1BCPC

Binary complex of pertussis toxin and atp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
C PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpC01
1HA5A 1LT3D 2Z8LA 2XNAC 4L63B 3GP7A 1SE3A 1RF2D 1EEFD 2RDGA 1BCPF 4UDUC 1TS3A 5ELCA 1B44D 1JQYD 2O2LD 1KLUD 4ZYSA 5D3DA 2IPKD 1V1PA 1TS2A 4RHRA 3DWQA 3G4OA 1TS4A 1LO5D 5TSSA 1AN8A 1SJHD 1XTCD 4Z9CB 1LTBD 3URYA 3BVZA 1CHPD 1FNWA 3EA6A 2J4XA 4RGOS 1S5ED 5I4DA 4RGNA 1ET9A 2TSSA 4BWGB 1HQRD 1PZID 3BVGA 1ET6A 5D3IB 3MC0B 1SE2A 3BVMA 3R2IA 5ELEA 1S5FD 3KLSX 1PRTC 1PRTB 1LT6D 3V05A 1TS5A 1ESFA 1FNUA 1I4RA 1LTTD 1RCVD 3BYTB 2AQ1B 1D5ZC 1S5BD 1LTAD 1PRTD 2AQ2B 1LTID 3TSSA 1JCKB 1SBBB 1EWCA 4RH6A 3G4NA 3W2DA 2XRSD 1PTOH 1CK1A 1AW7A 3EFXD 4K6LA 5ELFA 1Z52A 1SE4A 1JWUD 1B1ZA 1I4HA 4OHJA 1PREA 3SEBA 1PRTF 1DYQA 1LTSD 3BYYB 2NTSA 1I4PA 1CT1D 1V1PB 3MFGA 2ICIA 1EU4A 1EFID 1G8ZD 1T5XD 2SEBD 1RDPD 2XN9C 1JR0D 1JWMD 3OWEB 1LTRD 1I4GA 1PZJD 1D6EC 2QEJC 2QILA 1SJED 5ELBA 1LTGD 4C56C 4TSSA 4L6TB 1EU3A 1XXGA 5FK9C 1LT5D 1SEBD 1PYWD 4RGTA 4DXGA 1QILA 1D5MC 1I4XA 1M4VA 1PTOC 1PTOB 1EEID 2IJ0A 3C0NA 1L0XB 1HTLD 3C0MA 3DWAA 1PTOD 4RCOA 3DWPA 3R2TA 4O1NA 2CHBD 1S5DD 1GOZA 1D5XC 1I4QA 2AQ3B 2XRQD 4DXFA 3C0OA 1SXTA 3CHBD 1CQVA 5ELDA 2WV6D 1DJRD 1JWSD 1STEA 3BZDB 4RFBA 1BCPC 1BCPB 1PZKD 1UNSA 1KTKA 1V1OA 2G9HD 1RD9D 2NTTA 1FGBD 1ENFA 1L0YB 1PTOF 1FNVA 4RGMA 1BCPD 1TY0A 2RDHA 5FKAC 1TY2A 4RHSA 1BXTA 1HXYD 1LLRD 1S5CD 3O13A 1FD7D 1CHQD 1LT4D 1UUPA 1MD2D 1KLGD 1F77A 2R61A 3R8BA
chains in the Genus database with same CATH superfamily
4ZQ3A 2F0LA 3EIVA 4GKJQ 5IYCH 2JJQA 5AFWA 3E0EA 4G4KA 2K4KA 2FJ2A 1SN8A 2XWBB 1IBLL 2UU9Q 1PFBA 1TS3A 1B44D 4C3HG 3IL8A 2WFWA 4BY7G 4ZYSA 2CH4W 2JA9A 1WTQA 4CJ2C 4PMCA 1V1PA 1B9MA 4RHRA 3I4NG 1BVSA 3ULPA 1PH6A 1AE2A 1AN8A 5G3LD 4H02A 2J4XA 2UXDL 1SMYD 3TREA 1TXYA 2LY7A 1ESRA 1HUNA 3MAQA 3I90A 4HJ8A 1WOCA 2M2LA 4XYQA 3U58A 5ELEA 1LT6D 2Y0SE 1IBML 4HEDA 4M8AA 1Y8NB 3M85A 4BBRH 5EGTA 2F0TA 2OQ0A 2B2YA 1CKOA 2XRSD 4FXKC 2NYZD 4E6IA 1KRTA 1NR2A 1HA6A 1V43A 4MNOA 1XMQQ 1YJ9A 1JOKA 2FFKB 2IX0A 1JWUD 2QEXA 3S1NB 1EY9A 4KJOA 1ASYA 3H3VH 4GKKQ 4KKTA 4JI4Q 4K2LA 1EFID 2M9VA 3WWVA 4JI2L 2OCEA 4IURA 1KXLA 3OWEB 4NKLA 3MXUA 1LTRD 2D0OA 4LF6L 1D6EC 1ZXTA 2UXCQ 5IT9L 4DK3C 1EY4A 4R4IA 4APVA 2F0MA 1CKNB 2F3VA 4OONA 1H9KA 5FOBB 3VYRA 3C0MA 1MBYA 4DFAA 3KF6B 4DUYL 2GVAA 2EIFA 5IE8A 2MNAA 4DXFA 5KYIA 5GADC 1YJWA 2VY3A 3P20A 3NBHB 4IPDA 2IL8A 4RA8A 