1BCPC

Binary complex of pertussis toxin and atp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
b'GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
C PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpC01
1S5BD 1LTID 3KLSX 4L6TB 3MC0B 1BCPB 1S5CD 3R2IA 2SEBD 2TSSA 3O13A 2QEJC 3BVMA 1EEID 1G8ZD 4RGMA 1BCPD 1RD9D 1LTTD 1HA5A 1ET9A 1PRTF 1Z52A 1BCPC 3C0MA 1FGBD 4C56C 5ELFA 4O1NA 1HXYD 1ESFA 1L0XB 3OWEB 5ELCA 1LTRD 1D5ZC 3BZDB 1SJED 2AQ2B 1FNWA 1TS2A 2XNAC 1SEBD 1TY2A 2J4XA 3GP7A 1FNUA 1RF2D 2WV6D 1CT1D 1FD7D 1I4GA 1LTGD 3SEBA 1PYWD 1M4VA 1SXTA 1AW7A 4RCOA 1PREA 1EU3A 1SE4A 3MFGA 2NTSA 4UDUC 1LT5D 1GOZA 4RFBA 2IPKD 4RGNA 4RHSA 1CHQD 2AQ1B 4RGTA 4TSSA 2O2LD 2NTTA 1PRTD 2RDGA 1PTOH 1CK1A 1DYQA 5I4DA 1I4HA 1KTKA 1S5ED 1EFID 1SJHD 2IJ0A 3DWPA 3G4NA 5ELDA 3BVGA 1V1PA 1PZID 2ICIA 5D3DA 1TS4A 1L0YB 1DJRD 5FKAC 1EEFD 1KLGD 2Z8LA 1HQRD 1PTOF 5D3IB 1RDPD 2R61A 1B1ZA 1PZJD 1JQYD 1EWCA 1LLRD 4RH6A 1JWUD 1LT3D 4OHJA 1JWSD 3DWAA 4DXGA 1F77A 2G9HD 1PRTB 1I4QA 2CHBD 3C0OA 3V05A 1UNSA 1ENFA 1LT6D 1S5FD 1I4XA 1UUPA 4RGOS 1JR0D 3CHBD 1KLUD 1TS5A 1BXTA 1QILA 2AQ3B 4DXFA 1PTOB 3R2TA 1RCVD 1V1PB 1CQVA 1PRTC 3W2DA 5ELBA 1EU4A 3DWQA 1MD2D 1SE2A 1JCKB 1LT4D 1PTOD 1LO5D 1ET6A 1CHPD 4L63B 1HTLD 2XRQD 1D5XC 1D6EC 2XN9C 3TSSA 1PTOC 3C0NA 1B44D 2XRSD 4K6LA 5ELEA 1D5MC 5TSSA 1BCPF 1FNVA 1I4PA 1LTSD 1SBBB 1T5XD 1LTBD 1S5DD 4ZYSA 1STEA 1TS3A 3URYA 2QILA 1V1OA 3R8BA 3BYTB 1SE3A 2RDHA 1XXGA 3EA6A 4Z9CB 1TY0A 3BVZA 4BWGB 1I4RA 3BYYB 3EFXD 5FK9C 3G4OA 1JWMD 1PZKD 1AN8A 4RHRA 1XTCD 1LTAD
chains in the Genus database with same CATH superfamily
1TWCH 3MC0B 2E2IB 2LXKA 1AE3A 3FKIG 4A93G 2PZUA 1EYDA 3HOWH 2RF4A 1WOCA 3C0MA 4H02A 1O7LA 3OHXC 3H3VH 1UE6A 1CTMA 2UUCL 1OXXK 2DNEA 3J80i 1SJED 1VQ7A 1TS2A 1MSHA 5GAGC 3PO3G 5K36G 3ONAB 4JPBW 1XMQL 1IW7C 2O4XA 4JI7L 4FF4A 1QB5D 2NVQH 1PH8A 1RF2D 3M3YH 3SEBA 1WYDA 1LTGD 1B4OA 5C0XJ 5J1ZA 4HJ5A 1EU3A 1K28A 2K50A 3PIOA 1SE8A 4F88A 2DNCA 3EVQA 3A5ZB 3M4QA 4MTKA 2RKSA 4A3JB 1FL0A 5I4DA 1GJXA 4AQYL 4DR6L 1LM0A 3BVGA 2JEAI 3K58A 1L0YB 2YTVA 1RDPD 2CW0D 4BBSG 1IBML 2A69C 4DV1L 2RSOA 4MTNA 2KENA 1XX8A 4V0BA 3TBIB 5IYBG 3TP7A 4KJOA 1O7YA 2A19A 4GNXA 1VCIA 2JA6B 2GA4B 3F1ZA 1UNSA 2UUBQ 5C0XI 4PZ8A 2Y0SB 4QY7A 1JORA 1K8AC 4J6HA 2D0PA 2ZT9C 2RSNA 4LF8L 4DV5L 4DR1Q 5ELNA 3W2DA 4DR7L 4A3EG 1RIPA 4GN3B 1JCKB 1LT4D 1QNUA 2F0FA 2B2WA 1O7IA 4MIUA 4C3HB 4OO1I 3NEMA 5M3FB 1STHA 3T16A 2VB3X 1D5MC 2L1BA 5LMNW 2MFIA 4KHPL 3HOYG 1M90C 2MPMA 4ME3A 1NCVA 4Q0FA 4JI4L 2OCEA 1QJOA 2FJ2A 1CZGA 1SAPA 3EFXD 4X3KA 1Q7YC 3J81E 4A3DG 3TZDA 3T1HQ 1SYGA 2R92B 4LWCA 3KLSX 2CKZB 4BBRH 3KK7A 3E0EA 3EN2A 1HFNA 2NVXH 1BUVT 3J81c 4FYDA 1JMCA 3FKIB 4C56C 4X62Q 4LFAL 3PCOB 1XMOQ 3T1YQ 3A8KE 2RCFA 1D5ZC 2EVBA 3CC2A 1I6HB 4HMIA 2H5XA 1GHKA 3CQZH 4TRDA 3PO3B 3GP7A 1G6PA 2EPBA 2RVLA 1FJGQ 3PUZA 2K14A 1SNQA 2NBFA 4UDUC 4K2KA 3PO2G 3EJIA 2F52A 1R4PB 1BBWA 3FPUB 2O2LD 2NTTA 1PRTD 1CKNB 1DOKA 3VYUA 1HNZQ 3G4NA 2I0QA 1Y8PB 3S24A 1HPCA 1VQ4A 3I4MH 5D3DA 3HP3A 5AJ3L 2N88A 3FPPA 4DFAA 3J7AF 5D3IB 3GTOH 5C4XB 1EY4A 2B29A 5CC4A 4LF9L 4BBSB 3S1MH 2WIIB 2AKWB 1RTOA 3A8JE 3I3CA 5J39A 1W2BA 3K7AH 1F2LA 1IXRA 2YU9B 5I2YA 5FOBB 2LMCB 1UWVA 5JAVA 1PV4A 3IFDA 1Y1VG 1PRTC 1HNWQ 3MFYA 1K9MC 4DUYL 1PLFA 1SN8A 4WJWA 1KD1C 4A3EB 2MO0A 2ZM6L 1ET6A 2AUKA 4FNFA 2ZJQA 3RMHA 1Q1EA 1X3EA 2NN6I 5FO7B 3K0XA 4DPGA 3SK5A 4FXKC 3VR2A 2QILA 5IWAQ 3HOYB 1I94L 3R8BA 4NXNL 3EA6A 5DM73 4EQNA 5DM63 1T9HA 4FDBA 3CCVA 5C3WA 2N3SA 4GNXC 1EL0A 5FLXL 2Q2HA 3ICEA 2CH4W 2HQLA 3ERSX 3S1QH 4A3DB 1W3SA 2PNHA 4LF5L 5J3BA 3JC66 4FXDA 1PRTF 3BZCA 1CKNA 2B2WC 3WWVA 4ABNA 1A8VA 1J6QA 4IALA 5HGQA 1E2ZA 2L4NA 1KQSA 4WJ4A 1PDQA 4NXML 3EIVA 3K57A 2E2DC 1NR4A 4E6IA 1IHZA 1D1KA 4CGYB 5KYLA 1WTXA 1SFOH 1GUNA 5I2XA 1GM5A 3NE5B 2MNAA 2E76C 1SNPA 3CCLA 2F4VL 3PO2B 2PI2E 5G3LD 4DR4Q 1UE7A 2A6EC 4B9XA 1JB3A 5BN3A 3UDIA 3D6WA 4IO9A 1IZ6A 1VQAA 5IE8A 4OL7A 5CORA 3K0YA 3NTIA 2VQFL 2M2LA 3NTHA 3VDYA 1EEFD 1PFNA 2HQEA 4X3TA 4X64Q 1N36Q 2E2IH 1GUGA 2Q8TA 4XDXA 1XJVA 1JJ2A 1PZJD 3A56A 2F0WA 2K7VA 2F1MA 3C1EA 4XQQA 2ZTEA 3CRLC 1X55A 4LFCL 3V05A 1JICA 4MZ9A 1IBLQ 4EQOA 1A6XA 3F2CA 3H91A 1OXUA 1WD1A 3Q24A 4UP7A 4B3RQ 1QILA 4DF7A 4PG3A 4FF2A 4R9WA 1E0BA 3FVQA 1BBXC 1XWEA 1Q82C 5FLMH 2K28A 3W1GA 4POFA 2K1BA 5EBDA 1O80A 1STAA 1SNOA 1Y1VB 5GAHC 2KCCA 1LO5D 3QO2A 2QKIC 2NZHA 1PH3A 1IL2A 3K81C 4P71A 1ENCA 4A3JH 1HZ9A 3LGJA 4BBRG 1SYCA 3CCQA 1LTSD 5LMNL 1SBBB 3NELA 2UXCL 1U9RA 1T5XD 3KF8B 4RA8A 2ALYB 2R7ZG 3HGBA 1IBKQ 4DU9A 1C9OA 1OXTA 4DV4Q 4Z9CB 4FF1A 2EY5A 3PF4A 2OQ0A 4ZCKA 2O5IC 2HCCA 2E2HB 4ZAIA 1CZWA 5A2QL 4M1UB 5FLXE 3I55A 5I9OA 4JOIA 1HNXQ 2F4IA 2JA6H 3D0FA 1TVXA 1LABA 4DUZL 3NQTA 3PMFA 1EEID 5T1IA 3HOUB 1BCPD 3SR1A 2XIWA 5G3LF 4A3BB 2CQOA 3S2HB 4GKKQ 4PZ6A 5FLXc 5ELFA 4RKLA 2UXDL 4LW1A 4K5XA 4OGQC 1LYLA 2EDGA 2DJGC 1GVPA 1H9SB 3CMAA 2EQSA 3L9AX 4JI8L 4C3HH 3ULLA 3RR5A 2E74C 1SEBD 4N8X1 5M3FH 2LKVA 4A3GG 5EQ0A 2X69A 1CT1D 2B2TA 2G9DA 4X3SA 1AW7A 4O42A 1U4MA 3IAYA 1J8IA 1N32Q 1ML0D 2EY6A 2GVAA 4L5QA 2OEOA 5GROA 3I72A 1B3AA 2ICIA 2AHOB 3AB9A 2R92H 4L5SA 2F03A 2IL8A 4LJZC 4GN5A 1GKHA 3DHQA 4RAUC 1L1OB 3S2DB 4IPCA 2DGYA 1K3BC 2IX0A 2F0OA 2PO4A 5CYUA 3SK4A 1QUQB 4KI0A 1SYEA 3FKIH 1YEZA 2ID0A 1F9PA 1S3OA 4ZKCB 3KF8A 1X65A 4N9PA 4IPDA 3J7YW 1I6HH 1BXTA 2F0TA 2K32A 1MGSA 3RZOB 2AQ3B 1HR0L 3WDNA 4ZQ3A 3PO3H 5K36H 5ELBA 1PFSA 4NB3A 1MD2D 1SE2A 4QGUA 3QG1A 3A7LA 4DKAC 1STBA 1QZHA 4JI2L 3M7NA 2KCNA 1EIGA 1JE4A 1DOLA 1K8GA 5EGTA 3BDLA 2OTJA 1BCPF 5IGGA 1HCZA 3I91A 3OPOA 1TIID 1SLJA 1JT8A 4KHZA 1STEA 3NWSA 1P8LA 2NZ1D 1V1OA 1ESRA 4DK6C 1H9SA 3Q22A 4BY1B 3BYTB 4FP5D 4LF7L 2R7ZB 5C4XH 1MHWC 1QE6A 3NBHB 1Q86C 5IGCA 2KOLA 4KHVA 4BBSH 2RHSB 1VQ8A 1JWMD 2B8GA 2A6HD 4B3SQ 4RG1A 1FYCA 5IYBH 3TP8A 2SEBD 2QGQA 1HFGA 2TSSA 2YU9H 2Z0SA 2MJ8A 1D7QA 3FDTA 1SRUA 2HD3A 4UP8A 4YWMA 1ET9A 3OIQA 4K0KL 1ESFA 4DR3Q 3PQIA 4Y7NB 1E2VA 1X54A 3TP5A 2DY7A 4A3EH 1JB7A 1B53A 4B3TL 4KLKA 1L1OA 3VYRA 4X6AH 1WFQA 2XNAC 1J5EQ 2LXJA 4ZK9B 3I56A 2JA5B 2F0HA 5C0XG 3NSWA 3RZDB 2KHIA 2ZJPA 2N78A 4A3GB 3P20A 2RHQB 1QUQA 1R4QB 2L0CA 1QVGA 2A6HC 2O5JC 5E4WC 3HOYH 5GADC 4DV2Q 2K5WA 3CP0A 1A15A 4HIMA 1AZQA 3DUZA 4JOIC 3D4WA 2I5LX 4DAVA 1SJHD 4A76A 1JE5A 3P1HA 4JI3L 3HOZG 2JA9A 3F2DA 3W3AA 4A3DH 2UXBQ 1WCMB 1KLGD 3E5SA 4DV0Q 3D4RA 2PW7A 2HDMA 4UPAA 5FLMG 1S72A 4X65Q 1HZBA 1Y14B 3GTJB 4CDEC 2RDFA 5ISRA 1F2MA 1JWUD 4J15A 1LT3D 4HMJA 1HUMA 1EYAA 4IUQA 2JP1A 2F3IA 4A3JG 2HHHL 1KXLA 2B2TC 2EOTA 4RGOS 5JEAJ 1G51A 3KOJA 3NBHA 3PF5A 2EYFA 1GUSA 4BXXG 2F0EA 1BKBA 4DR2L 4CJ0B 5IT9E 1VQLA 1SNCA 2IW3A 1LUZA 1HTLD 2ICEC 2XRQD 1VQCA 3X3MA 1D6EC 4LMQD 2OF1A 3TSSA 1BO0A 1XNRQ 1BBUA 3PO2H 4K6LA 4C1NK 4OX9Q 2JJQA 1KDBA 4G4KA 2JK8A 3SHLA 1EOTA 1L2FA 5IGDA 3CPWA 3HRZC 3HKSA 1S5DD 1TS3A 2PZTA 1NUCA 2TMPA 1OXVA 1NNXA 4JYAQ 1SMYD 4CJ1B 1KHIA 3FRPB 1SR3A 1QNKA 3L2PA 3G4OA 4DK1A 1R9TB 4C3HG 3A54A 4P73A 5M3FG 1Q81C 2K05A 4JI5Q 2D9UA 1V8QA 2NZOA 2SNSA 4LF6Q 1H95A 3NHHA 4CDCC 4DV3Q 3DMUA 4POGA 4BS9A 1Y1VH 1L0XB 4B08A 2Z4IA 1IW7D 3CAMA 3HOVB 1X3GA 2KQ3A 3GTLB 1ICFB 3I4LA 1II3A 1KABA 2Z6KA 4BA2I 3Q23A 1X6OA 1FNUA 3U4VA 4CKEA 2EY1A 1SMXA 1NR2A 4P72A 1UAPA 1D8LA 4EGVA 5BR8L 3E9IA 2ZXRA 2K03A 2WKCA 3OSOA 5EAYA 2VUMB 2RDGA 1I4HA 1ZEQX 3I4OA 2E2HH 3DWPA 3VR3A 4NKLA 1HRJA 1GO3E 2E2JH 2UUCQ 4M8AA 2R3ZA 4ZKBB 1PZID 3G6EA 2A69D 2XGTA 2NN6G 2Z8LA 3HOZB 3STBC 1XMQQ 4JI7Q 3HOUH 1RKNA 4FVMA 2XWBB 4JI0Q 4A3BH 3S2HH 4KY7A 4JCVE 1B50A 3UE1A 1XPRA 1EY6A 1L1OC 1Z7TA 2SNMA 4BA1I 2L5TA 3CKIB 1KAAA 1K0SA 4LNQA 2BOSA 3VR6A 2DY8A 1K83B 3PUWA 3AFQA 1MJCA 4Q5VA 4LK1C 3CCMA 2D62A 2XTIA 2NYZD 2K5DA 1VQDA 3KDFB 4HJAA 2JA7G 1EU4A 5C4XG 1AEXA 4QUFA 1ICWA 1YHAA 5T1GA 4DV1Q 2XN9C 3C0NA 2WKDA 2B63B 1F2YA 1TU2B 1WI5A 4HCEA 3K80C 3TN2A 4KK7A 3RLFA 2E5LQ 2K5HA 3KFUA 1YIJA 1WTQA 1E7ZA 3S2DH 4LF8Q 1VQHA 4PMBA 3G4SA 4KKUA 3BVZA 5L37A 3D3RA 5CV9A 1VQEA 2VQEL 4OXPA 1XYIA 1VQ6A 3ITPA 2K33A 4NMZA 1LTID 1PMRA 3IL8A 3M4YA 2CWAA 5IYCG 4A3MB 2EJFC 4JI1L 1LTTD 3RZOH 4IFDJ 1C4QA 3MVVA 1VQJA 2YV5A 1D2BA 1GXDC 2F0DA 4JI4Q 3PUVA 1Y1WG 3KF6B 2VZAA 1C8CA 3EBEA 2KCTA 1ILPA 2N55A 4I65A 4JI6Q 4DK3C 3PV0A 3S1NB 4A3IG 1VQNA 4BY1H 3D4DA 2R7ZH 1RTNA 3GTKB 3U9SA 1IKLA 2JQOA 3HG9A 5DAUA 3C3LA 1BR9A 1WVLA 1YJ9A 1EQQA 3K5NA 1E1OA 3KDFA 4IFDI 1TWHB 3HS0C 4WJ3M 2EJMA 3WOFA 4C3JG 1DONA 2WAQG 1NAPA 4HIKA 