;  3Q90 A;  4I4K A;  4HM7 B;  4WYK A;  1B2Z A;  3MG1 A;  1TRQ A;  4HM8 B;  2LQV A;  3DUK A;  3IPT A;  3BNE A;  4XB5 A;  4H61 A;  1RN7 A;  1UDI I;  1TFK A;  5CK6 A;  4ZM8 A;  3CCU 3;  1IDP A;  5AII A;  1G96 A;  3D5G A;  1YGW A;  4LSO A;  3GZB A;  4XM4 A;  1GS3 A;  2KF3 A;  1UGH I;  3G4O A;  3CC4 3;  5CF2 A;  4HM6 B;  3A5E A;  3URP A;  3LTC A;  4LMI A;  1RGE A;  3PS8 A;  1CH0 A;  1HKX A;  1MWR A;  5G1L A;  3CPW 2;  3OW2 2;  3A76 A;  6RNT A;  1RNT A;  2SBL A;  1RGA A;  4XDW A;  3WHO A;  1W6C A;  4G1M B;  2PZV A;  1BNJ A;  1LOX A;  3DGO A; 
#chains in the Genus database with same CATH homology
 3LT9 A;  2FNQ A;  3EQQ B;  2D1W A;  4O3V A;  1IVU A;  3CNM A;  1NWW A;  2F86 B;  1D6Z A;  3X41 A;  1E3R A;  1QAK A;  2P0M A;  4OK0 A;  1KWI A;  3FG4 A;  4FMB A;  4X2H A;  5JPU A;  1LNH A;  3H3H A;  3T8N A;  3GZX B;  2CFK A;  1RKY A;  3GRD A;  4HJL B;  4N3V A;  3CC2 3;  3WA2 X;  1OGZ A;  2MC8 A;  3GWR A;  4AKY A;  4RZM A;  1D6U A;  3MSO A;  3MPH A;  4FCJ A;  4HM3 B;  1W2B 2;  3KSE D;  1UI7 A;  1DYU A;  1SQW A;  4AEQ A;  1N5P A;  4HBR A;  3JUO A;  3CCL 3;  2WGQ A;  1YGE A;  2Z77 A;  1JNQ A;  3OX9 A;  2BNG A;  4N6N B;  2C10 A;  1YJ9 3;  1Q40 B;  1W01 A;  3OXA A;  2GU3 A;  2OTL 3;  1EA2 A;  1N9E A;  3NXJ A;  4FMD A;  2CFD A;  2HMJ B;  2Z7A A;  2CIU A;  1S5A A;  3FGY A;  3AMO B;  1M90 4;  3X40 A;  3NQY A;  1Q7Y 4;  2K54 A;  3UL6 A;  1VQ4 3;  3GZR A;  1OHS A;  3S67 A;  3F9S A;  3CCS 3;  2HMN B;  1YIT 3;  3Q2P A;  4R80 A;  4LEH A;  1ROA A;  1UW1 A;  5JBS A;  1W6Y A;  3OWS A;  5LC6 A;  3G4N A;  1WNH A;  4LGQ A;  2IUJ A;  2Z6B A;  4WP5 A;  3JVC A;  1AR0 A;  3WOE B;  3RGA A;  2OQE C;  2W6J H;  2GBX B;  5FGO A;  1STD A;  2WOH A;  3X42 A;  1US1 A;  5I97 A;  3N54 B;  4J9A A;  3UNL A;  3EN8 A;  3KN4 A;  1RJO A;  2OOV C;  3CME 3;  2MF7 A;  1L5G B;  3WMD A;  1PFP A;  2YX9 A;  1ROV A;  4NHF A;  3JUN A;  4FCM A;  4RBN A;  3BNB A;  1TP6 A;  3NBR A;  1VQ7 3;  2K0M A;  4L8P A;  3KII A;  5HGR A;  3RGR A;  1GY6 A;  2Q07 A;  2QEX 3;  3PZW