2PMZB 2R7ZB 1F2MA 1KRSA 3HG9A 1D2BA 4JBKA 5J39A 3OIPA 1TU2B 3W3AA 4GNXB 3NTIA 4FF1A 4EGVA 3JAME 1YNNC 2Z8LA 3LGJA 4OO1I 2C9OA 1UE7A 4QY7A 5FO9B 1HUMA 3A8JE 1F2ZA 4JI1Q 4UAIA 1I6HB 1TS4A 2PZWA 3MEHA 4KN4C 1PLFA 4YCWA 1LTBD 1II3A 5C3WA 1WD1A 2MO1A 1PVOA 3RN5A 5I2XA 1VQ6A 1YI2A 5JJKA 1K9MC 5LMNW 2TSSA 3S1NH 3NUCA 1TT2A 1PHJA 1L1OB 5IYDG 1ET6A 3BZCA 4TKOB 1X3EA 4XYOA 1HZCA 2L5TA 1YEZA 2L11A 4JI8Q 2G5DA 2F0NA 4IUVA 2V1CC 3OPOA 2N3SA 3W2DA 2FHTA 3J80L 1WI5A 3PO2G 4JI5L 2VQEQ 1AW7A 4LF7L 1PH1A 3A7AB 1PRTF 4DKAC 3PIP3 5HY6A 5M3FG 1XPUA 2WP8J 4WJ4A 3CC7A 4Y7NB 2R92B 1NMGA 2Z1CA 1SYEA 5JOBA 5FLMH 3PCOB 3PUVA 3W1GA 1N36Q 4LF5Q 4LFAL 1C7YA 1UWVA 2E74C 1GKHA 3SDZA 2R7ZH 2F0JA 1EU3A 2EYOA 2RBMA 3SGIA 5IY0A 2DGYA 1LT5D 4FP5D 4DXGA 1QILA 4F87A 3J81j 1N34Q 3RLFA 4A3CG 1F9QA 4FDBA 1KHIA 2ZTCA 1VQAA 3CMEA 4DGZA 4RCOA 5D65A 1S5DD 4YCUA 1QVGA 1I4QA 4OWXB 5JPMC 3C0OA 1BOSA 1STEA 3L7ZC 5CYUA 1I6HH 3RNUA 2EZVA 1QUQB 1UNSA 2K14A 4HIDA 1CSQA 3JAML 2E2IB 2XWJB 4RGMA 3N52A 2RDHA 3PIOA 5A35A 2EDGA 1S40A 3BG3A 2LKVA 3BDOA 3FEWX 1F77A 5IP7H 5E1FA 2I07B 1STHA 2K5WA 1VQIA 2PW7A 3GO5A 1YHAA 2IWHA 1HPCA 1B50A 1ZYRD 4BY1B 4A93B 2O2LD 3GTMB 3CW2C 1KLUD 1BUVT 4IFDH 3PQIA 1B3AA 1E7ZA 3I72A 3OWFA 2KJXA 2OWOA 1JMCA 2E2DC 1XTCD 3I4LA 4DR5L 1CFMA 4MHEA 2EYFA 1O78A 1JB3A 3W5OA 1HZBA 3M3YB 4RGOS 3NXWA 1SNDA 2JP1A 1IBLQ 1W6JA 3MA2B 3OW7A 1VQ9A 1Z47A 1QOHA 2E5LL 3CP0A 1SR3A 3NK9A 5CMDA 1YJNA 5JVG3 2F3IA 3QG1A 4IUUA 3KF6A 1V9PA 1PRTB 4Y7NH 4JCVE 2R92H 1DOMA 3N6RA 1LTTD 2F0OA 1PRTD 2A6HD 2F0QA 4XTCS 3F2BA 2UXDQ 3NBHA 3QWNA 1STYA 4KD4A 4KHZA 2XSCA 4R8IA 3MZ5A 4CKCA 2NUCA 1O7LA 4G7HC 4DK6C 5C3XA 1I50B 3CU7A 3SEBA 4DR2L 4GNXA 3T53B 2AKWB 1IBMQ 2JK8A 3Q23A 1WFQA 3L3OC 2GN5A 2NN6G 3ND8A 2AHOB 2FXQA 4X65L 4YHHQ 2X69A 4HIKA 2E2IH 3HOYG 4J1MA 5EBDA 5CV8A 3KK7A 1JOOA 2UUAL 1M4VA 4KJNA 3D4RA 4JVZA 1NMFA 2ENBA 4PNYA 5JJIA 1D7QA 4IALA 4EQNA 1SNCA 4JI2Q 2OEOA 4JI6L 4LF6Q 5C4JB 1L1OA 5IWAL 3CHBD 2VW9A 4BY1H 1X3GA 4A93H 3BZDB 3K58A 4PV1C 3GTMH 4L5TA 3VR5A 2B2WA 4K6DA 3KYHC 2F52A 1IW7C 3HOZB 4CDCC 2EYHA 5KYLA 3KDFB 2UXBL 1U9RA 1Q86C 2A69C 4PMBA 2NVXB 3M3YH 5M3MB 4DUYQ 1WTPA 4DK0A 1OXXK 4C3JG 4L63B 1QJOA 2K7VA 5C5LA 2K50A 3AFPA 3RR5A 3UI2A 1TVXA 2ATWA 3IFDA 2VZAA 1X3PA 5COYA 2CVRA 4JOIC 2XTIA 2A8VA 3GTOB 4R9WA 5KNCA 3MTSA 3SK5A 1N32L 3CMAA 1S5ED 1ILPA 4PZ6A 2K5DA 3HFZB 3S2HB 1E0BA 3MXNB 1I50H 3NP8A 3F2CA 1PZID 1UAPA 3CF5A 2B63B 2DNCA 3H3VI 3K80C 2PO4A 