2SDFA 3BDCA 1T5EA 4LFBQ 2K52A 4OHJA 3K7UC 1LTLA 3D31A 4R4OA 4OWTB 4HR7B 2I07B 2Z6KC 4X62L 4Y7NH 1XMOL 4RMFA 3S17B 1HZAA 3BDOA 1PTOB 1SDFA 2JA5H 3S16B 3TS0A 1CKMA 3RZDH 4A3GH 2PZWA 2BA0A 4UP9A 2JA7B 1EWIA 1PH9A 2H4OA 4LF9Q 1EOVA 2KHJA 4AYBG 3MXNB 1VQ5A 2R7DA 2WFWA 2IWHA 2WAQE 3I70A 2F0KA 1ENAA 1X3QA 2UU9L 2UUAL 3HEJA 4C2MB 2ZTCA 5COYA 1RJTA 5FJ8H 1HNZL 2MP1A 1XPOA 3K5LA 1WCMH 5IP7H 2HUGA 2A5HA 3KF6A 3GTJH 4HAEA 4NW2A 4DUYQ 2PCFB 1PZKD 4RHRA 1S5BD 2ZM6Q 2JXMB 1FVIA 3OTOL 2QF7A 5LL6S 3J80L 5HY6A 1YJWA 2ASBA 4QJFA 3N52A 4DAYB 2M00A 4LUOA 4AYBE 5JJZA 2EYMA 3CCUA 1KDCA 1KRSA 1MKHA 1CKOA 5CV4A 4B9WA 4PZ7A 1HXYD 4P74A 5JPMC 3PUYA 1HNWL 1I94Q 3ER0A 1XPUA 1Z47A 5C4JB 2R93G 1Y1WB 1HZCA 4HCSA 4QCLA 1QZGA 4GKJL 3HKZE 4YCVA 3HOUG 3PGZA 5J22A 4LF5Q 4YHHL 2YTYA 2A6ED 4A3BG 2IPKD 2AWNA 4IOAA 1B9NA 3TREA 1OO9B 5HGTA 4A3IB 3GD7A 1VQBA 2IJ0A 1QVCA 2KHSA 3G48A 5ELDA 1R9TH 4NXMQ 2GVBA 1I3QB 1DJRD 4ILWA 2OT2A 1GUWA 1MBYA 2R61A 1K73C 3MXNA 4HTHA 4C3JB 2FMCA 2I5HA 4IJLA 1STGA 2WAQB 4ULLA 3J7ZC 3U4ZA 4FF3A 5EKIA 1YI2A 1E24A 2CHBD 1ASYA 4ODGA 2AMCB 3GTQB 1YJNA 3D6CA 3CHBD 4MN3A 5CV8A 3GTLH 3MWYW 1AZPA 2VB2X 1XNQL 1X56A 2F0VA 3DWQA 1WTWA 5C0XH 4CDFC 4RCNA 3WOEA 1KNAA 1B44D 2XRSD 4WRDA 2VUMH 1K3RA 5TSSA 4H13C 4J1MA 4AYBB 5EKKA 3A7AB 2F3WA 4DAYA 5H1SE 4LFCQ 3CW2C 1SSOA 1KAWA 3R93A 4OO1H 3ULPA 3NBIA 3VYSA 1VQOA 4HJ8A 3HOZH 4KKTA 4QUCA 2R6GA 1VQFA 3PUXA 4KY6A 3VR5A 3NK9A 4ZLTF 1PYSB 3HKZB 5M5XB 3M4PA 4L6TB 2B2YA 3KUPA 1UEAB 3BVMA 1K83H 3IRBA 1IBLL 3J80E 3G6JB 2UXCQ 2FXQA 4U68A 1BF4A 4BY1G 4Y52H 3ERQA 5KIXA 1WTPA 1A63A 5GQOA 4BXXH 4KD4A 3MEHA 2CWPA 2AQ2B 1B7YB 3J80c 2B63H 2RA4A 3GV3A 4P2CB 2V1CC 5JOBA 3S1RB 2R93B 4KV6A 5LMUL 1EUJA 2K04A 2F0NA 1SE4A 4HIOA 1MI2A 4JBKA 5BN5A 4DK0A 4CKBA 4DUZQ 3LWUA 4XIGS 2B2UA 1CM9A 4LAAA 4UAIA 3U9OA 1CI3M 1TXYA 2KUMA 3FP9A 1Y8NB 1S5ED 1EFID 5JJKA 3KYHC 1EYGA 3JAMi 4KY5A 1X3FA 2CQAA 5FKAC 4JI8Q 2JA5G 5I9PA 4DV6Q 1EIYB 4A3MH 1HNXL 1JJGA 4XQJA 2J0TD 5M5WB 1SNDA 2HCIA 1X3PA 3PIP3 4A3KG 2CVRA 3DWAA 3I90A 4DXGA 4GKKL 1EQVA 2N49A 1Z9FA 1WTRA 4QMGA 4N8FA 5JEAG 1I6VC 4GLXA 4A3FB 1CSPA 2F0PA 5FJ8G 1AFPA 1G291 1PYBA 2FFKB 1WTHA 1WCMG 4JBJA 5IP7G 1EY5A 2LFNA 4O0AA 1CHPD 2JN4A 1EQRA 4YY3L 3AFPA 4DAMA 3S1NH 3Q6SA 1PTOC 2K01A 3BJUA 2V4DA 3CRKC 4C3IB 2WB1G 3GTKH 1G2SA 3DEPA 3SXHA 4LF4Q 1A3VA 3MXUA 1HTPA 5CV7A 3LNNA 1TWHH 4OIJA 3ULJA 5IYDG 1YNJC 1BOSA 2NN6H 1HR0Q 5IT9L 5FK9C 3ZJYC 1N34L 1F9RA 3TEHB 3C1FA 3PIPA 5CR3A 3KBGA 3GTPB 4HSPA 1S5CD 3H3VI 2JA8G 3KLWA 3O13A 3J81i 4IZ8A 5IGFA 2PI2A 3S17H 2L55A 1BQQT 1FGUA 1NJIC 3CCRA 3H09A 1Z52A 3S16H 2WB1E 2IT1A 4L8JA 4BY7G 2JA7H 4LF7Q 3A55A 1IKMA 5IY0A 3NXWA 1Q1BA 3OIPA 1S4ZA 1U4LA 1A3UA 2WINB 4K5VA 2WV6D 4WORA 4OELB 4R4TA 3HOXG 1PREA 4C2MH 3F2BA 4RFBA 4GZYC 2F0LA 5ELOA 2F0SA 3GTMB 2B2YC 4K0KQ 1KTKA 1PH6A 3HOVG 1AH9A 1A3TA 1Q90A 1OXSC 3F8TA 5IYCH 3HFZB 5EPLA 1VF7A 2NVYB 4JV5L 1O78A 1Q46A 2HT1A 2G9HD 2VUMG 4A3KB 2K5VA 2LSSA 5DEHA 1ENFA 1LT6D 3CCSA 5C4JH 1JR0D 1TS5A 4GOPB 1Y1WH 4OO1G 1J5EL 4JI3Q 4OWWB 1VQGA 4N9TA 2EYLA 2B2UC 1RL2A 2D0OA 5M5YB 4EVOA 3H0GB 2VL6A 4B3ML 1H9MA 4DV2L 3V96A 4LUZA 5CV5A 1I4PA 3RN2A 4A3IH 2QW7A 2WB1B 4JC0A 3URYA 1I3QH 1BVSA 2K5NA 3KBXA 2G5DA 1EZ6A 3SDZA 3Q0AA 4DV0L 1I4RA 5CMDA 3BYYB 1NBWA 2Z4HA 4C3JH 5LHY1 1PFMA 2IX3A 4F87A 1PH1A 1CSQA 5AFWA 2B63G 1G2TA 1FR3A 3OYYA 4PV1C 2QEJC 1YHQA 1KRTA 5D65A 3GTQH 2JA8B 4IFDG 1RHPA 1UEBA 2OTLA 3I4NG 3I7FA 5IT9c 1N33Q 3CCJA 1Q8KA 2EJGC 2Z9HA 4K5WA 4A3CH 4IUTA 1HA6A 4X66L 4ME5A 4LUVA 2EYPA 4BY7B 1VF5C 2EE1A 3EQLC 5C4HA 2VS1A 4OX9L 2C9OA 1ZXTA 4A3MG 1JOQA 1UE5A 2B2VA 1AP0A 2NTSA 3S9WA 1LT5D 2BDNA 4DR5L 3HOXB 3L0OA 1KIXA 3K5MA 4RGNA 4QF4A 2LY7A 4RHSA 2AWOA 4XQNA 3S14B 3GTGB 1E22A 1B70B 2F0MA 1CK1A 4QB4A 1EYCA 1QCBD 4GOPA 1CFMA 3OWFA 1CUKA 1K8OA 2DJFC 1SNMA 3STBD 5M5XH 4XT1B 3H6MA 1PXUA 3W1BA 3GV6A 4JBWA 4TVAB 1VS0A 4K8IA 1JQYD 4FO2A 4JI5L 4YWKA 2FMMA 1DGSA 1EWHA 3SK6A 2I5MX 1PH7A 4J8QA 4LF6L 3IFTA 4ALPA 5C3EG 3C0OA 4GLVB 2KJXA 4DV3L 3PIO3 1PFBA 1YNNC 2Y0SE 1DM0B 2F0GA 4ZUIA 1U0LA 4TKOB 3F2UA 4PQXA 3S1RH 2R93H 4OIKA 3QB3A 4DV7L 1PH4A 2BH2A 3UE0A 3UDGA 2LS01 1CQFA 4DAPA 4KD3A 4GLAC 3OMGA 1Q3LA 4IQZA 1F9SA 2VNUD 3AYHB 5M3MG 3GQBA 1HJPA 1X32A 1DD2A 2CCZA 3RD4A 1L0WA 1A2UA 4JG2A 1TWFB 1SE3A 3AQQA 3H15A 4OWXB 4AQYQ 1H9KA 4DR6Q 4KMUC 1TWGB 3QR8A 1WTVA 5M5WH 1UE1A 5F2DA 4S3SA 2BE5C 2VW9A 1XTCD 1C0AA 2A68C 4JI0L 3NQIA 4IPHA 4CBVA 1IBMQ 3KJOA 4G7HC 1JC7A 4L5TA 1N8RC 5C44G 1G8ZD 4RGMA 4A3FH 3C2PA 2PQEA 3NPPA 3JAME 3CC7A 1HA5A 1I5FA 2ZJRA 3X3NA 1FGBD 3I4NB 1NMGA 5JVG3 1SROA 3OWEB 2QA4A 2JE6I 3T51B 3RN5A 4H7BA 1PH5A 1FNWA 2OQKA 4DV5Q 3JAMc 1ZYRD 2EYJA 4DR7Q 4C3IH 1U4PA 4P75A 2VQEQ 1E3PA 5E1FA 1PYWD 2D2CC 1STNA 2M9VA 2RBMA 2P5ZX 4AH6A 3M4OB 2E5LL 2UUBL 2XWJB 1CHQD 4JI1Q 2MGSA 3ND8A 4TSSA 2EXZA 3TDQA 4KHPQ 5JJIA 3T56B 3P75A 2EIFA 3SVMA 2F0UA 5CBEE 4DR1L 1VQPA 3QJYA 1Y69U 1U4RA 1K0RA 1TS4A 3GTPH 1DOMA 2JEBI 2D5DA 2ENBA 4RH6A 1KDAA 4JW0A 1QVFA 1ZYRC 2CW0C 3FHWA 4PMCA 4MHEA 2JYOA 3MXGA 1A62A 1O7ZA 2FINB 2B39A 3DLLA 1YZ6A 5C3EB 4K14A 2A73B 3RLOA 2B2VC 4LFAQ 4DXFA 3ZYYX 4CDDC 3CCEA 1KL9A 5DNFA 4YIJA 4F8MA 3TMEA 1V43A 4A3LH 3T1HL 3S15B 2IX1A 4GOPC 2CH4A 1ZKOA 3BS1A 4JI6L 1QOHA 5M9OA 2F0QA 2I46A 3MAQA 3GTMH 4GS3A 3SE0A 3BZKA 3J7AV 5M3MB 3J81j 2Q8RE 4A93B 3T1YL 1C48A 5E4XA 1PA6A 4YCUA 5I6WA 4A3CG 2MO1A 3P7JA 3MEFA 3V2TA 3MXPA 5AJ3Q 2FHTA 2NVYH 4EQPA 2N8NA 3D8GA 1TKWB 1FJGL 4LFBL 1BCPB 4A3KH 3L3OC 2HIXA 2PQAB 2C35B 4XXEA 5C44B 1HUNA 5JEAH 2UU9Q 2L9HA 2UUAQ 1DCZA 3A74A 4FXGC 3TP6A 3I8ZA 3VA7A 1V9PA 1LTRD 4R4CA 5M5YH 5CV6A 2KEDA 5IP9H 5FO8B 3HKZG 3H0GH 4HSVA 2KBNA 3U50C 5EBCA 4KJNA 5A35A 4IUNA 2C5CA 3RNUA 4HJ7A 1IYJB 1M4VA 4IUUA 1ASZA 3VR4A 5KEEA 4A75A 3OTOQ 2ZXOA 4HIDA 2WP8J 4KN7C 4YWLA 1P16A 3MZ5A 4MNOA 2NB0A 3T4AC 3VYTA 5I6YA 5IYDH 2F0JA 1HR0W 2Q2UA 1X9NA 1GUTA 1XTDA 3T13A 4NXNQ 4R8NA 3E6ZX 2K6AA 4HN7A 4XYQA 4UHVA 1F9QA 2JA8H 5LL6X 2PPBC 2ATWA 3OW2A 4GKJQ 1VQ9A 1U5KA 4HEDA 4A4IA 4U673 4V190 4WFN3 4YHHQ 1I4QA 1I50B 5IWAL 3C46A 1I4XA 1VDZA 5IIFA 3HOWG 5HURA 4DGZA 4BY7H 3CXCA 3TQYA 3MTSA 1TWAB 5EPKA 1JOKA 2Q2IA 3IKJA 2B3GA 2IHEA 3QOLA 5E7NA 4IURA 4NDXA 3HOXH 1EY0A 1D5XC 1YNXA 3S14H 1A0IA 2PQAA 3GTGH 4CKCA 1Q8IA 4EQ5A 2K75A 3K5OA 4JVZA 5GAEC 5IOCA 2BH8A 2Q2TA 2F4VQ 1EZ8A 4A3FG 2VY3A 2MHVA 3HOVH 4XT3B 4DNIA 2QCPX 2K5QA 3A0JA 4O2DA 4IN3A 1XNQQ 1SYDA 3M85A 2VQFQ 1Y8OB 1V1QA 2EYHA 4RGTA 4C3IG 2QEXA 3UDFA 1ONLA 3CU7A 2KECA 2OWOA 3CF5A 3Q8DA 5D14A 1BDOA 4DR4L 2A1AA 2PNRC 1JOOA 1EQTA 1GHJA 3DM1A 4G7OC 4DNTB 5ELCA 3J7A5 2XSCA 3NWTA 3W5OA 1N36L 1B8AA 4X64L 1N9WA 4IJHA 5JPNC 1EIHA 3N6RA 4IUPA 2J4XA 2NWGA 1D1IA 1QWYA 1I4GA 1TT2A 2ZTDA 4R4IA 4XTCS 3MFGA 1GD7A 3FMCA 2B8FA 3NUCA 1TWFH 2AQ1B 4UY8C 5LMNQ 1F2ZA 4B3RL 1TWGH 3K8AA 2YTXA 3U58A 2ZXPA 5C4ZA 1M8AA 4KTAA 1VMPA 1PVOA 3H94A 2E75C 3B6YA 4ID6A 1SYFA 1B1ZA 4ZRZA 1W6KA 4C1NI 1EWCA 1LLRD 2NVTB 2KCMA 2BA1A 4A3LG 2HIVA 5LMUQ 4XYOA 5C5MA 4IFDH 1JWSD 1TWCB 3I4NH 1F77A 1YBYA 2EZVA 1RODA 3OW7A 1OTCA 1IBKL 2IHFA 1B3QA 4DV4L 1YVCA 2UXDQ 3HOWB 5IGEA 1V1PB 3RUZA 3EROA 2E2JB 1MJEA 1PTOD 3G71A 3M4OH 3LWEA 5ELEA 2NVQB 3M3YB 1FNVA 4X3UA 1VQKA 5C6AA 2X6GA 1KC8C 4ZYSA 1YNJD 2MQHA 4H44C 5KNCA 1PHJA 3R3OA 5KYIA 1TY0A 4BWGB 1BNZA 3I4MG 3OMCA 1E2WA 4DV6L 3M9BA 3AMUA 5DLQE 1EFWA 1AN8A 5IP9G 1LTAD 1MSGA 3H0GG 4YY3Q 2F3VA 3I2ZA 1SYBA 2K4KA 5C3EH 4G7ZC 1JJCB 1N32L 2XVSA 1RD9D 2GN5A 1HHVA 4AIMA 1YITA 4DA2A 3T53B 3DM3A 1BCPC 1WD0A 2CFMA 1B9MA 1EY8A 4O1NA 5KNBA 5BN4A 5KGUA 4L5RC 3S15H 3DEOA 3BZDB 3KLSA 3QOJA 4GN4B 1NSNS 3AU7A 3KLRA 1N34Q 1CA5A 2WACA 1TQOA 1FD7D 5JJLA 1TR5A 1YHBA 3NENA 4JI2Q 5M3MH 4LF4L 3TRZA 2EYOA 4A93H 3DXJC 4IOCA 1NE3A 2KEEA 3LX0A 1PTOH 3BG3A 3QIAA 1PH2A 2L12A 3VA5A 1EY9A 1ILQA 4JBMA 1V1PA 1VMCA 5IODA 2PW5A 2PYKA 3UDXA 1HQRD 1PTOF 4QQBX 2VXWA 1NTGA 3E9HA 4R1JA 2OXPA 3NTKA 1K8MA 5C44H 2H1EA 5JVH3 5NUCA 4BBRB 1G6ZA 2J7ZA 3PSIA 3CD6A 5EJWA 4I7ZC 1S5FD 2NVXB 4IUVA 1KLUD 2QDLA 3TS2A 1RCVD 4PMWA 3HZXA 4B3TQ 2L11A 1WJJA 2DN8A 4JK1C 3CMEA 2SOBA 4QIWE 4B3SL 4G57A 4L63B 4TQUS 3SK8A 5A2QE 2Q8IB 2NUCA 4KKSA 3CQZB 5CGKA 1J9OA 3CPFA 4JV5Q 1C7YA 5IGBA 4I7AA 2R7FA 1STYA 2ES2A 4DR3L 5FO9B 3A5UA 1GUOA 2PMZE 1VQMA 2L15A 5KNDA 1LACA 2EY2A 1DXMA 2A8VA 1NMFA 2EXDA 3QWNA 3ND9A 3I4MB 1EIFA 4RWSC 3MA2B 2KVMA 1I50H 4DNRB 3R2IA 3GTOB 4B3MQ 1G91A 5C3XA 4RKBA 1Z6HA 3S1MB 1DZ1A 3G7LA 1EY7A 4CJ2C 1LV9A 2HHHQ 4H0LC 4IPGA 1HQMC 2HDLA 2KA7A 1TWAH 3NP8A 3FEWX 1H9JA 3K7AB 4K6DA 2A74C 3SGIA 1S40A 1M1KC 2UXBL 3E3XA 1H9RA 1E1TA 4X65L 1TY2A 4DR2Q 2BDOA 1SXTA 2YYZA 1IYUA 4RCOA 3JAML 5EKLA 1GOZA 2Z6BA 4NP5A 2MUYA 3GDEA 3GO5A 1NY4A 2BCOA 1DYQA 3M7GA 4APVA 4DN4M 4X66Q 1CA6A 4R8IA 4NPSA 4R4QA 1Q12A 4QIWB 3OOCA 1VQIA 4HJ9A 2DUDA 3TZUA 5EPJA 1A2TA 1XNRL 3E0JA 3I73A 4YCWA 2JA6G 2JSOA 4K2LA 3S1QB 2Y0SG 1YNND 4DR5Q 1PRTB 2AUJD 1W6JA 1AE2A 1N33L 4OONA 2E8GA 3K6OA 5K5PA 3A8IE 1UUPA 2Z1CA 3AEVA 5E3FA 2PMZB 2IY5B 3BU2A 4JYAL 4PNYA 1WTOA 3R2TA 4KN4C 1CQVA 2RQXA 4ZUJA 3RLNA 1MIUA 3CC4A 1QG7A 5C5LA 2X6LA 4K8JA 1HH2P 1KNEA 4OEMB 4F7XA 3H3VC 3K59A 5BR8Q 1B2TA 4GNXB 1SFOB 2F0IA 3KJPA 1LTBD 2QDBA 2RCNA 5KRUA 1IL8A 1IYVA 2RDHA 1XXGA 2BE5D 5CBAE 3J81L 2NVTH 2A68D 3L7ZC 3UI2A 4CHTB 2R92G 3MHBA 1SMYC 4EX5A 4DV7Q 4QL5A