A;  2JDI H;  2RGQ A;  3ECF A;  2RCD A;  4KFF A;  1CEW I;  1VQN 3;  3LYG A;  4EV5 A;  3G0K A;  1M1X B;  3WDG B;  2BHM A;  4FMA A;  5KP1 A;  1IV9 A;  3C0M A;  3PCR A;  4WWU C;  1Q40 A;  2W56 B;  2W0Q A;  1FUW A;  1ULJ B;  3KKG A;  3EX9 A;  4LZI A;  1JN5 B;  4N6M A;  4RNY A;  1K28 A;  1DMM A;  3AMO A;  3VSY A;  1PU4 A;  1CYU A;  1O7W B;  1KD1 4;  2CG1 A;  1CYV A;  3C0O A;  1DMN A;  5DRE A;  2A15 A;  2OQE A;  2ML6 A;  1FA3 A;  2W2C A;  5IG0 A;  3CC7 3;  1PRE A;  3V92 A;  4WFO A;  4XBT A;  2W9Q A;  1DVC A;  1WMP A;  2XR8 B;  2STD A;  2OTJ 3;  4R9K A;  2OOV A;  5AYS C;  2XRX B;  3K7C A;  4HYZ A;  1TU5 A;  2JQ5 A;  3EC9 A;  4HM0 B;  4O8S A;  4GL6 A;  1GY5 A;  1W5Z A;  2L4V A;  1YJW 3;  1Z1S A;  3T8U A;  3SX1 A;  4HZ9 B;  4MMX B;  5A0O B;  4U13 A;  3CCM 3;  4EV2 A;  3B8L A;  1N5H A;  2BT3 A;  4O2H A;  3NBJ A;  3DGM A;  2HMK B;  1IVX A;  1SII A;  5KP3 A;  1K9M 4;  3EBY A;  1OGX A;  1A2K A;  2CKF B;  2E2V A;  3FF2 A;  5LC7 A;  1GYB A;  1AVL A;  1UUW B;  3B4P A;  1D6Y A;  1QVG 2;  5ELJ A;  3V98 A;  1JKG B;  1IQ8 A;  1HU9 A;  3NUV A;  2CC3 A;  3BB9 A;  4WHA A;  2IUK A;  2F99 A;  3KZT A;  3MHE A;  1OCV A;  3ZJX A;  1JN5 A;  1OUN A;  3K0Z A;  3LXU X;  5DRV A;  1W02 A;  5AIG A;  3EB8 A;  3NV0 B;  1GY7 A;  3UB1 A;  4ORL A;  3NQZ A;  2HML B;  2BMR B;  5IER A;  4CDL A;  3LML A;  2M7O A;  1WMO A;  5EQL A;  2XSH B;  4K1V A;  1IQY A;  5AIF A;  2GXF A;  1Z52 A;  3F7X A;  3BLZ A;  5IG3 A;  3EBT A;  3LH4 A;  1DVD A;  2CFW A;  2UX0 A;  3GAX A;  1GD4 A;  4MMY B;  3CNX A;  3K9M C;  3FZW A;  3G6E 3;  1QMA A;  4K90 B;  3NX0 A;  3K5T A;  1W3G A;  3FKA A;  2XGL A;  2Z76 A;  4XBX A;  3FH1 A;  1O7P B;  3DZL A;  3MYT A;  4K1U A;  3S27 A;  1KQS 2;  1LVN A;  1ISK A;  3RDE A;  5CXO A;  1SPU A;  3PXM A;  1W00 A;  5IG5 A;  5BVB A;  3VF1 A;  5EEO A;  2WO0 A;  4XDV A;  4HZB B;  1ZX2 A;  3SOY A;  2CWV A;  1IVV A;  3H51 A;  3BND A;  3EJV A;  1JV2 B;  1IT8 A;  1JB4 A;  3FG3 A;  2ZL8 A;  1OAC A;  2XF3 A;  3FLJ A;  4N6T A;  1K41 A;  2GEY A;  