3KLSX 3U4VA 4QJFA 1B70B 2RCNA 1XX8A 4LMQD 2Q2TA 1FNUA 3STBD 1D5ZC 2NN6I 5CBEE 5K36G 1JICA 4G57A 1LTID 5T1IA 1QUQA 1I94L 4DPGA 1OXTA 3EFXD 4ZLTF 1J8IA 4IUPA 2UUCL 2JQOA 3JAMi 1PREA 1Q46A 2JA6B 1V1QA 1U0LA 1QE6A 4DK1A 5C4JH 1TIID 3I91A 5DM63 3HZXA 3PV0A 3CPWA 2TMPA 1ENCA 4HIOA 4LF4Q 3M4OB 3HOZH 4JI5Q 2EVBA 4LWCA 3KF8B 3W1BA 4LF7Q 3WOFA 2UXCL 3S2DB 2NVXH 2EY2A 3KLRA 5M3MH 4BXXG 4JBMA 3OYYA 1IXRA 1RJTA 3GD7A 1T5EA 4YWKA 1WTWA 1XJVA 1N33L 2CW0C 3AFQA 2ID0A 4CHTB 5IGEA 4H0LC 3A5UA 3RN2A 1IKLA 4ZK9B 3SK4A 4TVAB 4A3LG 3E0JA 3GTQB 1FGBD 2KECA 3GTOH 1NCVA 4A76A 4A4IA 4POGA 2IHFA 4CDDC 1E3PA 1QZHA 1NSNS 4R1JA 2KUMA 3C46A 3R8BA 2KA7A 3P7JA 4LUZA 3S2HH 5JJLA 3GTPB 1SNMA 1SE3A 2JA8G 2B2TA 2PMZE 2B63H 2F0SA 3F2UA 4UDUC 4K8JA 3A56A 1RKNA 1TS2A 1NJIC 2KCMA 4DV1L 2Q8IB 1Q1BA 3OHXC 1VQGA 1GD7A 1AZPA 5EQ0A 3VDYA 2VUMB 3T4AC 5C0XG 2BA1A 1TWFB 2OF1A 2JA6H 4RKLA 5IOCA 3E5SA 3E9IA 3ICEA 3U9OA 2SOBA 3J7YW 4K14A 5C6AA 1SAPA 4AYBB 4DAPA 4LF8Q 5CBAE 2Z0SA 4DR5Q 1AFPA 1PFMA 2K04A 2Q2UA 3M4OH 3CCLA 1VQBA 1KDCA 3A8KE 4JI8L 3TMEA 4HMJA 1EY5A 2RDFA 2E5LQ 1S3OA 1Y1VB 3CQZB 3S2DH 3CCJA 1PH2A 4K6LA 3KDFA 5ELFA 4HJ5A 1JT8A 2VQEL 3Q8DA 1A15A 2HDMA 3AB9A 2JA7G 1YITA 3A5ZB 2B2UA 1LYLA 3GTQH 2L1BA 1KAAA 1FR3A 4C56C 1IKMA 2CQAA 2ZTDA 1KD1C 1PTOC 3G71A 2CWAA 4DR2Q 3BJUA 3H0GG 1SYCA 1F9SA 5LMNQ 3QB3A 3DWPA 4KD3A 3D8GA 3GTPH 5CORA 2ES2A 3FPUB 1CQVA 3ZJYC 3D4DA 4X65Q 2L0CA 2VS1A 3FHWA 3UDXA 5CV4A 4XT1B 2UUAQ 1L0YB 2YTVA 3K6OA 1SDFA 1Z6HA 1SNPA 1IYJB 4IJLA 1HXYD 4X3KA 1S5CD 4GOPB 1CA5A 3K81C 3SVMA 1Y69U 2VUMH 4A3DG 2E75C 3E6ZX 4H13C 1LT3D 4JI6Q 2PZTA 1TWFH 5IWAQ 5C0XI 1E2WA 3VA5A 2Z9HA 3T1HQ 2EOTA 3NEMA 1AE3A 3VYSA 3ERQA 5ELOA 2WAQB 2OTJA 1VS0A 4ZKBB 4YWLA 2UXBQ 3G6JB 2F0WA 4DV0L 4IOAA 2RKSA 4IPCA 2F0UA 4ZUIA 3UDGA 3URYA 4QUFA 1QB5D 1FNWA 4LFBL 1JE4A 1Y1VH 2Y0SG 3CQZH 2V4DA 1G291 3AMUA 3KF8A 4K5WA 3M9BA 2IHEA 2RSNA 3NPPA 4S3SA 4MN3A 1EOTA 1GVPA 1NY4A 4RG1A 4A3JB 4DV5L 2YTXA 1RCVD 1EUJA 2X6GA 5IIFA 5JEAG 1N32Q 3ERSX 5EPLA 1O7YA 3OW2A 3G4NA 3CC2A 3S17B 1X32A 3PO3G 1JOQA 3MWYW 1VQFA 1HZ9A 1WCMB 5C4XG 4OO1G 3QIAA 1MJCA 4G7OC 3RZOB 1I4PA 3H15A 2WB1B 3J7AV 5GROA 3P75A 1YNXA 1KC8C 4XXEA 2JEBI 1N8RC 1GUWA 1Q82C 4DU9A 3HP3A 4A3KG 2F03A 3HKZB 1I94Q 1EZ6A 2QA4A 1LTGD 4KHPL 4J15A 3PF4A 1WTOA 3SK8A 3VA7A 4RGTA 2UUCQ 2N55A 4IPGA 2M00A 1Q12A 4K8IA 1XNRL 4YHHL 4BS9A 3Q22A 3RLNA 3CRLC 1L0XB 2JA5G 1UE6A 1TWCB 5HURA 2AQ3B 3PUXA 1PMRA 4WRDA 2H1EA 5C44G 