chains in the Genus database with same CATH topology
3MC0B 2E2IB 2PZUA 1EYDA 3C0MA 1O7LA 3OHXC 1CTMA 1OXXK 2DNEA 1SJED 1TS2A 1MSHA 5K36G 3ONAB 1IW7C 2O4XA 4FF4A 1QB5D 1RF2D 3SEBA 1LTGD 1B4OA 5C0XJ 5J1ZA 1EU3A 4F88A 2DNCA 3EVQA 2RKSA 4A3JB 5I4DA 1GJXA 3BVGA 2JEAI 3K58A 1L0YB 1RDPD 2CW0D 2A69C 2RSOA 1XX8A 4V0BA 3TBIB 3TP7A 4KJOA 1O7YA 1VCIA 2JA6B 2GA4B 1UNSA 5C0XI 2Y0SB 1JORA 4J6HA 2ZT9C 2RSNA 3W2DA 1JCKB 1LT4D 1QNUA 2F0FA 2B2WA 4MIUA 4C3HB 4OO1I 5M3FB 1STHA 3T16A 2VB3X 1D5MC 2L1BA 2MPMA 1NCVA 4Q0FA 1QJOA 2FJ2A 1CZGA 1SAPA 3EFXD 4X3KA 3J81E 3TZDA 1SYGA 2R92B 3KLSX 3KK7A 1HFNA 1BUVT 4FYDA 3FKIB 4C56C 3A8KE 1D5ZC 2EVBA 1I6HB 4HMIA 1GHKA 4TRDA 3PO3B 3GP7A 2EPBA 2RVLA 3PUZA 1SNQA 2NBFA 4UDUC 4K2KA 3EJIA 1R4PB 3FPUB 2O2LD 2NTTA 1PRTD 1DOKA 3VYUA 3G4NA 1Y8PB 1HPCA 5D3DA 3HP3A 2N88A 3FPPA 4DFAA 3J7AF 5D3IB 5C4XB 1EY4A 5CC4A 4BBSB 2WIIB 1RTOA 3A8JE 3I3CA 5J39A 1F2LA 2YU9B 5I2YA 5FOBB 2LMCB 5JAVA 3IFDA 1PRTC 3MFYA 1PLFA 4WJWA 4A3EB 1ET6A 2AUKA 4FNFA 3RMHA 1Q1EA 2NN6I 5FO7B 3SK5A 4FXKC 3VR2A 2QILA 3HOYB 3R8BA 3EA6A 5DM73 4EQNA 5DM63 5C3WA 1EL0A 5FLXL 4A3DB 4FXDA 1PRTF 2B2WC 4ABNA 4IALA 1E2ZA 2L4NA 1PDQA 3K57A 2E2DC 1NR4A 4E6IA 1IHZA 1D1KA 4CGYB 5KYLA 1WTXA 1GUNA 5I2XA 3NE5B 2E76C 1SNPA 3PO2B 5G3LD 2A6EC 4B9XA 1JB3A 5BN3A 3D6WA 4OL7A 5CORA 3K0YA 3NTIA 2M2LA 3NTHA 1EEFD 1PFNA 2HQEA 4X3TA 1GUGA 2Q8TA 4XDXA 1PZJD 3A56A 2F0WA 2K7VA 2F1MA 3C1EA 4XQQA 3CRLC 3V05A 1JICA 1A6XA 4EQOA 3H91A 1OXUA 1WD1A 3Q24A 1QILA 4DF7A 4FF2A 4R9WA 1E0BA 3FVQA 1BBXC 1XWEA 2K28A 2K1BA 5EBDA 1O80A 1STAA 1SNOA 1Y1VB 2KCCA 1LO5D 3QO2A 2QKIC 1ENCA 1SYCA 1LTSD 1SBBB 1U9RA 1T5XD 4RA8A 3HGBA 4DU9A 1OXTA 4Z9CB 4FF1A 2EY5A 2O5IC 2HCCA 2E2HB 4ZAIA 1CZWA 5A2QL 4M1UB 5FLXE 5I9OA 2F4IA 1TVXA 1LABA 3NQTA 3PMFA 1EEID 5T1IA 3HOUB 1BCPD 3SR1A 2XIWA 5G3LF 4A3BB 3S2HB 5ELFA 4RKLA 4K5XA 4OGQC 2EDGA 1H9SB 3L9AX 2E74C 1SEBD 2LKVA 5EQ0A 2X69A 1CT1D 2B2TA 2G9DA 4X3SA 1AW7A 4O42A 1U4MA 3IAYA 1J8IA 1ML0D 2EY6A 2OEOA 3I72A 1B3AA 2ICIA 3AB9A 2F03A 2IL8A 4LJZC 3DHQA 4RAUC 3S2DB 2IX0A 2F0OA 2PO4A 5CYUA 3SK4A 4KI0A 1SYEA 2ID0A 1F9PA 4ZKCB 3KF8A 4N9PA 3J7YW 1BXTA 2F0TA 2K32A 1MGSA 3RZOB 2AQ3B 3WDNA 4ZQ3A 5K36H 5ELBA 1MD2D 1SE2A 3QG1A 3A7LA 1STBA 3M7NA 2KCNA 1EIGA 1JE4A 1DOLA 5EGTA 3BDLA 1BCPF 5IGGA 1HCZA 3I91A 3OPOA 1TIID 4KHZA 1STEA 3NWSA 2NZ1D 1V1OA 1ESRA 1H9SA 3Q22A 4BY1B 3BYTB 4FP5D 2R7ZB 1QE6A 5IGCA 2KOLA 4KHVA 1JWMD 2B8GA 2A6HD 1FYCA 3TP8A 2SEBD 1HFGA 2TSSA 2MJ8A 3FDTA 1ET9A 3OIQA 1ESFA 4Y7NB 1E2VA 3TP5A 2DY7A 1B53A 3VYRA 2XNAC 4ZK9B 2JA5B 2F0HA 5C0XG 3NSWA 3RZDB 4A3GB 3P20A 2O5JC 1R4QB 2L0CA 2A6HC 5E4WC 2K5WA 1A15A 1AZQA 3DUZA 3D4WA 4DAVA 1SJHD 3P1HA 3W3AA 1WCMB 1KLGD 3E5SA 3D4RA 2PW7A 2HDMA 3GTJB 2RDFA 5ISRA 1F2MA 1JWUD 1LT3D 4HMJA 1HUMA 1EYAA 4IUQA 2JP1A 2B2TC 2EOTA 4RGOS 5JEAJ 3NBHA 2EYFA 1GUSA 2F0EA 4CJ0B 5IT9E 1SNCA 2IW3A 1HTLD 2ICEC 2XRQD 3X3MA 1D6EC 4LMQD 2OF1A 3TSSA 1BO0A 4K6LA 4C1NK 1KDBA 4G4KA 3SHLA 1EOTA 5IGDA 3HRZC 1S5DD 1TS3A 2PZTA 1NUCA 2TMPA 1OXVA 1SMYD 4CJ1B 3FRPB 1QNKA 3G4OA 4DK1A 1R9TB 4C3HG 3A54A 2K05A 2D9UA 1V8QA 2SNSA 3NHHA 3DMUA 4BS9A 1L0XB 4B08A 2Z4IA 1IW7D 3HOVB 2KQ3A 3GTLB 3I4LA 1II3A 1KABA 4BA2I 3Q23A 1FNUA 4CKEA 2EY1A 1NR2A 1UAPA 4EGVA 2ZXRA 2K03A 2WKCA 3OSOA 2VUMB 2RDGA 1I4HA 1ZEQX 3DWPA 3VR3A 4NKLA 1HRJA 4M8AA 2R3ZA 4ZKBB 1PZID 2A69D 2NN6G 2Z8LA 3HOZB 1RKNA 4FVMA 2XWBB 4KY7A 1B50A 1EY6A 1Z7TA 2SNMA 4BA1I 2L5TA 3CKIB 1KAAA 2BOSA 3VR6A 2DY8A 1K83B 3PUWA 4Q5VA 4LK1C 2D62A 2NYZD 2K5DA 1EU4A 1AEXA 4QUFA 1ICWA 5T1GA 2XN9C 3C0NA 2WKDA 2B63B 1F2YA 1TU2B 4HCEA 3TN2A 4KK7A 3RLFA 1WTQA 4PMBA 4KKUA 3BVZA 3D3RA 5CV9A 1XYIA 3ITPA 2K33A 4NMZA 1LTID 1PMRA 3IL8A 3M4YA 4A3MB 2EJFC 1LTTD 4IFDJ 1C4QA 3MVVA 1D2BA 1GXDC 2F0DA 3PUVA 1C8CA 1ILPA 2N55A 4I65A 3PV0A 3S1NB 3D4DA 1RTNA 3GTKB 3U9SA 1IKLA 3HG9A 5DAUA 3C3LA 1BR9A 1WVLA 3K5NA 4IFDI 1TWHB 3HS0C 2EJMA 3WOFA 4C3JG 1DONA 1NAPA 2SDFA 3BDCA 1T5EA 4OHJA 3D31A 4HR7B 2I07B 3S17B 3BDOA 1PTOB 1SDFA 3S16B 2PZWA 2BA0A 2JA7B 2H4OA 2IWHA 3I70A 2F0KA 1ENAA 1X3QA 3HEJA 4C2MB 5COYA 1RJTA 2MP1A 3K5LA 2HUGA 2A5HA 4HAEA 4NW2A 2PCFB 1PZKD 4RHRA 1S5BD 2JXMB 2QF7A 5LL6S 3J80L 3N52A 2M00A 5JJZA 2EYMA 1KDCA 4B9WA 5CV4A 1HXYD 5JPMC 3PUYA 1Z47A 5C4JB 1Y1WB 4HCSA 4QCLA 5J22A 2A6ED 2IPKD 2AWNA 1B9NA 1OO9B 5HGTA 4A3IB 3GD7A 2IJ0A 2KHSA 5ELDA 1I3QB 1DJRD 4ILWA 2OT2A 1GUWA 1MBYA 2R61A 3MXNA 4HTHA 4C3JB 2FMCA 1STGA 2WAQB 4ULLA 4FF3A 5EKIA 2CHBD 4ODGA 3GTQB 3D6CA 3CHBD 4MN3A 5CV8A 3MWYW 1AZPA 2VB2X 2F0VA 3DWQA 1WTWA 5C0XH 4RCNA 3WOEA 1KNAA 1B44D 2XRSD 4WRDA 5TSSA 4H13C 4J1MA 4AYBB 5EKKA 3A7AB 2F3WA 4DAYA 1SSOA 3R93A 4OO1H 3NBIA 3VYSA 4KKTA 4QUCA 2R6GA 3PUXA 4KY6A 3VR5A 3NK9A 4ZLTF 3HKZB 5M5XB 4L6TB 2B2YA 3KUPA 1UEAB 3BVMA 3J80E 3G6JB 4U68A 1BF4A 3ERQA 5KIXA 1WTPA 4KD4A 3MEHA 2AQ2B 2RA4A 3GV3A 4P2CB 5JOBA 3S1RB 2R93B 4KV6A 2K04A 2F0NA 1SE4A 1MI2A 5BN5A 4DK0A 4CKBA 3LWUA 4XIGS 2B2UA 1CM9A 4LAAA 4UAIA 3U9OA 1CI3M 2KUMA 1Y8NB 1S5ED 1EFID 4KY5A 5FKAC 2CQAA 5I9PA 4XQJA 2J0TD 5M5WB 1SNDA 2HCIA 1X3PA 3PIP3 2CVRA 3DWAA 3I90A 4DXGA 1EQVA 1WTRA 4QMGA 5JEAG 1I6VC 4A3FB 2F0PA 1AFPA 1G291 2FFKB 1EY5A 2LFNA 1CHPD 3Q6SA 1PTOC 2K01A 2V4DA 3CRKC 4C3IB 1G2SA 3DEPA 3SXHA 1A3VA 3MXUA 1HTPA 5CV7A 3LNNA 4OIJA 1YNJC 1BOSA 2NN6H 5IT9L 5FK9C 1F9RA 3C1FA 5CR3A 3KBGA 3GTPB 4HSPA 1S5CD 3O13A 4IZ8A 5IGFA 2L55A 1BQQT 3H09A 1Z52A 2IT1A 4L8JA 3A55A 1IKMA 3NXWA 1Q1BA 3OIPA 1S4ZA 1U4LA 1A3UA 2WINB 4K5VA 2WV6D 4WORA 1PREA 4RFBA 4GZYC 2F0LA 2F0SA 3GTMB 2B2YC 1KTKA 1A3TA 1Q90A 1OXSC 5EPLA 1VF7A 2NVYB 1O78A 2G9HD 4A3KB 5DEHA 1ENFA 1LT6D 1JR0D 1TS5A 4OO1G 4N9TA 2EYLA 2B2UC 5M5YB 4EVOA 3H0GB 1H9MA 3V96A 5CV5A 1I4PA 2WB1B 3URYA 3KBXA 1EZ6A 3SDZA 3Q0AA 1I4RA 5CMDA 3BYYB 2Z4HA 5LHY1 1PFMA 2IX3A 4F87A 5AFWA 1G2TA 1FR3A 4PV1C 2QEJC 5D65A 2JA8B 4IFDG 1RHPA 2EJGC 4K5WA 4IUTA 1HA6A 4ME5A 2EYPA 4BY7B 1VF5C 2EE1A 3EQLC 5C4HA 2C9OA 1ZXTA 1JOQA 2B2VA 1AP0A 2NTSA 3S9WA 1LT5D 2BDNA 3HOXB 3K5MA 4RGNA 4QF4A 2LY7A 4RHSA 2AWOA 4XQNA 3S14B 3GTGB 2F0MA 1CK1A 4QB4A 1EYCA 1QCBD 1CFMA 3OWFA 1K8OA 1SNMA 4XT1B 3H6MA 1PXUA 3GV6A 4JBWA 4K8IA 1JQYD 4FO2A 2FMMA 1EWHA 3SK6A 4J8QA 3IFTA 3C0OA 2KJXA 3PIO3 1PFBA 1YNNC 1DM0B 2F0GA 4ZUIA 4TKOB 3F2UA 4PQXA 4OIKA 3QB3A 2LS01 1CQFA 4DAPA 4KD3A 3OMGA 1Q3LA 4IQZA 1F9SA 2VNUD 3GQBA 1X32A 1DD2A 3RD4A 1A2UA 1TWFB 1SE3A 1H9KA 4KMUC 1TWGB 1WTVA 5F2DA 4S3SA 2BE5C 1XTCD 2A68C 3NQIA 4CBVA 4G7HC 1JC7A 1G8ZD 4RGMA 3C2PA 2PQEA 3NPPA 3JAME 1HA5A 3X3NA 1FGBD 3I4NB 5JVG3 3OWEB 2JE6I 3T51B 4H7BA 1FNWA 1ZYRD 2EYJA 1U4PA 5E1FA 1PYWD 2D2CC 1STNA 2M9VA 2RBMA 3M4OB 2XWJB 1CHQD 2MGSA 3ND8A 4TSSA 2EXZA 3TDQA 3T56B 3P75A 3SVMA 2F0UA 5CBEE 3QJYA 1Y69U 1U4RA 1TS4A 1DOMA 2JEBI 2D5DA 2ENBA 4RH6A 1KDAA 1ZYRC 2CW0C 4PMCA 4MHEA 2JYOA 3MXGA 1O7ZA 2FINB 2B39A 5C3EB 4K14A 2A73B 2B2VC 4DXFA 3ZYYX 5DNFA 4YIJA 4F8MA 3TMEA 1V43A 3S15B 2IX1A 1ZKOA 3BS1A 1QOHA 5M9OA 2F0QA 2I46A 3MAQA 3SE0A 3J7AV 5M3MB 2Q8RE 4A93B 1C48A 5E4XA 5I6WA 3P7JA 3V2TA 3MXPA 2FHTA 4EQPA 3D8GA 1TKWB 1BCPB 3L3OC 4XXEA 5C44B 1HUNA 5JEAH 2L9HA 1DCZA 4FXGC 3TP6A 3I8ZA 3VA7A 1LTRD 5CV6A 2KEDA 5FO8B 4HSVA 5EBCA 4KJNA 5A35A 4IUNA 2C5CA 1M4VA 4IUUA 3VR4A 5KEEA 2ZXOA 2WP8J 4KN7C 3MZ5A 2NB0A 3T4AC 3VYTA 5I6YA 2F0JA 1GUTA 3T13A 4R8NA 3E6ZX 2K6AA 4HN7A 4XYQA 1F9QA 5LL6X 2PPBC 4HEDA 4U673 4V190 4WFN3 1I4QA 1I50B 3C46A 1I4XA 1VDZA 5IIFA 5HURA 4DGZA 3MTSA 1TWAB 5EPKA 1JOKA 3IKJA 3QOLA 4IURA 4NDXA 1EY0A 1D5XC 4CKCA 1Q8IA 3K5OA 5IOCA 1EZ8A 2MHVA 4XT3B 2QCPX 2K5QA 4IN3A 1SYDA 3M85A 1Y8OB 2EYHA 