4KVH A;  1TUH A;  2RSX A;  1JB2 A;  2XFT A;  4MEI A;  4N6V 0;  1TIJ A;  3DGL A;  1WTH A;  2PNC A;  3B7C A;  3NM7 A;  5ELU A;  3X3Y A;  5AIH A;  1Q86 4;  1N8R 4;  5G2G A;  2CG0 A;  1O7H B;  1FGM A;  4X2O A;  3V99 A;  1RRH A;  1O7G B;  2BO9 B;  3NV0 A;  3CCQ 3;  3I0Y A;  1VQ5 3;  1NB5 I;  2P0X A;  1NJI 4;  2GBW B;  3MG2 A;  2YFI B;  2XSO B;  3SLU A;  5EVH A;  4AKZ A;  1J2B A;  2I9W A;  2QA4 3;  1KC8 4;  3LTA A;  1U5O A;  3HZP A;  2Y74 A;  4N6L A;  4WYK B;  7STD A;  4BTW A;  3QK9 A;  1CQS A;  4L8O A;  4R9L A;  3D3L A;  2ZDJ A;  1JB5 A;  4HM5 B;  4XBY A;  3DXO A;  1W4N A;  3D9R A;  1MOL A;  1MNL A;  1QAF A;  3O8Y A;  1T5Y A;  3HII A;  4NRE A;  1OH0 A;  3DMC A;  3ROB A;  3N8B A;  3QRD A;  4FCZ A;  1Q82 4;  4OUQ A;  4N6O B;  5D82 A;  1FGR A;  3K63 A;  3S29 A;  5CLK A;  3CPO A;  2CWT A;  4IPB A;  1E3V A;  1OPY A;  4MMZ B;  1QVF 2;  3F8X A;  1UYJ A;  5AEW B;  3CCV 3;  1K8A 4;  3SVA A;  1V74 A;  2XEP A;  1BUQ A;  2F98 A;  3DM8 A;  3EE1 A;  5IF6 A;  2B1X B;  3UL5 A;  3EN1 B;  3U97 A;  1IU7 A;  3TDG A;  1TFO A;  3LTD A;  2CH9 A;  4JRF A;  3E99 A;  3UJM A;  3CCR 3;  1SIH A;  1S72 3;  3OV4 A;  3WOD G;  3NBB A;  3S28 A;  4RNZ A;  1OHP A;  1ASK A;  3HIG A;  1A90 A;  3N9H A;  4HVN A;  2P09 A;  1VQP 3;  2XGN A;  2GU1 A;  4HM1 B;  2R4I A;  1W3F A;  3OWU A;  4BTX A;  1M9G A;  1W3A A;  2CK3 H;  3PCS A;  1FGO A;  4KFD A;  1VQ9 3;  2YFL B;  1Q81 4;  3KE7 A;  1AVK A;  1ZO2 A;  2W56 A;  4EYC A;  1W2Z A;  3CXC 2;  4IIA A;  3G71 3;  1IQX A;  3KFQ C;  1FGQ A;  3SED A;  1O7M B;  4R1K A;  1K73 4;  5IEO A;  4IT7 A;  2INX A;  3HX8 A;  4HKV B;  2IA7 A;  4FR9 A;  2IMJ A;  1A67 A;  1UI8 A;  3L0R A;  3U1W A;  1ULI B;  3CD6 3;  5BXQ A;  1AV4 A;  1EKM A;  3F8H A;  4H3U A;  1STF I;  1OF5 B;  3WA3 A;  2CFG A;  4R4K A;  1N8Q A;  1VZZ A;  3LTB A;  3SOA A;  5IEN A;  5CF1 A;  4BTY A;  3J7Y d;  1VQK 3;  3HK4 A;  3FSD A;  3G16 A;  3CU3 A;  1R4C A;  2FXT A;  1E97 A;  2BMO B;  3G4S 3;  1JRQ A;  1W7C A;  4CCV A;  1DMQ A;  2XFS A;  2GEX A;  3OWY A;  