1BCPC 1NAPA 2B39A 2K28A 1ENFA 2YV5A 4IPHA 4NXNL 1FNVA 2Q8TA 5C4ZA 5GAEC 3HOUB 1HR0W 1NR4A 1LLRD 3O13A 2PZUA 3U9SA 1XPRA 3HOXB 2RA4A 1N33Q 5JJZA 5DLQE 4FO2A 4K5VA 5CR3A 3ZYYX 1E1TA 1YNND 4ZKCB 3K0XA 4RMFA 3S15B 5C0XJ 4UY8C 4ME3A 4A3JH 2I5MX 4XQNA 4BBSG 1BDOA 1WYDA 1Y14B 3T1YQ 4JI7L 2IX1A 4DF7A 1G2TA 2SNSA 2R6GA 4JC0A 1BF4A 4LNQA 2DY8A 3EVQA 3S17H 1WD0A 1ILQA 4IUNA 4QUCA 5LMUL 4DV2L 1WCMH 2KEEA 4QGUA 2BDNA 3BVGA 2R93G 2IY5B 4ODGA 1W3SA 2DJGC 4I65A 4QMGA 3CRKC 4HSVA 3RZOH 1ICWA 2PCFB 4NDXA 1SYDA 4DV1Q 3A55A 3TP7A 2PNHA 3NWSA 4IO9A 2Z6KA 2I0QA 1TWGB 1M90C 5LL6S 4I7AA 4N9TA 3HOVB 1BNZA 2B2VA 1TWHB 4GOPA 5I9PA 2HCIA 4PZ7A 2K5NA 1VQ4A 4GS3A 1Q90A 1DYQA 1LTSD 4A3MG 1X56A 1TWCH 2EE1A 2FMMA 1B53A 4YCVA 1H9RA 1EY0A 4GN3B 3U4ZA 4B3MQ 3HOUH 3NWTA 4B9XA 2F0DA 1D5MC 1I4XA 3OTOL 4ULLA 2ZJPA 4LF4L 2ZTEA 1PXUA 4OELB 2DUDA 3HOXH 4XDXA 5AJ3L 4KKUA 1JORA 4PG3A 4LK1C 1ONLA 1J9OA 3S15H 4IQZA 1G6PA 3K8AA 1BR9A 4OGQC 1KABA 3CPFA 4HSPA 1TY0A 3E3XA 2L9HA 3OOCA 4NMZA 1CM9A 3S24A 2EY1A 1EY6A 4KY7A 4KV6A 2R61A 4NB3A 4N8FA 5DEHA 5CV6A 1MHWC 1WJJA 2D9UA 1EEFD 2RDGA 3TRZA 5ELCA 3FMCA 2ZJQA 2EXZA 2R3ZA 3G4OA 1X3QA 2F0HA 5EPJA 1LABA 3UDIA 2K6AA 1CHPD 4KY5A 1TWGH 1PH5A 4DA2A 1HHVA 4X3SA 3FKIB 5JEAJ 3HOVH 4K5XA 2A68C 3MXPA 4A3EG 5J22A 4KKSA 1TWHH 1HR0L 2L12A 4IJHA 4ME5A 5IYCG 3I2ZA 1ZEQX 4OL7A 2JXMB 4DV0Q 4PMWA 1QCBD 3PF5A 5C3EB 1S5BD 1VQJA 2X6LA 4ZUJA 4LFBQ 4DR6L 4LF8L 2HIVA 2L55A 4HCEA 2ZXOA 1YNJC 1CK1A 3FPPA 3CCSA 1BKBA 1SYBA 4AYBE 1CKNA 3TS0A 4WFN3 4DV5Q 1HNWQ 1KIXA 3J81c 3A7LA 2D62A 1PA6A 4CKBA 4C2MB 4FVMA 2A6EC 1PZJD 4QL5A 5IGCA 1LACA 2QKIC 1DOKA 1Q8IA 4BBRG 5FK9C 3K5MA 4HJ7A 1TWAB 4EQOA 1WTVA 1A8VA 4F7XA 1DD2A 2B3GA 4P75A 1BO0A 3I4OA 2BOSA 3ITPA 1CZGA 4DUZL 2PPBC 3OMCA 2KEDA 4R4OA 5FLXE 3A74A 1Y8OB 4PQXA 5LMNL 1K8MA 4KHPQ 2OXPA 1R4PB 2F4VQ 5CV5A 1QWYA 1ENAA 1BBWA 1JE5A 2A73B 5T1GA 3DUZA 1O7ZA 1XNRQ 3C1FA 5FKAC 3KFUA 5KIXA 1D1IA 4JG2A 1IW7D 5H1SE 3F2DA 2D5DA 3BZKA 3FKIH 2K05A 1KLGD 3AYHB 1EIHA 2O5IC 2A69D 4X62L 4JPBW 4NXMQ 3HGBA 1ICFB 3I4MB 3H91A 4LFCL 1GO3E 2ICEC 4NXNQ 3I4NB 3T1HL 5IYBH 3KLWA 3MVVA 3GQBA 1K8GA 2CKZB 5C3EH 5M5XB 3OIQA 2ZJRA 1F9RA 3S1RB 2E76C 3PUZA 3JC66 2MUYA 1SE2A 4JI0Q 1FYCA 1A62A 3BDLA 1GUSA 4JI7Q 2WB1G 2KENA 1KQSA 4C2MH 3BYTB 2VXWA 1LV9A 1HFNA 3QOJA 2ALYB 3TSSA 1C8CA 5DAUA 3GV3A 1OXVA 3H09A 1Y8PB 5LMUQ 4DV2Q 3TP6A 1TWAH 1EQRA 3K7AB 5I9OA 1P16A 2J7ZA 4GZYC 2MP1A 1MIUA 2KCTA 1Z52A 1B1ZA 2F0PA 3L9AX 