4RGTA 4C3IG 1ONLA 3CU7A 2KECA 5D14A 1BDOA 2PNRC 1JOOA 1EQTA 1GHJA 3DM1A 4G7OC 4DNTB 5ELCA 2XSCA 3NWTA 5JPNC 1EIHA 3N6RA 4IUPA 2J4XA 2NWGA 1D1IA 1QWYA 1I4GA 1TT2A 4XTCS 3MFGA 3FMCA 2B8FA 3NUCA 2AQ1B 1F2ZA 2ZXPA 5C4ZA 1M8AA 4KTAA 1VMPA 3H94A 2E75C 4ID6A 1SYFA 1B1ZA 4ZRZA 1W6KA 4C1NI 1EWCA 1LLRD 2NVTB 2BA1A 4XYOA 5C5MA 4IFDH 1JWSD 1TWCB 1F77A 2EZVA 1RODA 3OW7A 3HOWB 5IGEA 1V1PB 3RUZA 3EROA 2E2JB 1PTOD 3LWEA 5ELEA 2NVQB 3M3YB 1FNVA 4X3UA 5C6AA 2X6GA 4ZYSA 1YNJD 4H44C 5KNCA 3R3OA 5KYIA 1TY0A 4BWGB 1BNZA 3OMCA 1E2WA 3AMUA 1AN8A 1LTAD 1MSGA 2F3VA 1SYBA 4G7ZC 2XVSA 1RD9D 1HHVA 4DA2A 3T53B 1BCPC 1WD0A 1B9MA 1EY8A 4O1NA 5KNBA 5BN4A 5KGUA 3DEOA 3BZDB 3KLSA 3QOJA 1NSNS 3AU7A 3KLRA 1CA5A 2WACA 1TQOA 1FD7D 1TR5A 2EYOA 3DXJC 2KEEA 1PTOH 3BG3A 3LX0A 3QIAA 2L12A 3VA5A 1EY9A 1ILQA 1V1PA 1VMCA 5IODA 2PW5A 2PYKA 1HQRD 1PTOF 2VXWA 2OXPA 3NTKA 1K8MA 2H1EA 5JVH3 5NUCA 4BBRB 1G6ZA 2J7ZA 5EJWA 4I7ZC 1S5FD 2NVXB 4IUVA 1KLUD 1RCVD 4PMWA 3HZXA 2L11A 2DN8A 4JK1C 2SOBA 4G57A 4L63B 4TQUS 3SK8A 5A2QE 2Q8IB 2NUCA 4KKSA 3CQZB 5CGKA 1J9OA 5IGBA 1STYA 5FO9B 1GUOA 5KNDA 1LACA 2EY2A 1DXMA 3QWNA 3ND9A 3I4MB 4RWSC 3MA2B 2KVMA 4DNRB 3R2IA 3GTOB 1G91A 5C3XA 4RKBA 1Z6HA 3S1MB 1DZ1A 3G7LA 1EY7A 4CJ2C 1LV9A 4H0LC 1HQMC 2HDLA 2KA7A 3FEWX 3NP8A 1H9JA 3K7AB 4K6DA 2A74C 1H9RA 1TY2A 2BDOA 1SXTA 2YYZA 1IYUA 4RCOA 3JAML 5EKLA 1GOZA 4NP5A 2MUYA 3GO5A 2BCOA 1DYQA 3M7GA 4DN4M 1CA6A 4R8IA 1Q12A 4QIWB 3OOCA 3TZUA 5EPJA 1A2TA 3E0JA 3I73A 2JSOA 4K2LA 3S1QB 1YNND 1PRTB 2AUJD 1W6JA 3K6OA 5K5PA 3A8IE 1UUPA 2Z1CA 5E3FA 2PMZB 4PNYA 1WTOA 3R2TA 4KN4C 1CQVA 2RQXA 4ZUJA 1QG7A 5C5LA 2X6LA 4K8JA 1KNEA 4F7XA 3H3VC 3K59A 1B2TA 1SFOB 2F0IA 1LTBD 2QDBA 5KRUA 1IL8A 1IYVA 2RDHA 1XXGA 2BE5D 5CBAE 3J81L 2A68D 3L7ZC 3UI2A 4CHTB 3MHBA 1SMYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5B D;  1LTI D;  3KLS X;  4L6T B;  3MC0 B;  1BCP B;  1S5C D;  3R2I A;  2SEB D;  2TSS A;  3O13 A;  2QEJ C;  3BVM A;  1EEI D;  1G8Z D;  4RGM A;  1BCP D;  1RD9 D;  1LTT D;  1HA5 A;  1ET9 A;  1PRT F;  1Z52 A;  1BCP C;  3C0M A;  1FGB D;  4C56 C;  5ELF A;  4O1N A;  1HXY D;  1ESF A;  1L0X B;  3OWE B;  5ELC A;  1LTR D;  1D5Z C;  3BZD B;  1SJE D;  2AQ2 B;  1FNW A;  1TS2 A;  2XNA C;  1SEB D;  1TY2 A;  2J4X A;  3GP7 A;  1FNU A;  1RF2 D;  2WV6 D;  1CT1 D;  1FD7 D;  1I4G A;  1LTG D;  3SEB A;  1PYW D;  1M4V A;  1SXT A;  1AW7 A;  4RCO A;  1PRE A;  1EU3 A;  1SE4 A;  3MFG A;  2NTS A;  4UDU C;  1LT5 D;  1GOZ A;  4RFB A;  2IPK D;  4RGN A;  4RHS A;  1CHQ D;  2AQ1 B;  4RGT A;  4TSS A;  2O2L D;  2NTT A;  1PRT D;  2RDG A;  1PTO H;  1CK1 A;  1DYQ A;  5I4D A;  1I4H A;  1KTK A;  1S5E D;  1EFI D;  1SJH D;  2IJ0 A;  3DWP A;  3G4N A;  5ELD A;  3BVG A;  1V1P A;  1PZI D;  2ICI A;  5D3D A;  1TS4 A;  1L0Y B;  1DJR D;  5FKA C;  1EEF D;  1KLG D;  2Z8L A;  1HQR D;  1PTO F;  5D3I B;  1RDP D;  2R61 A;  1B1Z A;  1PZJ D;  1JQY D;  1EWC A;  1LLR D;  4RH6 A;  1JWU D;  1LT3 D;  4OHJ A;  1JWS D;  3DWA A;  4DXG A;  1F77 A;  2G9H D;  1PRT B;  1I4Q A;  2CHB D;  3C0O A;  3V05 A;  1UNS A;  1ENF A;  1LT6 D;  1S5F D;  1I4X A;  1UUP A;  4RGO S;  1JR0 D;  3CHB D;  1KLU D;  1TS5 A;  1BXT A;  1QIL A;  2AQ3 B;  4DXF A;  1PTO B;  3R2T A;  1RCV D;  1V1P B;  1CQV A;  1PRT C;  3W2D A;  5ELB A;  1EU4 A;  3DWQ A;  1MD2 D;  1SE2 A;  1JCK B;  1LT4 D;  1PTO D;  1LO5 D;  1ET6 A;  1CHP D;  4L63 B;  1HTL D;  2XRQ D;  1D5X C;  1D6E C;  2XN9 C;  3TSS A;  1PTO C;  3C0N A;  1B44 D;  2XRS D;  4K6L A;  5ELE A;  1D5M C;  5TSS A;  1BCP F;  1FNV A;  1I4P A;  1LTS D;  1SBB B;  1T5X D;  1LTB D;  1S5D D;  4ZYS A;  1STE A;  1TS3 A;  3URY A;  2QIL A;  1V1O A;  3R8B A;  3BYT B;  1SE3 A;  2RDH A;  1XXG A;  3EA6 A;  4Z9C B;  1TY0 A;  3BVZ A;  4BWG B;  1I4R A;  3BYY B;  3EFX D;  5FK9 C;  3G4O A;  1JWM D;  1PZK D;  1AN8 A;  4RHR A;  1XTC D;  1LTA D; 
#chains in the Genus database with same CATH topology
 1TWC H;  3MC0 B;  2E2I B;  2LXK A;  1AE3 A;  3FKI G;  4A93 G;  2PZU A;  1EYD A;  3HOW H;  2RF4 A;  1WOC A;  3C0M A;  4H02 A;  1O7L A;  3OHX C;  3H3V H;  1UE6 A;  1CTM A;  2UUC L;  1OXX K;  2DNE A;  3J80 i;  1SJE D;  1VQ7 A;  1TS2 A;  1MSH A;  5GAG C;  3PO3 G;  5K36 G;  3ONA B;  4JPB W;  1XMQ L;  1IW7 C;  2O4X A;  4JI7 L;  4FF4 A;  1QB5 D;  2NVQ H;  1PH8 A;  1RF2 D;  3M3Y H;  3SEB A;  1WYD A;  1LTG D;  1B4O A;  5C0X J;  5J1Z A;  4HJ5 A;  1EU3 A;  1K28 A;  2K50 A;  3PIO A;  1SE8 A;  4F88 A;  2DNC A;  3EVQ A;  3A5Z B;  3M4Q A;  4MTK A;  2RKS A;  4A3J B;  1FL0 A;  5I4D A;  1GJX A;  4AQY L;  4DR6 L;  1LM0 A;  3BVG A;  2JEA I;  3K58 A;  1L0Y B;  2YTV A;  1RDP D;  2CW0 D;  4BBS G;  1IBM L;  2A69 C;  4DV1 L;  2RSO A;  4MTN A;  2KEN A;  1XX8 A;  4V0B A;  3TBI B;  5IYB G;  3TP7 A;  4KJO A;  1O7Y A;  2A19 A;  4GNX A;  1VCI A;  2JA6 B;  2GA4 B;  3F1Z A;  1UNS A;  2UUB Q;  5C0X I;  4PZ8 A;  2Y0S B;  4QY7 A;  1JOR A;  1K8A C;  4J6H A;  2D0P A;  2ZT9 C;  2RSN A;  4LF8 L;  4DV5 L;  4DR1 Q;  5ELN A;  3W2D A;  4DR7 L;  4A3E G;  1RIP A;  4GN3 B;  1JCK B;  1LT4 D;  1QNU A;  2F0F A;  2B2W A;  1O7I A;  4MIU A;  4C3H B;  4OO1 I;  3NEM A;  5M3F B;  1STH A;  3T16 A;  2VB3 X;  1D5M C;  2L1B A;  5LMN W;  2MFI A;  4KHP L;  3HOY G;  1M90 C;  2MPM A;  4ME3 A;  1NCV A;  4Q0F A;  4JI4 L;  2OCE A;  1QJO A;  2FJ2 A;  1CZG A;  1SAP A;  3EFX D;  4X3K A;  1Q7Y C;  3J81 E;  4A3D G;  3TZD A;  3T1H Q;  1SYG A;  2R92 B;  4LWC A;  3KLS X;  2CKZ B;  4BBR H;  3KK7 A;  3E0E A;  3EN2 A;  1HFN A;  2NVX H;  1BUV T;  3J81 c;  4FYD A;  1JMC A;  3FKI B;  4C56 C;  4X62 Q;  4LFA L;  3PCO B;  1XMO Q;  3T1Y Q;  3A8K E;  2RCF A;  1D5Z C;  2EVB A;  3CC2 A;  1I6H B;  4HMI A;  2H5X A;  1GHK A;  3CQZ H;  4TRD A;  3PO3 B;  3GP7 A;  1G6P A;  2EPB A;  2RVL A;  1FJG Q;  3PUZ A;  2K14 A;  1SNQ A;  2NBF A;  4UDU C;  4K2K A;  3PO2 G;  3EJI A;  2F52 A;  1R4P B;  1BBW A;  3FPU B;  2O2L D;  2NTT A;  1PRT D;  1CKN B;  1DOK A;  3VYU A;  1HNZ Q;  3G4N A;  2I0Q A;  1Y8P B;  3S24 A;  1HPC A;  1VQ4 A;  3I4M H;  5D3D A;  3HP3 A;  5AJ3 L;  2N88 A;  3FPP A;  4DFA A;  3J7A F;  5D3I B;  3GTO H;  5C4X B;  1EY4 A;  2B29 A;  5CC4 A;  4LF9 L;  4BBS B;  3S1M H;  2WII B;  2AKW B;  1RTO A;  3A8J E;  3I3C A;  5J39 A;  1W2B A;  3K7A H;  1F2L A;  1IXR A;  2YU9 B;  5I2Y A;  5FOB B;  2LMC B;  1UWV A;  5JAV A;  1PV4 A;  3IFD A;  1Y1V G;  1PRT C;  1HNW Q;  3MFY A;  1K9M C;  4DUY L;  1PLF A;  1SN8 A;  4WJW A;  1KD1 C;  4A3E B;  2MO0 A;  2ZM6 L;  1ET6 A;  2AUK A;  4FNF A;  2ZJQ A;  3RMH A;  1Q1E A;  1X3E A;  2NN6 I;  5FO7 B;  3K0X A;  4DPG A;  3SK5 A;  4FXK C;  3VR2 A;  2QIL A;  5IWA Q;  3HOY B;  1I94 L;  3R8B A;  4NXN L;  3EA6 A;  5DM7 3;  4EQN A;  5DM6 3;  1T9H A;  4FDB A;  3CCV A;  5C3W A;  2N3S A;  4GNX C;  1EL0 A;  5FLX L;  2Q2H A;  3ICE A;  2CH4 W;  2HQL A;  3ERS X;  3S1Q H;  4A3D B;  1W3S A;  2PNH A;  4LF5 L;  5J3B A;  3JC6 6;  4FXD A;  1PRT F;  3BZC A;  1CKN A;  2B2W C;  3WWV A;  4ABN A;  1A8V A;  1J6Q A;  4IAL A;  5HGQ A;  1E2Z A;  2L4N A;  1KQS A;  4WJ4 A;  1PDQ A;  4NXM L;  3EIV A;  3K57 A;  2E2D C;  1NR4 A;  4E6I A;  1IHZ A;  1D1K A;  4CGY B;  5KYL A;  1WTX A;  1SFO H;  1GUN A;  5I2X A;  1GM5 A;  3NE5 B;  2MNA A;  2E76 C;  1SNP A;  3CCL A;  2F4V L;  3PO2 B;  2PI2 E;  5G3L D;  4DR4 Q;  1UE7 A;  2A6E C;  4B9X A;  1JB3 A;  5BN3 A;  3UDI A;  3D6W A;  4IO9 A;  1IZ6 A;  1VQA A;  5IE8 A;  4OL7 A;  5COR A;  3K0Y A;  3NTI A;  2VQF L;  2M2L A;  3NTH A;  3VDY A;  1EEF D;  1PFN A;  2HQE A;  4X3T A;  4X64 Q;  1N36 Q;  2E2I H;  1GUG A;  2Q8T A;  4XDX A;  1XJV A;  1JJ2 A;  1PZJ D;  3A56 A;  2F0W A;  2K7V A;  2F1M A;  3C1E A;  4XQQ A;  2ZTE A;  3CRL C;  1X55 A;  4LFC L;  3V05 A;  1JIC A;  4MZ9 A;  1IBL Q;  4EQO A;  1A6X A;  3F2C A;  3H91 A;  1OXU A;  1WD1 A;  3Q24 A;  4UP7 A;  4B3R Q;  1QIL A;  4DF7 A;  4PG3 A;  4FF2 A;  4R9W A;  1E0B A;  3FVQ A;  1BBX C;  1XWE A;  1Q82 C;  5FLM H;  2K28 A;  3W1G A;  4POF A;  2K1B A;  5EBD A;  1O80 A;  1STA A;  1SNO A;  1Y1V B;  5GAH C;  2KCC A;  1LO5 D;  3QO2 A;  2QKI C;  2NZH A;  1PH3 A;  1IL2 A;  3K81 C;  4P71 A;  1ENC A;  4A3J H;  1HZ9 A;  3LGJ A;  4BBR G;  1SYC A;  3CCQ A;  1LTS D;  5LMN L;  1SBB B;  3NEL A;  2UXC L;  1U9R A;  1T5X D;  3KF8 B;  4RA8 A;  2ALY B;  2R7Z G;  3HGB A;  1IBK Q;  4DU9 A;  1C9O A;  1OXT A;  4DV4 Q;  4Z9C B;  4FF1 A;  2EY5 A;  3PF4 A;  2OQ0 A;  4ZCK A;  