4GB5 A;  3STD A;  3FG1 A;  1JJ2 2;  3LOY A;  3FCS B;  4Q53 A;  4EBG A;  5STD A;  2V1L A;  2BMQ B;  3Q1C A;  4TX4 A;  1FGT A;  5AYR B;  5JPP A;  4QWT A;  4O02 B;  2W04 A;  2Y73 A;  3FF0 A;  3JUP A;  3CMA 3;  3LZA A;  3MG3 A;  3M8C A;  8CHO A;  1WMN A;  1YVB I;  2QIY A;  1JKG A;  1VQO 3;  2KXG A;  3S5C A;  1O7N B;  5IG4 A;  1IK3 A;  2KRT A;  3T0U A;  3MKI A;  3HI7 A;  4K61 A;  3DGN A;  2CHC A;  5IEP A;  3X3Z A;  1VQ8 3;  1NB3 I;  2KCD A;  2WGO A;  2CW9 A;  1RRL A;  4N6U A;  3C0N A;  3VGN A;  3JUQ A;  2HMO B;  3JUM A;  3I55 3;  3I56 3;  3LT8 A;  1YJN 3;  4JF8 A;  3B4O A;  3GZY B;  3PGB A;  2QGU A;  1IVW A;  5D81 A;  1OF5 A;  3NM2 A;  3CCE 3;  1NO3 A;  4HM4 B;  2W9P A;  3ALA A;  5TGN A;  2CWU A;  1YIJ 3;  1LXE A;  2O3O A;  2P38 A;  1VQL 3;  2E2T A;  1IV7 A;  3F14 A;  2P05 A;  1SJW A;  3X3X A;  2OCT A;  4OVM A;  2W03 A;  1A2V A;  5KP4 A;  3G8Z A;  1W6G A;  2D42 A;  2O9U X;  1KSI A;  1QAL A;  4HM2 B;  2YFJ B;  3F40 A;  1VQM 3;  2OWP A;  3NHX A;  1VQ6 3;  2RFR A;  1YHQ 3;  2FGT A;  4PEJ A;  3IJE B;  5IW9 A;  1C7H A;  3CCJ 3;  2B24 B;  4MJD A;  1Y4K A;  2WOF A;  3IMA B;  6STD A;  4KZ1 A;  3PYJ A;  4STD A;  2C11 A;  1YI2 3;  3MWZ A;  1GD3 A;  3EF8 A;  1NDO B;  3ER7 A;  1M1K 4;  2HMM B;  1U8C B;  4KFE A;  1EQK A;  1QJG A;  3SXX A;  5AEU B;  4J8T A;  5FW5 A;  3DY5 A;  3BNC A;  3F7S A;  1UUV B;  1WQL B;  2CFL A;  2E2U A;  2ML5 A;  1Q42 A;  1EG9 B;  2XH9 A;  1IT7 A;  3EHC A;  5AI1 A;  1OHO A;  3KSP A;  1N9J A;  1NU3 A;  2LYX A;  4L7K A;  3WOF B;  5D83 A;  4EC6 A;  4EXR A;  4FMC A;  1F8N A;  3Q90 A;  4I4K A;  4HM7 B;  4WYK A;  3MG1 A;  4HM8 B;  2LQV A;  3DUK A;  3IPT A;  3BNE A;  4XB5 A;  4H61 A;  1RN7 A;  4ZM8 A;  1TFK A;  5CK6 A;  3CCU 3;  1IDP A;  5AII A;  1G96 A;  4LSO A;  3GZB A;  4XM4 A;  1GS3 A;  3G4O A;  3CC4 3;  5CF2 A;  4HM6 B;  3LTC A;  4LMI A;  3PS8 A;  1HKX A;  3CPW 2;  3OW2 2;  3A76 A;  2SBL A;  4XDW A;  1W6C A;  4G1M B;  2PZV A;  1LOX A;  3DGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...