1H9JA 3D6CA 3K59A 1WTRA 1MGSA 3BYYB 3GV6A 5CGKA 3J81i 4LUOA 2RHQB 2PNRC 1A6XA 5J1ZA 1TR5A 3R3OA 1SYFA 4YIJA 2IT1A 3TS2A 1EL0A 4DR1L 1Q3LA 2DJFC 2WB1E 2Q8RE 1AH9A 2FMCA 5ELNA 4O1NA 1Q8KA 3HKZE 3HRZC 3D4WA 4KK7A 2BDOA 3I4MH 1DCZA 2KHIA 5ELDA 2WV6D 1VQEA 2CW0D 1NUCA 5I6WA 3I4NH 5HGTA 3UE0A 3ULLA 5FLMG 3OTOQ 4HIMA 3C3LA 1PTOF 2EY5A 1X65A 2K32A 4ZRZA 3KJPA 3GTLB 5M5XH 3GTKB 2R7ZG 4A3GB 4DN4M 1NBWA 3S1RH 5AJ3Q 1CHQD 1LT4D 5LL6X 1EYDA 3I70A 4RCNA 3G6EA 3TEHB 1NE3A 1EYCA 2XNAC 3VR2A 3K5LA 1X9NA 5DNFA 1GUTA 4ABNA 1YHQA 5IGBA 1DOLA 3C1EA 3EJIA 2SDFA 2RVLA 3NENA 1E1OA 1UEAB 1AP0A 1B4OA 5JAVA 3ND9A 2AUKA 4HR7B 2B8FA 1K3RA 3T1YL 4A3BB 5E4XA 3EA6A 1HTPA 2B29A 1RODA 3K7AH 1M8AA 1ML0D 4KI0A 5IP7G 2E8GA 3CCQA 1EOVA 4X64L 1E2VA 3NELA 1S5FD 3SXHA 5FLXc 2A74C 3DEOA 2E2JB 2N49A 1B7YB 1RTNA 3CC4A 1K73C 4LW1A 2EJGC 1Y1WB 2EXDA 2AQ1B 2RCFA 1H9SB 4IFDG 5GQOA 4FF4A 2MHVA 1EWCA 1HNZQ 1HH2P 2VB2X 4CDFC 4CKEA 3PO2B 2O5JC 2K5HA 1A3VA 2JYOA 5A2QE 1DXMA 1HR0Q 1G91A 3GTGB 2ZXPA 3T56B 4DV3Q 5M3FB 4R4QA 4Y52H 2BE5C 1SRUA 2KBNA 4OWWB 3CKIB 3OMGA 2ICIA 1VQKA 3X3NA 1VMPA 2R92G 1I4GA 4DR6Q 1G51A 2QEJC 5ELBA 2C35B 4A3IB 3GTLH 3VR3A 1XXGA 4DAYB 3GTKH 4A3GH 4JOIA 2MGSA 1H95A 1PTOB 1TKWB 1VDZA 3PGZA 3QO2A 3CXCA 4B3ML 5IODA 2ZT9C 3G7LA 4P72A 3DWAA 1PTOD 2CHBD 2SNMA 4EQ5A 4GLXA 2AWNA 1D5XC 4B3SQ 1CTMA 2LXJA 1RL2A 4JK1C 1DJRD 1R4QB 2A1AA 3AU7A 3EN2A 2B2YC 4RKBA 2KCNA 1U4LA 3M4QA 2NTTA 2H5XA 1DONA 3SHLA 2PQAB 3WOEA 2MQHA 1BXTA 3CCMA 4K0KL 4A3BH 3MHBA 1R9TB 4DUZQ 4IZ8A 1FL0A 4NW2A 2VB3X 4KTAA 1HFGA 4G7ZC 5IYDH 3M4PA 2DNEA 4R4TA 1Q1EA 5JVH3 1RF2D 1BCPF 3MXNA 4DNTB 2E2JH 4BY1G 5JPNC 1VQHA 1VQCA 4A93G 2BH8A 1Y1WH 1IL8A 4IFDI 1NNXA 5C3EG 1IBKL 1EFWA 4HTHA 1SJHD 1F2YA 3BVZA 3PO2H 3SE0A 5DM73 5D14A 2ZXRA 3DMUA 1PV4A 4X62Q 4UHVA 3TZDA 3GTGH 1ET9A 1HNXQ 1S72A 3KBXA 4OX9L 2EQSA 1HQRD 5M3FH 3IFTA 5E4WC 4HAEA 5D3IB 3HS0C 4LFCQ 2NZ1D 3K7UC 5KNBA 5KNDA 4GLVB 4CBVA 2UUBL 4KLKA 3I73A 5A2QL 4I7ZC 1I6VC 3I56A 2HUGA 4A3IH 1RIPA 4J8QA 1A3UA 4A3CH 1PTOH 4ILWA 1VQ8A 2EYJA 1XMOL 4UP7A 2NZHA 4DR3L 1J5EL 4L5RC 1QG7A 1EIYB 5BN4A 4Q5VA 2IW3A 1KNEA 1YHBA 1RTOA 1N9WA 1GM5A 4AQYL 4ZCKA 1HNWL 3HOYB 3AEVA 2NWGA 1STAA 4LF9L 2QDBA 1KDAA 4QB4A 4C3IB 2XGTA 4ID6A 4XT3B 1CI3M 1R9TH 2HIXA 1VQLA 2AUJD 1I5FA 5IP9H 2HHHL 1MJEA 3H3VC 2HQLA 4XIGS 5J3BA 4GN5A 1OXUA 1C9OA 3I4MG 5K5PA 4LAAA 3X3MA 4MTKA 1BCPB 2GVBA 3SK6A 2G9HD 4OXPA 4ALPA 4DR1Q 1BCPD 4A75A 1O80A 3HOZG 4DNRB 1H9SA 