2O5I C;  2HCC A;  2E2H B;  4ZAI A;  1CZW A;  5A2Q L;  4M1U B;  5FLX E;  3I55 A;  5I9O A;  4JOI A;  1HNX Q;  2F4I A;  2JA6 H;  3D0F A;  1TVX A;  1LAB A;  4DUZ L;  3NQT A;  3PMF A;  1EEI D;  5T1I A;  3HOU B;  1BCP D;  3SR1 A;  2XIW A;  5G3L F;  4A3B B;  2CQO A;  3S2H B;  4GKK Q;  4PZ6 A;  5FLX c;  5ELF A;  4RKL A;  2UXD L;  4LW1 A;  4K5X A;  4OGQ C;  1LYL A;  2EDG A;  2DJG C;  1GVP A;  1H9S B;  3CMA A;  2EQS A;  3L9A X;  4JI8 L;  4C3H H;  3ULL A;  3RR5 A;  2E74 C;  1SEB D;  4N8X 1;  5M3F H;  2LKV A;  4A3G G;  5EQ0 A;  2X69 A;  1CT1 D;  2B2T A;  2G9D A;  4X3S A;  1AW7 A;  4O42 A;  1U4M A;  3IAY A;  1J8I A;  1N32 Q;  1ML0 D;  2EY6 A;  2GVA A;  4L5Q A;  2OEO A;  5GRO A;  3I72 A;  1B3A A;  2ICI A;  2AHO B;  3AB9 A;  2R92 H;  4L5S A;  2F03 A;  2IL8 A;  4LJZ C;  4GN5 A;  1GKH A;  3DHQ A;  4RAU C;  1L1O B;  3S2D B;  4IPC A;  2DGY A;  1K3B C;  2IX0 A;  2F0O A;  2PO4 A;  5CYU A;  3SK4 A;  1QUQ B;  4KI0 A;  1SYE A;  3FKI H;  1YEZ A;  2ID0 A;  1F9P A;  1S3O A;  4ZKC B;  3KF8 A;  1X65 A;  4N9P A;  4IPD A;  3J7Y W;  1I6H H;  1BXT A;  2F0T A;  2K32 A;  1MGS A;  3RZO B;  2AQ3 B;  1HR0 L;  3WDN A;  4ZQ3 A;  3PO3 H;  5K36 H;  5ELB A;  1PFS A;  4NB3 A;  1MD2 D;  1SE2 A;  4QGU A;  3QG1 A;  3A7L A;  4DKA C;  1STB A;  1QZH A;  4JI2 L;  3M7N A;  2KCN A;  1EIG A;  1JE4 A;  1DOL A;  1K8G A;  5EGT A;  3BDL A;  2OTJ A;  1BCP F;  5IGG A;  1HCZ A;  3I91 A;  3OPO A;  1TII D;  1SLJ A;  1JT8 A;  4KHZ A;  1STE A;  3NWS A;  1P8L A;  2NZ1 D;  1V1O A;  1ESR A;  4DK6 C;  1H9S A;  3Q22 A;  4BY1 B;  3BYT B;  4FP5 D;  4LF7 L;  2R7Z B;  5C4X H;  1MHW C;  1QE6 A;  3NBH B;  1Q86 C;  5IGC A;  2KOL A;  4KHV A;  4BBS H;  2RHS B;  1VQ8 A;  1JWM D;  2B8G A;  2A6H D;  4B3S Q;  4RG1 A;  1FYC A;  5IYB H;  3TP8 A;  2SEB D;  2QGQ A;  1HFG A;  2TSS A;  2YU9 H;  2Z0S A;  2MJ8 A;  1D7Q A;  3FDT A;  1SRU A;  2HD3 A;  4UP8 A;  4YWM A;  1ET9 A;  3OIQ A;  4K0K L;  1ESF A;  4DR3 Q;  3PQI A;  4Y7N B;  1E2V A;  1X54 A;  3TP5 A;  2DY7 A;  4A3E H;  1JB7 A;  1B53 A;  4B3T L;  4KLK A;  1L1O A;  3VYR A;  4X6A H;  1WFQ A;  2XNA C;  1J5E Q;  2LXJ A;  4ZK9 B;  3I56 A;  2JA5 B;  2F0H A;  5C0X G;  3NSW A;  3RZD B;  2KHI A;  2ZJP A;  2N78 A;  4A3G B;  3P20 A;  2RHQ B;  1QUQ A;  1R4Q B;  2L0C A;  1QVG A;  2A6H C;  2O5J C;  5E4W C;  3HOY H;  5GAD C;  4DV2 Q;  2K5W A;  3CP0 A;  1A15 A;  4HIM A;  1AZQ A;  3DUZ A;  4JOI C;  3D4W A;  2I5L X;  4DAV A;  1SJH D;  4A76 A;  1JE5 A;  3P1H A;  4JI3 L;  3HOZ G;  2JA9 A;  3F2D A;  3W3A A;  4A3D H;  2UXB Q;  1WCM B;  1KLG D;  3E5S A;  4DV0 Q;  3D4R A;  2PW7 A;  2HDM A;  4UPA A;  5FLM G;  1S72 A;  4X65 Q;  1HZB A;  1Y14 B;  3GTJ B;  4CDE C;  2RDF A;  5ISR A;  1F2M A;  1JWU D;  4J15 A;  1LT3 D;  4HMJ A;  1HUM A;  1EYA A;  4IUQ A;  2JP1 A;  2F3I A;  4A3J G;  2HHH L;  1KXL A;  2B2T C;  2EOT A;  4RGO S;  5JEA J;  1G51 A;  3KOJ A;  3NBH A;  3PF5 A;  2EYF A;  1GUS A;  4BXX G;  2F0E A;  1BKB A;  4DR2 L;  4CJ0 B;  5IT9 E;  1VQL A;  1SNC A;  2IW3 A;  1LUZ A;  1HTL D;  2ICE C;  2XRQ D;  1VQC A;  3X3M A;  1D6E C;  4LMQ D;  2OF1 A;  3TSS A;  1BO0 A;  1XNR Q;  1BBU A;  3PO2 H;  4K6L A;  4C1N K;  4OX9 Q;  2JJQ A;  1KDB A;  4G4K A;  2JK8 A;  3SHL A;  1EOT A;  1L2F A;  5IGD A;  3CPW A;  3HRZ C;  3HKS A;  1S5D D;  1TS3 A;  2PZT A;  1NUC A;  2TMP A;  1OXV A;  1NNX A;  4JYA Q;  1SMY D;  4CJ1 B;  1KHI A;  3FRP B;  1SR3 A;  1QNK A;  3L2P A;  3G4O A;  4DK1 A;  1R9T B;  4C3H G;  3A54 A;  4P73 A;  5M3F G;  1Q81 C;  2K05 A;  4JI5 Q;  2D9U A;  1V8Q A;  2NZO A;  2SNS A;  4LF6 Q;  1H95 A;  3NHH A;  4CDC C;  4DV3 Q;  3DMU A;  4POG A;  4BS9 A;  1Y1V H;  1L0X B;  4B08 A;  2Z4I A;  1IW7 D;  3CAM A;  3HOV B;  1X3G A;  2KQ3 A;  3GTL B;  1ICF B;  3I4L A;  1II3 A;  1KAB A;  2Z6K A;  4BA2 I;  3Q23 A;  1X6O A;  1FNU A;  3U4V A;  4CKE A;  2EY1 A;  1SMX A;  1NR2 A;  4P72 A;  1UAP A;  1D8L A;  4EGV A;  5BR8 L;  3E9I A;  2ZXR A;  2K03 A;  2WKC A;  3OSO A;  5EAY A;  2VUM B;  2RDG A;  1I4H A;  1ZEQ X;  3I4O A;  2E2H H;  3DWP A;  3VR3 A;  4NKL A;  1HRJ A;  1GO3 E;  2E2J H;  2UUC Q;  4M8A A;  2R3Z A;  4ZKB B;  1PZI D;  3G6E A;  2A69 D;  2XGT A;  2NN6 G;  2Z8L A;  3HOZ B;  3STB C;  1XMQ Q;  4JI7 Q;  3HOU H;  1RKN A;  4FVM A;  2XWB B;  4JI0 Q;  4A3B H;  3S2H H;  4KY7 A;  4JCV E;  1B50 A;  3UE1 A;  1XPR A;  1EY6 A;  1L1O C;  1Z7T A;  2SNM A;  4BA1 I;  2L5T A;  3CKI B;  1KAA A;  1K0S A;  4LNQ A;  2BOS A;  3VR6 A;  2DY8 A;  1K83 B;  3PUW A;  3AFQ A;  1MJC A;  4Q5V A;  4LK1 C;  3CCM A;  2D62 A;  2XTI A;  2NYZ D;  2K5D A;  1VQD A;  3KDF B;  4HJA A;  2JA7 G;  1EU4 A;  5C4X G;  1AEX A;  4QUF A;  1ICW A;  1YHA A;  5T1G A;  4DV1 Q;  2XN9 C;  3C0N A;  2WKD A;  2B63 B;  1F2Y A;  1TU2 B;  1WI5 A;  4HCE A;  3K80 C;  3TN2 A;  4KK7 A;  3RLF A;  2E5L Q;  2K5H A;  3KFU A;  1YIJ A;  1WTQ A;  1E7Z A;  3S2D H;  4LF8 Q;  1VQH A;  4PMB A;  3G4S A;  4KKU A;  3BVZ A;  5L37 A;  3D3R A;  5CV9 A;  1VQE A;  2VQE L;  4OXP A;  1XYI A;  1VQ6 A;  3ITP A;  2K33 A;  4NMZ A;  1LTI D;  1PMR A;  3IL8 A;  3M4Y A;  2CWA A;  5IYC G;  4A3M B;  2EJF C;  4JI1 L;  1LTT D;  3RZO H;  4IFD J;  1C4Q A;  3MVV A;  1VQJ A;  2YV5 A;  1D2B A;  1GXD C;  2F0D A;  4JI4 Q;  3PUV A;  1Y1W G;  3KF6 B;  2VZA A;  1C8C A;  3EBE A;  2KCT A;  1ILP A;  2N55 A;  4I65 A;  4JI6 Q;  4DK3 C;  3PV0 A;  3S1N B;  4A3I G;  1VQN A;  4BY1 H;  3D4D A;  2R7Z H;  1RTN A;  3GTK B;  3U9S A;  1IKL A;  2JQO A;  3HG9 A;  5DAU A;  3C3L A;  1BR9 A;  1WVL A;  1YJ9 A;  1EQQ A;  3K5N A;  1E1O A;  3KDF A;  4IFD I;  1TWH B;  3HS0 C;  4WJ3 M;  2EJM A;  3WOF A;  4C3J G;  1DON A;  2WAQ G;  1NAP A;  4HIK A;  2SDF A;  3BDC A;  1T5E A;  4LFB Q;  2K52 A;  4OHJ A;  3K7U C;  1LTL A;  3D31 A;  4R4O A;  4OWT B;  4HR7 B;  2I07 B;  2Z6K C;  4X62 L;  4Y7N H;  1XMO L;  4RMF A;  3S17 B;  1HZA A;  3BDO A;  1PTO B;  1SDF A;  2JA5 H;  3S16 B;  3TS0 A;  1CKM A;  3RZD H;  4A3G H;  2PZW A;  2BA0 A;  4UP9 A;  2JA7 B;  1EWI A;  1PH9 A;  2H4O A;  4LF9 Q;  1EOV A;  2KHJ A;  4AYB G;  3MXN B;  1VQ5 A;  2R7D A;  2WFW A;  2IWH A;  2WAQ E;  3I70 A;  2F0K A;  1ENA A;  1X3Q A;  2UU9 L;  2UUA L;  3HEJ A;  4C2M B;  2ZTC A;  5COY A;  1RJT A;  5FJ8 H;  1HNZ L;  2MP1 A;  1XPO A;  3K5L A;  1WCM H;  5IP7 H;  2HUG A;  2A5H A;  3KF6 A;  3GTJ H;  4HAE A;  4NW2 A;  4DUY Q;  2PCF B;  1PZK D;  4RHR A;  1S5B D;  2ZM6 Q;  2JXM B;  1FVI A;  3OTO L;  2QF7 A;  5LL6 S;  3J80 L;  5HY6 A;  1YJW A;  2ASB A;  4QJF A;  3N52 A;  4DAY B;  2M00 A;  4LUO A;  4AYB E;  5JJZ A;  2EYM A;  3CCU A;  1KDC A;  1KRS A;  1MKH A;  1CKO A;  5CV4 A;  4B9W A;  4PZ7 A;  1HXY D;  4P74 A;  5JPM C;  3PUY A;  1HNW L;  1I94 Q;  3ER0 A;  1XPU A;  1Z47 A;  5C4J B;  2R93 G;  1Y1W B;  1HZC A;  4HCS A;  4QCL A;  1QZG A;  4GKJ L;  3HKZ E;  4YCV A;  3HOU G;  3PGZ A;  5J22 A;  4LF5 Q;  4YHH L;  2YTY A;  2A6E D;  4A3B G;  2IPK D;  2AWN A;  4IOA A;  1B9N A;  3TRE A;  1OO9 B;  5HGT A;  4A3I B;  3GD7 A;  1VQB A;  2IJ0 A;  1QVC A;  2KHS A;  3G48 A;  5ELD A;  1R9T H;  4NXM Q;  2GVB A;  1I3Q B;  1DJR D;  4ILW A;  2OT2 A;  1GUW A;  1MBY A;  2R61 A;  1K73 C;  3MXN A;  4HTH A;  4C3J B;  2FMC A;  2I5H A;  4IJL A;  1STG A;  2WAQ B;  4ULL A;  3J7Z C;  3U4Z A;  4FF3 A;  5EKI A;  1YI2 A;  1E24 A;  2CHB D;  1ASY A;  4ODG A;  2AMC B;  3GTQ B;  1YJN A;  3D6C A;  3CHB D;  4MN3 A;  5CV8 A;  3GTL H;  3MWY W;  1AZP A;  2VB2 X;  1XNQ L;  1X56 A;  2F0V A;  3DWQ A;  1WTW A;  5C0X H;  4CDF C;  4RCN A;  3WOE A;  1KNA A;  1B44 D;  2XRS D;  4WRD A;  2VUM H;  1K3R A;  5TSS A;  4H13 C;  4J1M A;  4AYB B;  5EKK A;  3A7A B;  2F3W A;  4DAY A;  5H1S E;  4LFC Q;  3CW2 C;  1SSO A;  1KAW A;  3R93 A;  4OO1 H;  3ULP A;  3NBI A;  3VYS A;  1VQO A;  4HJ8 A;  3HOZ H;  4KKT A;  4QUC A;  2R6G A;  1VQF A;  3PUX A;  4KY6 A;  3VR5 A;  3NK9 A;  4ZLT F;  1PYS B;  3HKZ B;  5M5X B;  3M4P A;  4L6T B;  2B2Y A;  3KUP A;  1UEA B;  3BVM A;  1K83 H;  3IRB A;  1IBL L;  3J80 E;  3G6J B;  2UXC Q;  2FXQ A;  4U68 A;  1BF4 A;  4BY1 G;  4Y52 H;  3ERQ A;  5KIX A;  1WTP A;  1A63 A;  5GQO A;  4BXX H;  4KD4 A;  3MEH A;  2CWP A;  2AQ2 B;  1B7Y B;  3J80 c;  2B63 H;  2RA4 A;  3GV3 A;  4P2C B;  2V1C C;  5JOB A;  3S1R B;  2R93 B;  4KV6 A;  5LMU L;  1EUJ A;  2K04 A;  2F0N A;  1SE4 A;  4HIO A;  1MI2 A;  4JBK A;  5BN5 A;  4DK0 A;  4CKB A;  4DUZ Q;  3LWU A;  4XIG S;  2B2U A;  1CM9 A;  