5I2YA 2F4VL 1MI2A 4C3JB 1JB7A 1MD2D 5M3MG 1SROA 3TQYA 1IZ6A 3D31A 1CKMA 3TP5A 1Q7YC 3CD6A 1UEBA 1A2UA 4NXML 1B2TA 1A3TA 1K83B 4BA1I 1PFNA 1B3QA 1LO5D 5TSSA 5C5MA 4TRDA 1SMYC 1K0SA 1AZQA 3HOWB 1TQOA 3P1HA 4P2CB 3Q24A 1JJGA 4IFDJ 1X6OA 1PH9A 4DV4L 4DAYA 3LX0A 1XNQL 1L2FA 5NUCA 3J7AF 3J80E 1OXSC 1X54A 5HGQA 1DM0B 3R2IA 3NQTA 3J81E 2OTLA 1EY7A 2B63G 1XTDA 3V05A 2NN6H 3MFYA 1I4RA 4JI0L 1E24A 2N78A 3FVQA 3HOYH 2NZOA 1LM0A 2MFIA 2A19A 4JW0A 4QIWB 4WJ3M 2EJMA 2KOLA 4C3IH 4X3TA 3NQIA 2PQAA 4X64Q 3V96A 5FJ8H 2RQXA 3H6MA 2JA6G 1D1KA 3LWUA 3RZDB 2KHSA 3RUZA 4U68A 2I46A 2L4NA 1KDBA 3Q0AA 2R7FA 4L6TB 3L0OA 4EQPA 3T51B 4A3GG 2F4IA 4C3JH 2WACA 1GHJA 2HCCA 3F1ZA 3IKJA 3R2TA 5EPKA 1G2SA 3D3RA 1JC7A 2KQ3A 4GLAC 3NSWA 4N8X1 1PH8A 1EIFA 1K83H 1U4PA 3DXJC 1RD9D 2EYMA 4HMIA 1HJPA 1FGUA 3IRBA 1BBXC 3HOWH 2CWPA 3PUWA 4NPSA 4A3BG 1KNAA 3LNNA 4GNXC 4B3TL 1UUPA 4A3FB 1K8AC 4CJ0B 1DGSA 1P8LA 5IT9c 4JV5L 2JA8B 4B3RL 3PIO3 5BN3A 5E7NA 2F0FA 1SFOB 2CFMA 1JQYD 5EJWA 5M9OA 5D3DA 5K36H 2IPKD 3E9HA 4UP9A 3QOLA 4K0KQ 1Y1WG 1FJGL 4OWTB 4X3UA 2JN4A 3EBEA 4MIUA 3J81L 1T9HA 4DR4L 1L1OC 3F8TA 2HT1A 2VUMG 2C5CA 2JEAI 2A68D 4X66L 2B2WC 1EQVA 2LS01 4FF2A 3NTKA 3A54A 2Z6BA 3RZDH 1IBKQ 4YY3L 4AYBG 1IYVA 4DAMA 1KAWA 1W6KA 2AQ2B 2LXKA 1CUKA 3A0JA 1JCKB 5CC4A 3DLLA 4A3IG 1FVIA 1SNQA 1HQMC 4N9PA 4OIKA 2YTYA 5IGGA 4OX9Q 3MEFA 1HRJA 3AQQA 4BXXH 2VQFL 1Y1VG 1HNZL 1QVCA 1I4HA 4GN4B 3R93A 1YNJD 3I3CA 2UUBQ 2NTSA 2JA7B 2K75A 4DV3L 1X55A 1EU4A 4A3LH 1D8LA 1T5XD 2ZM6L 2XN9C 1JWMD 3S16B 5F2DA 1W2BA 2OT2A 2NB0A 2F0GA 1LUZA 1VQ5A 4TSSA 3KLSA 4DAVA 2B8GA 2A6ED 4IUQA 1SEBD 1XYIA 1VMCA 1XMOQ 3H0GB 3PIPA 4DR3Q 4IUTA 1J5EQ 2IJ0A 5CV7A 1Q81C 4A3FH 3NHHA 3IAYA 1IL2A 4IN3A 1STNA 2LSSA 2JA8H 3H94A 5IP9G 1C0AA 5EKLA 3M7NA 4AQYQ 3J80c 4CGYB 2CCZA 3S1MB 2XRQD 5IGFA 1SFOH 2MPMA 1YIJA 4R8NA 3DM3A 1PZKD 4LF9Q 4IOCA 1U4RA 4B3SL 4JBWA 1A63A 4QCLA 5KGUA 1C4QA 1SNOA 1OTCA 4KY6A 2R7DA 3RLOA 3DHQA 1GUOA 1FD7D 2HHHQ 4B08A 1Z7TA 4A3DB 2NBFA 3I55A 5C0XH 4HN7A 1NTGA 2LMCB 1ZYRC 5EBCA 1PH3A 4QF4A 2D0PA 2YYZA 2QCPX 5FO8B 3QR8A 1CQFA 4P73A 3VR6A 2F0EA 1S4ZA 4DV7L 3I8ZA 2WAQG 1BBUA 3DWQA 3TDQA 3CAMA 2Q2HA 2K01A 2Y0SB 3Q6SA 2EY6A 2RHSB 1GHKA 2VL6A 4RGNA 4DV6L 4L8JA 3JAMc 3FDTA 4C1NK 1I3QB 2HQEA 3MC0B 1O7IA 4JI3L 4CJ1B 5BR8L 1HNXL 4JYAL 4C3HB 1EIGA 4ZAIA 2JA7H 3HKSA 3PMFA 4L5SA 2K1BA 4BY7B 2Z4HA 1PRTC 1PYSB 4UP8A 3KUPA 3RD4A 3SR1A 2A6HC 1F9PA 1K3BC 4A3JG 2IX3A 3S16H 3VYTA 1LTAD 