4LAA A;  4UAI A;  3U9O A;  1CI3 M;  1TXY A;  2KUM A;  3FP9 A;  1Y8N B;  1S5E D;  1EFI D;  5JJK A;  3KYH C;  1EYG A;  3JAM i;  4KY5 A;  1X3F A;  2CQA A;  5FKA C;  4JI8 Q;  2JA5 G;  5I9P A;  4DV6 Q;  1EIY B;  4A3M H;  1HNX L;  1JJG A;  4XQJ A;  2J0T D;  5M5W B;  1SND A;  2HCI A;  1X3P A;  3PIP 3;  4A3K G;  2CVR A;  3DWA A;  3I90 A;  4DXG A;  4GKK L;  1EQV A;  2N49 A;  1Z9F A;  1WTR A;  4QMG A;  4N8F A;  5JEA G;  1I6V C;  4GLX A;  4A3F B;  1CSP A;  2F0P A;  5FJ8 G;  1AFP A;  1G29 1;  1PYB A;  2FFK B;  1WTH A;  1WCM G;  4JBJ A;  5IP7 G;  1EY5 A;  2LFN A;  4O0A A;  1CHP D;  2JN4 A;  1EQR A;  4YY3 L;  3AFP A;  4DAM A;  3S1N H;  3Q6S A;  1PTO C;  2K01 A;  3BJU A;  2V4D A;  3CRK C;  4C3I B;  2WB1 G;  3GTK H;  1G2S A;  3DEP A;  3SXH A;  4LF4 Q;  1A3V A;  3MXU A;  1HTP A;  5CV7 A;  3LNN A;  1TWH H;  4OIJ A;  3ULJ A;  5IYD G;  1YNJ C;  1BOS A;  2NN6 H;  1HR0 Q;  5IT9 L;  5FK9 C;  3ZJY C;  1N34 L;  1F9R A;  3TEH B;  3C1F A;  3PIP A;  5CR3 A;  3KBG A;  3GTP B;  4HSP A;  1S5C D;  3H3V I;  2JA8 G;  3KLW A;  3O13 A;  3J81 i;  4IZ8 A;  5IGF A;  2PI2 A;  3S17 H;  2L55 A;  1BQQ T;  1FGU A;  1NJI C;  3CCR A;  3H09 A;  1Z52 A;  3S16 H;  2WB1 E;  2IT1 A;  4L8J A;  4BY7 G;  2JA7 H;  4LF7 Q;  3A55 A;  1IKM A;  5IY0 A;  3NXW A;  1Q1B A;  3OIP A;  1S4Z A;  1U4L A;  1A3U A;  2WIN B;  4K5V A;  2WV6 D;  4WOR A;  4OEL B;  4R4T A;  3HOX G;  1PRE A;  4C2M H;  3F2B A;  4RFB A;  4GZY C;  2F0L A;  5ELO A;  2F0S A;  3GTM B;  2B2Y C;  4K0K Q;  1KTK A;  1PH6 A;  3HOV G;  1AH9 A;  1A3T A;  1Q90 A;  1OXS C;  3F8T A;  5IYC H;  3HFZ B;  5EPL A;  1VF7 A;  2NVY B;  4JV5 L;  1O78 A;  1Q46 A;  2HT1 A;  2G9H D;  2VUM G;  4A3K B;  2K5V A;  2LSS A;  5DEH A;  1ENF A;  1LT6 D;  3CCS A;  5C4J H;  1JR0 D;  1TS5 A;  4GOP B;  1Y1W H;  4OO1 G;  1J5E L;  4JI3 Q;  4OWW B;  1VQG A;  4N9T A;  2EYL A;  2B2U C;  1RL2 A;  2D0O A;  5M5Y B;  4EVO A;  3H0G B;  2VL6 A;  4B3M L;  1H9M A;  4DV2 L;  3V96 A;  4LUZ A;  5CV5 A;  1I4P A;  3RN2 A;  4A3I H;  2QW7 A;  2WB1 B;  4JC0 A;  3URY A;  1I3Q H;  1BVS A;  2K5N A;  3KBX A;  2G5D A;  1EZ6 A;  3SDZ A;  3Q0A A;  4DV0 L;  1I4R A;  5CMD A;  3BYY B;  1NBW A;  2Z4H A;  4C3J H;  5LHY 1;  1PFM A;  2IX3 A;  4F87 A;  1PH1 A;  1CSQ A;  5AFW A;  2B63 G;  1G2T A;  1FR3 A;  3OYY A;  4PV1 C;  2QEJ C;  1YHQ A;  1KRT A;  5D65 A;  3GTQ H;  2JA8 B;  4IFD G;  1RHP A;  1UEB A;  2OTL A;  3I4N G;  3I7F A;  5IT9 c;  1N33 Q;  3CCJ A;  1Q8K A;  2EJG C;  2Z9H A;  4K5W A;  4A3C H;  4IUT A;  1HA6 A;  4X66 L;  4ME5 A;  4LUV A;  2EYP A;  4BY7 B;  1VF5 C;  2EE1 A;  3EQL C;  5C4H A;  2VS1 A;  4OX9 L;  2C9O A;  1ZXT A;  4A3M G;  1JOQ A;  1UE5 A;  2B2V A;  1AP0 A;  2NTS A;  3S9W A;  1LT5 D;  2BDN A;  4DR5 L;  3HOX B;  3L0O A;  1KIX A;  3K5M A;  4RGN A;  4QF4 A;  2LY7 A;  4RHS A;  2AWO A;  4XQN A;  3S14 B;  3GTG B;  1E22 A;  1B70 B;  2F0M A;  1CK1 A;  4QB4 A;  1EYC A;  1QCB D;  4GOP A;  1CFM A;  3OWF A;  1CUK A;  1K8O A;  2DJF C;  1SNM A;  3STB D;  5M5X H;  4XT1 B;  3H6M A;  1PXU A;  3W1B A;  3GV6 A;  4JBW A;  4TVA B;  1VS0 A;  4K8I A;  1JQY D;  4FO2 A;  4JI5 L;  4YWK A;  2FMM A;  1DGS A;  1EWH A;  3SK6 A;  2I5M X;  1PH7 A;  4J8Q A;  4LF6 L;  3IFT A;  4ALP A;  5C3E G;  3C0O A;  4GLV B;  2KJX A;  4DV3 L;  3PIO 3;  1PFB A;  1YNN C;  2Y0S E;  1DM0 B;  2F0G A;  4ZUI A;  1U0L A;  4TKO B;  3F2U A;  4PQX A;  3S1R H;  2R93 H;  4OIK A;  3QB3 A;  4DV7 L;  1PH4 A;  2BH2 A;  3UE0 A;  3UDG A;  2LS0 1;  1CQF A;  4DAP A;  4KD3 A;  4GLA C;  3OMG A;  1Q3L A;  4IQZ A;  1F9S A;  2VNU D;  3AYH B;  5M3M G;  3GQB A;  1HJP A;  1X32 A;  1DD2 A;  2CCZ A;  3RD4 A;  1L0W A;  1A2U A;  4JG2 A;  1TWF B;  1SE3 A;  3AQQ A;  3H15 A;  4OWX B;  4AQY Q;  1H9K A;  4DR6 Q;  4KMU C;  1TWG B;  3QR8 A;  1WTV A;  5M5W H;  1UE1 A;  5F2D A;  4S3S A;  2BE5 C;  2VW9 A;  1XTC D;  1C0A A;  2A68 C;  4JI0 L;  3NQI A;  4IPH A;  4CBV A;  1IBM Q;  3KJO A;  4G7H C;  1JC7 A;  4L5T A;  1N8R C;  5C44 G;  1G8Z D;  4RGM A;  4A3F H;  3C2P A;  2PQE A;  3NPP A;  3JAM E;  3CC7 A;  1HA5 A;  1I5F A;  2ZJR A;  3X3N A;  1FGB D;  3I4N B;  1NMG A;  5JVG 3;  1SRO A;  3OWE B;  2QA4 A;  2JE6 I;  3T51 B;  3RN5 A;  4H7B A;  1PH5 A;  1FNW A;  2OQK A;  4DV5 Q;  3JAM c;  1ZYR D;  2EYJ A;  4DR7 Q;  4C3I H;  1U4P A;  4P75 A;  2VQE Q;  1E3P A;  5E1F A;  1PYW D;  2D2C C;  1STN A;  2M9V A;  2RBM A;  2P5Z X;  4AH6 A;  3M4O B;  2E5L L;  2UUB L;  2XWJ B;  1CHQ D;  4JI1 Q;  2MGS A;  3ND8 A;  4TSS A;  2EXZ A;  3TDQ A;  4KHP Q;  5JJI A;  3T56 B;  3P75 A;  2EIF A;  3SVM A;  2F0U A;  5CBE E;  4DR1 L;  1VQP A;  3QJY A;  1Y69 U;  1U4R A;  1K0R A;  1TS4 A;  3GTP H;  1DOM A;  2JEB I;  2D5D A;  2ENB A;  4RH6 A;  1KDA A;  4JW0 A;  1QVF A;  1ZYR C;  2CW0 C;  3FHW A;  4PMC A;  4MHE A;  2JYO A;  3MXG A;  1A62 A;  1O7Z A;  2FIN B;  2B39 A;  3DLL A;  1YZ6 A;  5C3E B;  4K14 A;  2A73 B;  3RLO A;  2B2V C;  4LFA Q;  4DXF A;  3ZYY X;  4CDD C;  3CCE A;  1KL9 A;  5DNF A;  4YIJ A;  4F8M A;  3TME A;  1V43 A;  4A3L H;  3T1H L;  3S15 B;  2IX1 A;  4GOP C;  2CH4 A;  1ZKO A;  3BS1 A;  4JI6 L;  1QOH A;  5M9O A;  2F0Q A;  2I46 A;  3MAQ A;  3GTM H;  4GS3 A;  3SE0 A;  3BZK A;  3J7A V;  5M3M B;  3J81 j;  2Q8R E;  4A93 B;  3T1Y L;  1C48 A;  5E4X A;  1PA6 A;  4YCU A;  5I6W A;  4A3C G;  2MO1 A;  3P7J A;  3MEF A;  3V2T A;  3MXP A;  5AJ3 Q;  2FHT A;  2NVY H;  4EQP A;  2N8N A;  3D8G A;  1TKW B;  1FJG L;  4LFB L;  1BCP B;  4A3K H;  3L3O C;  2HIX A;  2PQA B;  2C35 B;  4XXE A;  5C44 B;  1HUN A;  5JEA H;  2UU9 Q;  2L9H A;  2UUA Q;  1DCZ A;  3A74 A;  4FXG C;  3TP6 A;  3I8Z A;  3VA7 A;  1V9P A;  1LTR D;  4R4C A;  5M5Y H;  5CV6 A;  2KED A;  5IP9 H;  5FO8 B;  3HKZ G;  3H0G H;  4HSV A;  2KBN A;  3U50 C;  5EBC A;  4KJN A;  5A35 A;  4IUN A;  2C5C A;  3RNU A;  4HJ7 A;  1IYJ B;  1M4V A;  4IUU A;  1ASZ A;  3VR4 A;  5KEE A;  4A75 A;  3OTO Q;  2ZXO A;  4HID A;  2WP8 J;  4KN7 C;  4YWL A;  1P16 A;  3MZ5 A;  4MNO A;  2NB0 A;  3T4A C;  3VYT A;  5I6Y A;  5IYD H;  2F0J A;  1HR0 W;  2Q2U A;  1X9N A;  1GUT A;  1XTD A;  3T13 A;  4NXN Q;  4R8N A;  3E6Z X;  2K6A A;  4HN7 A;  4XYQ A;  4UHV A;  1F9Q A;  2JA8 H;  5LL6 X;  2PPB C;  2ATW A;  3OW2 A;  4GKJ Q;  1VQ9 A;  1U5K A;  4HED A;  4A4I A;  4U67 3;  4V19 0;  4WFN 3;  4YHH Q;  1I4Q A;  1I50 B;  5IWA L;  3C46 A;  1I4X A;  1VDZ A;  5IIF A;  3HOW G;  5HUR A;  4DGZ A;  4BY7 H;  3CXC A;  3TQY A;  3MTS A;  1TWA B;  5EPK A;  1JOK A;  2Q2I A;  3IKJ A;  2B3G A;  2IHE A;  3QOL A;  5E7N A;  4IUR A;  4NDX A;  3HOX H;  1EY0 A;  1D5X C;  1YNX A;  3S14 H;  1A0I A;  2PQA A;  3GTG H;  4CKC A;  1Q8I A;  4EQ5 A;  2K75 A;  3K5O A;  4JVZ A;  5GAE C;  5IOC A;  2BH8 A;  2Q2T A;  2F4V Q;  1EZ8 A;  4A3F G;  2VY3 A;  2MHV A;  3HOV H;  4XT3 B;  4DNI A;  2QCP X;  2K5Q A;  3A0J A;  4O2D A;  4IN3 A;  1XNQ Q;  1SYD A;  3M85 A;  2VQF Q;  1Y8O B;  1V1Q A;  2EYH A;  4RGT A;  4C3I G;  2QEX A;  3UDF A;  1ONL A;  3CU7 A;  2KEC A;  2OWO A;  3CF5 A;  3Q8D A;  5D14 A;  1BDO A;  4DR4 L;  2A1A A;  2PNR C;  1JOO A;  1EQT A;  1GHJ A;  3DM1 A;  4G7O C;  4DNT B;  5ELC A;  3J7A 5;  2XSC A;  3NWT A;  3W5O A;  1N36 L;  1B8A A;  4X64 L;  1N9W A;  4IJH A;  5JPN C;  1EIH A;  3N6R A;  4IUP A;  2J4X A;  2NWG A;  1D1I A;  1QWY A;  1I4G A;  1TT2 A;  2ZTD A;  4R4I A;  4XTC S;  3MFG A;  1GD7 A;  3FMC A;  2B8F A;  3NUC A;  1TWF H;  2AQ1 B;  4UY8 C;  5LMN Q;  1F2Z A;  4B3R L;  1TWG H;  3K8A A;  2YTX A;  3U58 A;  2ZXP A;  5C4Z A;  1M8A A;  4KTA A;  1VMP A;  1PVO A;  3H94 A;  2E75 C;  3B6Y A;  4ID6 A;  1SYF A;  1B1Z A;  4ZRZ A;  1W6K A;  4C1N I;  1EWC A;  1LLR D;  2NVT B;  2KCM A;  2BA1 A;  4A3L G;  2HIV A;  5LMU Q;  4XYO A;  5C5M A;  4IFD H;  1JWS D;  1TWC B;  3I4N H;  1F77 A;  1YBY A;  2EZV A;  1ROD A;  3OW7 A;  1OTC A;  1IBK L;  2IHF A;  1B3Q A;  4DV4 L;  1YVC A;  2UXD Q;  3HOW B;  5IGE A;  1V1P B;  3RUZ A;  3ERO A;  2E2J B;  1MJE A;  1PTO D;  3G71 A;  3M4O H;  3LWE A;  5ELE A;  2NVQ B;  3M3Y B;  1FNV A;  4X3U A;  1VQK A;  5C6A A;  2X6G A;  1KC8 C;  4ZYS A;  1YNJ D;  2MQH A;  4H44 C;  5KNC A;  1PHJ A;  3R3O A;  5KYI A;  1TY0 A;  4BWG B;  1BNZ A;  3I4M G;  3OMC A;  1E2W A;  4DV6 L;  3M9B A;  3AMU A;  5DLQ E;  1EFW A;  1AN8 A;  5IP9 G;  1LTA D;  1MSG A;  3H0G G;  4YY3 Q;  2F3V A;  3I2Z A;  1SYB A;  2K4K A;  5C3E H;  4G7Z C;  1JJC B;  1N32 L;  2XVS A;  1RD9 