3T16A 3PO3B 4RH6A 2H4OA 1B8AA 2RSOA 4DV4Q 3WDNA 2QGQA 3V2TA 1EQQA 1XNQQ 3H0GH 4C3IG 5C4XB 2WIIB 2B2TC 2FINB 1BQQT 3DEPA 1MKHA 1SE4A 3FRPB 2BA0A 3M7GA 2WAQE 4XQJA 1WCMG 3M4YA 5FJ8G 1MSHA 1EYAA 4PZ8A 1GJXA 3C2PA 1E2ZA 3S1MH 2AWOA 4A3KB 1G8ZD 3S1QB 1QNUA 4Q0FA 1GUNA 4R4CA 4B9WA 3CCEA 4EX5A 1KL9A 3MXGA 1A0IA 1H9MA 1SJED 2QILA 1Z9FA 2QDLA 3S9WA 3KBGA 3HKZG 4AIMA 4FF3A 1IHZA 4DR7L 1PYWD 4V190 1GUGA 4C1NI 1EEID 2VNUD 2NVTB 2F3WA 1CSPA 3B6YA 3S14B 2JA5B 4A3DH 2WKDA 5C4HA 2WKCA 3PSIA 2DN8A 3J80i 5C44B 2PI2A 4GKJL 1SXTA 2OQKA 2XVSA 1ZKOA 1VQ7A 2UU9L 2O4XA 2GA4B 1J6QA 5GAHC 2F0IA 3EROA 3K57A 4FXDA 3HOWG 4WJWA 3HOUG 3ER0A 5M5WB 5BN5A 2EJFC 2JSOA 2K52A 5FLXL 4OEMB 2JE6I 2DY7A 1EYGA 1PFSA 1HA5A 2PYKA 1RHPA 4FXGC 3HOXG 1E22A 1G6ZA 1SE8A 1I3QH 1V8QA 2B2UC 4C3HH 4BY7H 3ULJA 4BBSB 2J0TD 1U4MA 3GTJB 1LTLA 4H7BA 5JEAH 3NBIA 1CA6A 3HEJA 5EAYA 1QVFA 2AMCB 1WTXA 3PO3H 4B3TQ 2BH2A 3BS1A 4V0BA 4JV5Q 2N8NA 4B3RQ 5KEEA 5C4XH 1X3FA 2R93B 3NTHA 4OO1H 2RF4A 2EYPA 1OO9B 2MO0A 1B9NA 3BVMA 1VQDA 1XMQL 3STBC 3OSOA 4A3KH 3S1QH 1TS5A 4GKKL 1FJGQ 4JI4L 4TQUS 1PYBA 5I6YA 2E2HB 1PDQA 1HCZA 4M1UB 3L2PA 4DR4Q 4KN7C 2BCOA 2NVTH 4DNIA 1VQMA 2JA5H 3S14H 1K28A 4LJZC 3CCUA 4X66Q 4U673 3HOVG 4OHJA 4A3MB 2HD3A 3D6WA 2WINB 1GXDC 4QQBX 4FYDA 5C44H 4CDEC 4LFAQ 1CT1D 1V1PB 3D0FA 3MFGA 4F8MA 4YY3Q 1VQOA 1QNKA 2BE5D 2SEBD 4EVOA 4QIWE 1JR0D 1WTHA 1VF5C 3I7FA 2P5ZX 1EWHA 4X6AH 5M5YB 3J7ZC 5FO7B 5E3FA 3G48A 2VQFQ 2YU9B 4NP5A 4F88A 5M5WH 3C0NA 1STGA 1XPOA 2I5LX 2I5HA 1UE1A 1HTLD 4A3FG 5GAGC 1A2TA 4O0AA 5CV9A 2NVQB 1M1KC 1SMXA 2ZM6Q 4LUVA 2F1MA 1F2LA 3FP9A 4HJ9A 4XQQA 4BBSH 1JWSD 2K33A 4RFBA 3KJOA 3GTJH 5L37A 1KTKA 4JI1L 2K03A 2EPBA 2CH4A 1EQTA 1TY2A 4RHSA 4UPAA 1STBA 1PH7A 2KHJA 4BA2I 1JJCB 4RWSC 3G4SA 2R93H 2NVYB 1EWIA 1C48A 3VYUA 2F0KA 2Q2IA 3GP7A 2CQOA 4HJAA 2PQEA 1K8OA 5EKIA 1HZAA 1XWEA 5IGDA 1SYGA 2A5HA 1PH4A 3GDEA 2E2HH 1ASZA 2N88A 4JBJA 1EY8A 3KOJA 4Z9CB 4MTNA 2LFNA 3K5OA 1YZ6A 4A3EB 1YVCA 5I4DA 2F0VA 1EZ8A 4H44C 3BDCA 3FKIG 1JJ2A 4BWGB 1MSGA 5LHY1 4A3MH 4POFA 1SSOA 4J6HA 5G3LF 2K5QA 4DV7Q 3J7A5 1ESFA 3A8IE 4L5QA 4YWMA 4P74A 1UE5A 4K2KA 5IYBG 5M5YH 3T13A 1VQNA 3LWEA 1SBBB 2PI2E 3U50C 1N36L 4LF5L 4DV6Q 2YU9H 4JI3Q 1DZ1A 1N34L 5BR8Q 4JYAQ 2D2CC 2L15A 3UE1A 3TBIB 2NVQH 1CZWA 3EQLC 2KVMA 1U5KA 1QZGA 3QJYA 1RDPD 1YBYA 4O42A 1IYUA 3CCRA 3PUYA 4BBRB 1VF7A 4KMUC 2G9DA 2EYLA 3NE5B 3K0YA 4P71A 5IT9E 1SLJA 2Z4IA 4FNFA 2NVYH 3CCVA 3RMHA 3TN2A 4HCSA 2QW7A 1AEXA 2KCCA 1VQPA 1GOZA 4KHVA 2ASBA 4O2DA 2XIWA 3DM1A 3VR4A 1L0WA 2Z6KC 3UDFA 2MJ8A 2K5VA 1V1OA 4DR7Q 5KRUA 3K5NA 2QF7A 4WORA 1K0RA 4OIJA 4RAUC 4MZ9A 3ONAB 4AH6A 5EKKA 2B2VC 2PW5A 4GOPC 5ISRA 1WVLA 3BU2A 4A3EH 3TZUA 2HDLA 3TP8A 1VCIA