D;  2GN5 A;  1HHV A;  4AIM A;  1YIT A;  4DA2 A;  3T53 B;  3DM3 A;  1BCP C;  1WD0 A;  2CFM A;  1B9M A;  1EY8 A;  4O1N A;  5KNB A;  5BN4 A;  5KGU A;  4L5R C;  3S15 H;  3DEO A;  3BZD B;  3KLS A;  3QOJ A;  4GN4 B;  1NSN S;  3AU7 A;  3KLR A;  1N34 Q;  1CA5 A;  2WAC A;  1TQO A;  1FD7 D;  5JJL A;  1TR5 A;  1YHB A;  3NEN A;  4JI2 Q;  5M3M H;  4LF4 L;  3TRZ A;  2EYO A;  4A93 H;  3DXJ C;  4IOC A;  1NE3 A;  2KEE A;  3LX0 A;  1PTO H;  3BG3 A;  3QIA A;  1PH2 A;  2L12 A;  3VA5 A;  1EY9 A;  1ILQ A;  4JBM A;  1V1P A;  1VMC A;  5IOD A;  2PW5 A;  2PYK A;  3UDX A;  1HQR D;  1PTO F;  4QQB X;  2VXW A;  1NTG A;  3E9H A;  4R1J A;  2OXP A;  3NTK A;  1K8M A;  5C44 H;  2H1E A;  5JVH 3;  5NUC A;  4BBR B;  1G6Z A;  2J7Z A;  3PSI A;  3CD6 A;  5EJW A;  4I7Z C;  1S5F D;  2NVX B;  4IUV A;  1KLU D;  2QDL A;  3TS2 A;  1RCV D;  4PMW A;  3HZX A;  4B3T Q;  2L11 A;  1WJJ A;  2DN8 A;  4JK1 C;  3CME A;  2SOB A;  4QIW E;  4B3S L;  4G57 A;  4L63 B;  4TQU S;  3SK8 A;  5A2Q E;  2Q8I B;  2NUC A;  4KKS A;  3CQZ B;  5CGK A;  1J9O A;  3CPF A;  4JV5 Q;  1C7Y A;  5IGB A;  4I7A A;  2R7F A;  1STY A;  2ES2 A;  4DR3 L;  5FO9 B;  3A5U A;  1GUO A;  2PMZ E;  1VQM A;  2L15 A;  5KND A;  1LAC A;  2EY2 A;  1DXM A;  2A8V A;  1NMF A;  2EXD A;  3QWN A;  3ND9 A;  3I4M B;  1EIF A;  4RWS C;  3MA2 B;  2KVM A;  1I50 H;  4DNR B;  3R2I A;  3GTO B;  4B3M Q;  1G91 A;  5C3X A;  4RKB A;  1Z6H A;  3S1M B;  1DZ1 A;  3G7L A;  1EY7 A;  4CJ2 C;  1LV9 A;  2HHH Q;  4H0L C;  4IPG A;  1HQM C;  2HDL A;  2KA7 A;  1TWA H;  3NP8 A;  3FEW X;  1H9J A;  3K7A B;  4K6D A;  2A74 C;  3SGI A;  1S40 A;  1M1K C;  2UXB L;  3E3X A;  1H9R A;  1E1T A;  4X65 L;  1TY2 A;  4DR2 Q;  2BDO A;  1SXT A;  2YYZ A;  1IYU A;  4RCO A;  3JAM L;  5EKL A;  1GOZ A;  2Z6B A;  4NP5 A;  2MUY A;  3GDE A;  3GO5 A;  1NY4 A;  2BCO A;  1DYQ A;  3M7G A;  4APV A;  4DN4 M;  4X66 Q;  1CA6 A;  4R8I A;  4NPS A;  4R4Q A;  1Q12 A;  4QIW B;  3OOC A;  1VQI A;  4HJ9 A;  2DUD A;  3TZU A;  5EPJ A;  1A2T A;  1XNR L;  3E0J A;  3I73 A;  4YCW A;  2JA6 G;  2JSO A;  4K2L A;  3S1Q B;  2Y0S G;  1YNN D;  4DR5 Q;  1PRT B;  2AUJ D;  1W6J A;  1AE2 A;  1N33 L;  4OON A;  2E8G A;  3K6O A;  5K5P A;  3A8I E;  1UUP A;  2Z1C A;  3AEV A;  5E3F A;  2PMZ B;  2IY5 B;  3BU2 A;  4JYA L;  4PNY A;  1WTO A;  3R2T A;  4KN4 C;  1CQV A;  2RQX A;  4ZUJ A;  3RLN A;  1MIU A;  3CC4 A;  1QG7 A;  5C5L A;  2X6L A;  4K8J A;  1HH2 P;  1KNE A;  4OEM B;  4F7X A;  3H3V C;  3K59 A;  5BR8 Q;  1B2T A;  4GNX B;  1SFO B;  2F0I A;  3KJP A;  1LTB D;  2QDB A;  2RCN A;  5KRU A;  1IL8 A;  1IYV A;  2RDH A;  1XXG A;  2BE5 D;  5CBA E;  3J81 L;  2NVT H;  2A68 D;  3L7Z C;  3UI2 A;  4CHT B;  2R92 G;  3MHB A;  1SMY C;  4EX5 A;  4DV7 Q;  4QL5 A; 
#chains in the Genus database with same CATH homology
 3MC0 B;  2E2I B;  2PZU A;  1EYD A;  3C0M A;  1O7L A;  3OHX C;  1CTM A;  1OXX K;  2DNE A;  1SJE D;  1TS2 A;  1MSH A;  5K36 G;  3ONA B;  1IW7 C;  2O4X A;  4FF4 A;  1QB5 D;  1RF2 D;  3SEB A;  1LTG D;  1B4O A;  5C0X J;  5J1Z A;  1EU3 A;  4F88 A;  2DNC A;  3EVQ A;  2RKS A;  4A3J B;  5I4D A;  1GJX A;  3BVG A;  2JEA I;  3K58 A;  1L0Y B;  1RDP D;  2CW0 D;  2A69 C;  2RSO A;  1XX8 A;  4V0B A;  3TBI B;  3TP7 A;  4KJO A;  1O7Y A;  1VCI A;  2JA6 B;  2GA4 B;  1UNS A;  5C0X I;  2Y0S B;  1JOR A;  4J6H A;  2ZT9 C;  2RSN A;  3W2D A;  1JCK B;  1LT4 D;  1QNU A;  2F0F A;  2B2W A;  4MIU A;  4C3H B;  4OO1 I;  5M3F B;  1STH A;  3T16 A;  2VB3 X;  1D5M C;  2L1B A;  2MPM A;  1NCV A;  4Q0F A;  1QJO A;  2FJ2 A;  1CZG A;  1SAP A;  3EFX D;  4X3K A;  3J81 E;  3TZD A;  1SYG A;  2R92 B;  3KLS X;  3KK7 A;  1HFN A;  1BUV T;  4FYD A;  3FKI B;  4C56 C;  3A8K E;  1D5Z C;  2EVB A;  1I6H B;  4HMI A;  1GHK A;  4TRD A;  3PO3 B;  3GP7 A;  2EPB A;  2RVL A;  3PUZ A;  1SNQ A;  2NBF A;  4UDU C;  4K2K A;  3EJI A;  1R4P B;  3FPU B;  2O2L D;  2NTT A;  1PRT D;  1DOK A;  3VYU A;  3G4N A;  1Y8P B;  1HPC A;  5D3D A;  3HP3 A;  2N88 A;  3FPP A;  4DFA A;  3J7A F;  5D3I B;  5C4X B;  1EY4 A;  5CC4 A;  4BBS B;  2WII B;  1RTO A;  3A8J E;  3I3C A;  5J39 A;  1F2L A;  2YU9 B;  5I2Y A;  5FOB B;  2LMC B;  5JAV A;  3IFD A;  1PRT C;  3MFY A;  1PLF A;  4WJW A;  4A3E B;  1ET6 A;  2AUK A;  4FNF A;  3RMH A;  1Q1E A;  2NN6 I;  5FO7 B;  3SK5 A;  4FXK C;  3VR2 A;  2QIL A;  3HOY B;  3R8B A;  3EA6 A;  5DM7 3;  4EQN A;  5DM6 3;  5C3W A;  1EL0 A;  5FLX L;  4A3D B;  4FXD A;  1PRT F;  2B2W C;  4ABN A;  4IAL A;  1E2Z A;  2L4N A;  1PDQ A;  3K57 A;  2E2D C;  1NR4 A;  4E6I A;  1IHZ A;  1D1K A;  4CGY B;  5KYL A;  1WTX A;  1GUN A;  5I2X A;  3NE5 B;  2E76 C;  1SNP A;  3PO2 B;  5G3L D;  2A6E C;  4B9X A;  1JB3 A;  5BN3 A;  3D6W A;  4OL7 A;  5COR A;  3K0Y A;  3NTI A;  2M2L A;  3NTH A;  1EEF D;  1PFN A;  2HQE A;  4X3T A;  1GUG A;  2Q8T A;  4XDX A;  1PZJ D;  3A56 A;  2F0W A;  2K7V A;  2F1M A;  3C1E A;  4XQQ A;  3CRL C;  3V05 A;  1JIC A;  1A6X A;  4EQO A;  3H91 A;  1OXU A;  1WD1 A;  3Q24 A;  1QIL A;  4DF7 A;  4FF2 A;  4R9W A;  1E0B A;  3FVQ A;  1BBX C;  1XWE A;  2K28 A;  2K1B A;  5EBD A;  1O80 A;  1STA A;  1SNO A;  1Y1V B;  2KCC A;  1LO5 D;  3QO2 A;  2QKI C;  1ENC A;  1SYC A;  1LTS D;  1SBB B;  1U9R A;  1T5X D;  4RA8 A;  3HGB A;  4DU9 A;  1OXT A;  4Z9C B;  4FF1 A;  2EY5 A;  2O5I C;  2HCC A;  2E2H B;  4ZAI A;  1CZW A;  5A2Q L;  4M1U B;  5FLX E;  5I9O A;  2F4I A;  1TVX A;  1LAB A;  3NQT A;  3PMF A;  1EEI D;  5T1I A;  3HOU B;  1BCP D;  3SR1 A;  2XIW A;  5G3L F;  4A3B B;  3S2H B;  5ELF A;  4RKL A;  4K5X A;  4OGQ C;  2EDG A;  1H9S B;  3L9A X;  2E74 C;  1SEB D;  2LKV A;  5EQ0 A;  2X69 A;  1CT1 D;  2B2T A;  2G9D A;  4X3S A;  1AW7 A;  4O42 A;  1U4M A;  3IAY A;  1J8I A;  1ML0 D;  2EY6 A;  2OEO A;  3I72 A;  1B3A A;  2ICI A;  3AB9 A;  2F03 A;  2IL8 A;  4LJZ C;  3DHQ A;  4RAU C;  3S2D B;  2IX0 A;  2F0O A;  2PO4 A;  5CYU A;  3SK4 A;  4KI0 A;  1SYE A;  2ID0 A;  1F9P A;  4ZKC B;  3KF8 A;  4N9P A;  3J7Y W;  1BXT A;  2F0T A;  2K32 A;  1MGS A;  3RZO B;  2AQ3 B;  3WDN A;  4ZQ3 A;  5K36 H;  5ELB A;  1MD2 D;  1SE2 A;  3QG1 A;  3A7L A;  1STB A;  3M7N A;  2KCN A;  1EIG A;  1JE4 A;  1DOL A;  5EGT A;  3BDL A;  1BCP F;  5IGG A;  1HCZ A;  3I91 A;  3OPO A;  1TII D;  4KHZ A;  1STE A;  3NWS A;  2NZ1 D;  1V1O A;  1ESR A;  1H9S A;  3Q22 A;  4BY1 B;  3BYT B;  4FP5 D;  2R7Z B;  1QE6 A;  5IGC A;  2KOL A;  4KHV A;  1JWM D;  2B8G A;  2A6H D;  1FYC A;  3TP8 A;  2SEB D;  1HFG A;  2TSS A;  2MJ8 A;  3FDT A;  1ET9 A;  3OIQ A;  1ESF A;  4Y7N B;  1E2V A;  3TP5 A;  2DY7 A;  1B53 A;  3VYR A;  2XNA C;  4ZK9 B;  2JA5 B;  2F0H A;  5C0X G;  3NSW A;  3RZD B;  4A3G B;  3P20 A;  2O5J C;  1R4Q B;  2L0C A;  2A6H C;  5E4W C;  2K5W A;  1A15 A;  1AZQ A;  3DUZ A;  3D4W A;  4DAV A;  1SJH D;  3P1H A;  3W3A A;  1WCM B;  1KLG D;  3E5S A;  3D4R A;  2PW7 A;  2HDM A;  3GTJ B;  2RDF A;  5ISR A;  1F2M A;  1JWU D;  1LT3 D;  4HMJ A;  1HUM A;  1EYA A;  4IUQ A;  2JP1 A;  2B2T C;  2EOT A;  4RGO S;  5JEA J;  3NBH A;  2EYF A;  1GUS A;  2F0E A;  4CJ0 B;  5IT9 E;  1SNC A;  2IW3 A;  1HTL D;  2ICE C;  2XRQ D;  3X3M A;  1D6E C;  4LMQ D;  2OF1 A;  3TSS A;  1BO0 A;  4K6L A;  4C1N K;  1KDB A;  4G4K A;  3SHL A;  1EOT A;  5IGD A;  3HRZ C;  1S5D D;  1TS3 A;  2PZT A;  1NUC A;  2TMP A;  1OXV A;  1SMY D;  4CJ1 B;  3FRP B;  1QNK A;  3G4O A;  4DK1 A;  1R9T B;  4C3H G;  3A54 A;  2K05 A;  2D9U A;  1V8Q A;  2SNS A;  3NHH A;  3DMU A;  4BS9 A;  1L0X B;  4B08 A;  2Z4I A;  1IW7 D;  3HOV B;  2KQ3 A;  3GTL B;  3I4L A;  1II3 A;  1KAB A;  4BA2 I;  3Q23 A;  1FNU A;  4CKE A;  2EY1 A;  1NR2 A;  1UAP A;  4EGV A;  2ZXR A;  2K03 A;  2WKC A;  3OSO A;  2VUM B;  2RDG A;  1I4H A;  1ZEQ X;  3DWP A;  3VR3 A;  4NKL A;  1HRJ A;  4M8A A;  2R3Z A;  4ZKB B;  1PZI D;  2A69 D;  2NN6 G;  2Z8L A;  3HOZ B;  1RKN A;  4FVM A;  2XWB B;  4KY7 A;  1B50 A;  1EY6 A;  1Z7T A;  2SNM A;  4BA1 I;  2L5T A;  3CKI B;  1KAA A;  2BOS A;  3VR6 A;  2DY8 A;  1K83 B;  3PUW A;  4Q5V A;  4LK1 C;  2D62 A;  2NYZ D;  2K5D A;  1EU4 A;  1AEX A;  4QUF A;  1ICW A;  5T1G A;  2XN9 C;  3C0N A;  2WKD A;  2B63 B;  1F2Y A;  1TU2 B;  4HCE A;  3TN2 A;  4KK7 A;  3RLF A;  1WTQ A;  4PMB A;  4KKU A;  3BVZ A;  3D3R A;  5CV9 A;  1XYI A;  3ITP A;  2K33 A;  4NMZ A;  1LTI D;  1PMR A;  3IL8 A;  3M4Y A;  4A3M B;  2EJF C;  1LTT D;  4IFD J;  1C4Q A;  3MVV A;  1D2B A;  1GXD C;  2F0D A;  3PUV A;  1C8C A;  1ILP A;  2N55 A;  4I65 A;  3PV0 A;  3S1N B;  3D4D A;  1RTN A;  3GTK B;  3U9S A;  1IKL A;  3HG9 A;  5DAU A;  3C3L A;  1BR9 A;  1WVL A;  3K5N A;  4IFD I;  1TWH B;  3HS0 C;  2EJM A;  3WOF A;  4C3J G;  1DON A;  1NAP A;  2SDF A;  3BDC A;  1T5E A;  4OHJ A;  3D31 A;  4HR7 B;  2I07 B;  3S17 B;  3BDO A;  1PTO B;  1SDF A;  3S16 B;  2PZW A;  2BA0 A;  2JA7 B;  2H4O A;  2IWH A;  3I70 A;  2F0K A;  1ENA A;  1X3Q A;  3HEJ A;  4C2M B;  5COY A;  1RJT A;  2MP1 A;  3K5L A;  2HUG A;  2A5H A;  4HAE A;  4NW2 A;  2PCF B;  1PZK D;  4RHR A;  1S5B D;  2JXM B;  2QF7 A;  5LL6 S;  3J80 L;  3N52 A;  2M00 A;  5JJZ A;  2EYM A;  1KDC A;  4B9W A;  5CV4 A;  1HXY D;  5JPM C;  3PUY A;  1Z47 A;  5C4J B;  1Y1W B;  4HCS A;  4QCL A;  5J22 A;  2A6E D;  2IPK D;  2AWN A;  1B9N A;  1OO9 B;  5HGT A;  4A3I B;  3GD7 A;  2IJ0 A;  2KHS A;  5ELD A;  1I3Q B;  1DJR D;  4ILW A;  2OT2 A;  1GUW A;  1MBY A;  2R61 A;  3MXN A;  4HTH A;  4C3J B;  2FMC A;  1STG A;  2WAQ B;  4ULL A;  4FF3 A;  5EKI A;  2CHB D;  4ODG A;  3GTQ B;  3D6C A;  3CHB D;  4MN3 A;  5CV8 A;  3MWY W;  1AZP A;  2VB2 X;  2F0V A;  3DWQ A;  1WTW A;  5C0X H;  4RCN A;  3WOE A;  1KNA A;  1B44 D;  2XRS D;  4WRD A;  5TSS A;  4H13 C;  4J1M A;  4AYB B;  5EKK A;  3A7A B;  2F3W A;  4DAY A;  1SSO A;  3R93 A;  4OO1 H;  3NBI A;  3VYS A;  4KKT A;  4QUC A;  2R6G A;  3PUX A;  4KY6 A;  3VR5 A;  3NK9 A;  4ZLT F;  3HKZ B;  5M5X B;  4L6T B;  2B2Y A;  3KUP A;  1UEA B;  3BVM A;  3J80 E;  3G6J B;  4U68 A;  1BF4 A;  3ERQ A;  5KIX A;  1WTP A;  4KD4 A;  3MEH A;  2AQ2 B;  2RA4 A;  3GV3 A;  4P2C B;  5JOB A;  3S1R B;  2R93 B;  4KV6 A;  2K04 A;  2F0N A;  1SE4 A;  1MI2 A;  5BN5 A;  4DK0 A;  4CKB A;  3LWU A;  4XIG S;  2B2U A;  1CM9 A;  4LAA A;  4UAI A;  3U9O A;  1CI3 M;  2KUM A;  1Y8N B;  1S5E D;  1EFI D;  4KY5 A;  5FKA C;  2CQA A;  5I9P A;  4XQJ A;  2J0T D;  5M5W B;  1SND A;  2HCI A;  1X3P A;  3PIP 3;  2CVR A;  3DWA A;  3I90 A;  4DXG A;  1EQV A;  1WTR A;  4QMG A;  5JEA G;  1I6V C;  4A3F B;  2F0P A;  1AFP A;  1G29 1;  2FFK B;  1EY5 A;  2LFN A;  1CHP D;  3Q6S A;  1PTO C;  2K01 A;  2V4D A;  3CRK C;  4C3I B;  1G2S A;  3DEP A;  3SXH A;  1A3V A;  3MXU A;  1HTP A;  5CV7 A;  3LNN A;  4OIJ A;  1YNJ C;  1BOS A;  2NN6 H;  5IT9 L;  5FK9 C;  1F9R A;  3C1F A;  5CR3 A;  3KBG A;  3GTP B;  4HSP A;  1S5C D;  3O13 A;  4IZ8 A;  5IGF A;  2L55 A;  1BQQ T;  3H09 A;  1Z52 A;  2IT1 A;  4L8J A;  3A55 A;  1IKM A;  3NXW A;  1Q1B A;  3OIP A;  1S4Z A;  1U4L A;  1A3U A;  2WIN B;  4K5V A;  2WV6 D;  4WOR A;  1PRE A;  4RFB A;  4GZY C;  2F0L A;  2F0S A;  3GTM B;  2B2Y C;  1KTK A;  1A3T A;  1Q90 A;  1OXS C;  5EPL A;  1VF7 A;  2NVY B;  1O78 A;  2G9H D;  4A3K B;  5DEH A;  1ENF A;  1LT6 D;  1JR0 D;  1TS5 A;  4OO1 G;  4N9T A;  2EYL A;  2B2U C;  5M5Y B;  4EVO A;  3H0G B;  1H9M A;  3V96 A;  5CV5 A;  1I4P A;  2WB1 B;  3URY A;  3KBX A;  1EZ6 A;  3SDZ A;  3Q0A A;  1I4R A;  5CMD A;  3BYY B;  2Z4H A;  5LHY 1;  1PFM A;  2IX3 A;  4F87 A;  5AFW A;  1G2T A;  1FR3 A;  4PV1 C;  2QEJ C;  5D65 A;  2JA8 B;  4IFD G;  1RHP A;  2EJG C;  4K5W A;  4IUT A;  1HA6 A;  4ME5 A;  2EYP A;  4BY7 B;  1VF5 C;  2EE1 A;  3EQL C;  5C4H A;  2C9O A;  1ZXT A;  1JOQ A;  2B2V A;  1AP0 A;  2NTS A;  3S9W A;  1LT5 D;  2BDN A;  3HOX B;  3K5M A;  4RGN A;  4QF4 A;  2LY7 A;  4RHS A;  2AWO A;  4XQN A;  3S14 B;  3GTG B;  2F0M A;  1CK1 A;  4QB4 A;  1EYC A;  1QCB D;  1CFM A;  3OWF A;  1K8O A;  1SNM A;  4XT1 B;  3H6M A;  1PXU A;  3GV6 A;  4JBW A;  4K8I A;  1JQY D;  4FO2 A;  2FMM A;  1EWH A;  3SK6 A;  4J8Q A;  3IFT A;  3C0O A;  2KJX A;  3PIO 3;  1PFB A;  1YNN C;  1DM0 B;  2F0G A;  4ZUI A;  4TKO B;  3F2U A;  4PQX A;  4OIK A;  3QB3 A;  2LS0 1;  1CQF A;  4DAP A;  4KD3 A;  3OMG A;  1Q3L A;  4IQZ A;  1F9S A;  2VNU D;  3GQB A;  1X32 A;  1DD2 A;  3RD4 A;  1A2U A;  1TWF B;  1SE3 A;  1H9K A;  4KMU C;  1TWG B;  1WTV A;  5F2D A;  4S3S A;  2BE5 C;  1XTC D;  2A68 C;  3NQI A;  4CBV A;  4G7H C;  1JC7 A;  1G8Z D;  4RGM A;  3C2P A;  2PQE A;  3NPP A;  3JAM E;  1HA5 A;  3X3N A;  1FGB D;  3I4N B;  5JVG 3;  3OWE B;  2JE6 I;  3T51 B;  4H7B A;  1FNW A;  1ZYR D;  2EYJ A;  1U4P A;  5E1F A;  1PYW D;  2D2C C;  1STN A;  2M9V A;  2RBM A;  3M4O B;  2XWJ B;  1CHQ D;  2MGS A;  3ND8 A;  4TSS A;  2EXZ A;  3TDQ A;  3T56 B;  3P75 A;  3SVM A;  2F0U A;  5CBE E;  3QJY A;  1Y69 U;  1U4R A;  1TS4 A;  1DOM A;  2JEB I;  2D5D A;  2ENB A;  4RH6 A;  1KDA A;  1ZYR C;  2CW0 C;  4PMC A;  4MHE A;  2JYO A;  3MXG A;  1O7Z A;  2FIN B;  2B39 A;  5C3E B;  4K14 A;  2A73 B;  2B2V C;  4DXF A;  3ZYY X;  5DNF A;  4YIJ A;  4F8M A;  3TME A;  1V43 A;  3S15 B;  2IX1 A;  1ZKO A;  3BS1 A;  1QOH A;  5M9O A;  2F0Q A;  2I46 A;  3MAQ A;  3SE0 A;  3J7A V;  5M3M B;  2Q8R E;  4A93 B;  1C48 A;  5E4X A;  5I6W A;  3P7J A;  3V2T A;  3MXP A;  2FHT A;  4EQP A;  3D8G A;  1TKW B;  1BCP B;  3L3O C;  4XXE A;  5C44 B;  1HUN A;  5JEA H;  2L9H A;  1DCZ A;  4FXG C;  3TP6 A;  3I8Z A;  3VA7 A;  1LTR D;  5CV6 A;  2KED A;  5FO8 B;  4HSV A;  5EBC A;  4KJN A;  5A35 A;  4IUN A;  2C5C A;  1M4V A;  4IUU A;  3VR4 A;  5KEE A;  2ZXO A;  2WP8 J;  4KN7 C;  3MZ5 A;  2NB0 A;  3T4A C;  3VYT A;  5I6Y A;  2F0J A;  1GUT A;  3T13 A;  4R8N A;  3E6Z X;  2K6A A;  4HN7 A;  4XYQ A;  1F9Q A;  5LL6 X;  2PPB C;  4HED A;  4U67 3;  4V19 0;  4WFN 3;  1I4Q A;  1I50 B;  3C46 A;  1I4X A;  1VDZ A;  5IIF A;  5HUR A;  4DGZ A;  3MTS A;  1TWA B;  5EPK A;  1JOK A;  3IKJ A;  3QOL A;  4IUR A;  4NDX A;  1EY0 A;  1D5X C;  4CKC A;  1Q8I A;  3K5O A;  5IOC A;  1EZ8 A;  2MHV A;  4XT3 B;  2QCP X;  2K5Q A;  4IN3 A;  1SYD A;  3M85 A;  1Y8O B;  2EYH A;  4RGT A;  4C3I G;  1ONL A;  3CU7 A;  2KEC A;  5D14 A;  1BDO A;  2PNR C;  1JOO A;  1EQT A;  1GHJ A;  3DM1 A;  4G7O C;  4DNT B;  5ELC A;  2XSC A;  3NWT A;  5JPN C;  1EIH A;  3N6R A;  4IUP A;  2J4X A;  2NWG A;  1D1I A;  1QWY A;  1I4G A;  1TT2 A;  4XTC S;  3MFG A;  3FMC A;  2B8F A;  3NUC A;  2AQ1 B;  1F2Z A;  2ZXP A;  5C4Z A;  1M8A A;  4KTA A;  1VMP A;  3H94 A;  2E75 C;  4ID6 A;  1SYF A;  1B1Z A;  4ZRZ A;  1W6K A;  4C1N I;  1EWC A;  1LLR D;  2NVT B;  2BA1 A;  4XYO A;  5C5M A;  4IFD H;  1JWS D;  1TWC B;  1F77 A;  2EZV A;  1ROD A;  3OW7 A;  3HOW B;  5IGE A;  1V1P B;  3RUZ A;  3ERO A;  2E2J B;  1PTO D;  3LWE A;  5ELE A;  2NVQ B;  3M3Y B;  1FNV A;  4X3U A;  5C6A A;  2X6G A;  4ZYS A;  1YNJ D;  4H44 C;  5KNC A;  3R3O A;  5KYI A;  1TY0 A;  4BWG B;  1BNZ A;  3OMC A;  1E2W A;  3AMU A;  1AN8 A;  1LTA D;  1MSG A;  2F3V A;  1SYB A;  4G7Z C;  2XVS A;  1RD9 D;  1HHV A;  4DA2 A;  3T53 B;  1BCP C;  1WD0 A;  1B9M A;  1EY8 A;  4O1N A;  5KNB A;  5BN4 A;  5KGU A;  3DEO A;  3BZD B;  3KLS A;  3QOJ A;  1NSN S;  3AU7 A;  3KLR A;  1CA5 A;  2WAC A;  1TQO A;  1FD7 D;  1TR5 A;  2EYO A;  3DXJ C;  2KEE A;  1PTO H;  3BG3 A;  3LX0 A;  3QIA A;  2L12 A;  3VA5 A;  1EY9 A;  1ILQ A;  1V1P A;  1VMC A;  5IOD A;  2PW5 A;  2PYK A;  1HQR D;  1PTO F;  2VXW A;  2OXP A;  3NTK A;  1K8M A;  2H1E A;  5JVH 3;  5NUC A;  4BBR B;  1G6Z A;  2J7Z A;  5EJW A;  4I7Z C;  1S5F D;  2NVX B;  4IUV A;  1KLU D;  1RCV D;  4PMW A;  3HZX A;  2L11 A;  2DN8 A;  4JK1 C;  2SOB A;  4G57 A;  4L63 B;  4TQU S;  3SK8 A;  5A2Q E;  2Q8I B;  2NUC A;  4KKS A;  3CQZ B;  5CGK A;  1J9O A;  5IGB A;  1STY A;  5FO9 B;  1GUO A;  5KND A;  1LAC A;  2EY2 A;  1DXM A;  3QWN A;  3ND9 A;  3I4M B;  4RWS C;  3MA2 B;  2KVM A;  4DNR B;  3R2I A;  3GTO B;  1G91 A;  5C3X A;  4RKB A;  1Z6H A;  3S1M B;  1DZ1 A;  3G7L A;  1EY7 A;  4CJ2 C;  1LV9 A;  4H0L C;  1HQM C;  2HDL A;  2KA7 A;  3FEW X;  3NP8 A;  1H9J A;  3K7A B;  4K6D A;  2A74 C;  1H9R A;  1TY2 A;  2BDO A;  1SXT A;  2YYZ A;  1IYU A;  4RCO A;  3JAM L;  5EKL A;  1GOZ A;  4NP5 A;  2MUY A;  3GO5 A;  2BCO A;  1DYQ A;  3M7G A;  4DN4 M;  1CA6 A;  4R8I A;  1Q12 A;  4QIW B;  3OOC A;  3TZU A;  5EPJ A;  1A2T A;  3E0J A;  3I73 A;  2JSO A;  4K2L A;  3S1Q B;  1YNN D;  1PRT B;  2AUJ D;  1W6J A;  3K6O A;  5K5P A;  3A8I E;  1UUP A;  2Z1C A;  5E3F A;  2PMZ B;  4PNY A;  1WTO A;  3R2T A;  4KN4 C;  1CQV A;  2RQX A;  4ZUJ A;  1QG7 A;  5C5L A;  2X6L A;  4K8J A;  1KNE A;  4F7X A;  3H3V C;  3K59 A;  1B2T A;  1SFO B;  2F0I A;  1LTB D;  2QDB A;  5KRU A;  1IL8 A;  1IYV A;  2RDH A;  1XXG A;  2BE5 D;  5CBA E;  3J81 L;  2A68 D;  3L7Z C;  3UI2 A;  4CHT B;  3MHB A;  1SMY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...