chains in the Genus database with same CATH topology
4ZQ3A 2F0LA 5AFWA 4G4KA 2XWBB 2FJ2A 1PFBA 1TS3A 1B44D 4C3HG 3IL8A 4ZYSA 1WTQA 4CJ2C 4PMCA 1V1PA 1B9MA 4RHRA 1AN8A 5G3LD 2J4XA 1SMYD 2LY7A 1ESRA 1HUNA 3MAQA 3I90A 2M2LA 4XYQA 5ELEA 1LT6D 4HEDA 4M8AA 1Y8NB 3M85A 5EGTA 2F0TA 2B2YA 2XRSD 4FXKC 2NYZD 4E6IA 1NR2A 1HA6A 1V43A 1JOKA 2FFKB 2IX0A 1JWUD 3S1NB 1EY9A 4KJOA 4KKTA 4K2LA 1EFID 2M9VA 4IURA 3OWEB 4NKLA 3MXUA 1LTRD 1D6EC 1ZXTA 5IT9L 1EY4A 2F0MA 2F3VA 1H9KA 5FOBB 3VYRA 3C0MA 1MBYA 4DFAA 4DXFA 5KYIA 3P20A 4RA8A 2IL8A 2PMZB 2R7ZB 1F2MA 3HG9A 1D2BA 5J39A 3OIPA 1TU2B 3W3AA 3NTIA 4FF1A 4EGVA 3JAME 1YNNC 2Z8LA 4OO1I 2C9OA 5FO9B 1HUMA 3A8JE 1F2ZA 4UAIA 1I6HB 1TS4A 2PZWA 3MEHA 4KN4C 1PLFA 1LTBD 1II3A 5C3WA 1WD1A 5I2XA 2TSSA 3NUCA 1TT2A 1ET6A 4TKOB 4XYOA 2L5TA 2L11A 2F0NA 4IUVA 3OPOA 3W2DA 2FHTA 3J80L 1AW7A 3A7AB 1PRTF 3PIP3 2WP8J 4Y7NB 2R92B 2Z1CA 1SYEA 5JOBA 3PUVA 2E74C 3SDZA 2F0JA 1EU3A 2EYOA 2RBMA 1LT5D 4FP5D 4DXGA 1QILA 4F87A 3RLFA 1F9QA 4DGZA 4RCOA 5D65A 1S5DD 1I4QA 5JPMC 3C0OA 1BOSA 1STEA 3L7ZC 5CYUA 2EZVA 1UNSA 3JAML 2E2IB 2XWJB 4RGMA 3N52A 2RDHA 5A35A 2EDGA 3BG3A 2LKVA 3BDOA 3FEWX 1F77A 5E1FA 2I07B 1STHA 2K5WA 2PW7A 3GO5A 2IWHA 1HPCA 1B50A 1ZYRD 4BY1B 4A93B 2O2LD 3GTMB 1KLUD 1BUVT 4IFDH 1B3AA 3I72A 3OWFA 2KJXA 2E2DC 1XTCD 3I4LA 1CFMA 4MHEA 2EYFA 1O78A 1JB3A 3M3YB 4RGOS 3NXWA 1SNDA 2JP1A 1W6JA 3MA2B 3OW7A 1Z47A 1QOHA 3NK9A 5CMDA 5JVG3 3QG1A 4IUUA 1PRTB 1DOMA 3N6RA 1LTTD 2F0OA 1PRTD 2A6HD 2F0QA 4XTCS 3NBHA 3QWNA 1STYA 4KD4A 4KHZA 2XSCA 4R8IA 3MZ5A 4CKCA 2NUCA 1O7LA 4G7HC 5C3XA 1I50B 3CU7A 3SEBA 3T53B 3Q23A 3L3OC 2NN6G 3ND8A 2X69A 4J1MA 5EBDA 5CV8A 3KK7A 1JOOA 1M4VA 4KJNA 3D4RA 2ENBA 4PNYA 4IALA 4EQNA 1SNCA 2OEOA 5C4JB 3CHBD 3BZDB 3K58A 4PV1C 3VR5A 2B2WA 4K6DA 1IW7C 3HOZB 2EYHA 5KYLA 1U9RA 2A69C 4PMBA 2NVXB 5M3MB 1WTPA 4DK0A 1OXXK 4C3JG 4L63B 1QJOA 2K7VA 5C5LA 3UI2A 1TVXA 3IFDA 1X3PA 5COYA 2CVRA 3GTOB 5KNCA 4R9WA 3MTSA 3SK5A 1S5ED 1ILPA 2K5DA 3S2HB 1E0BA 3NP8A 1PZID 1UAPA 2B63B 2DNCA 2PO4A 3KLSX 1XX8A 4LMQD 1FNUA 1D5ZC 2NN6I 5CBEE 5K36G 1JICA 4G57A 1LTID 5T1IA 1OXTA 3EFXD 4ZLTF 1J8IA 4IUPA 1PREA 2JA6B 1QE6A 4DK1A 1TIID 3I91A 5DM63 3HZXA 3PV0A 2TMPA 1ENCA 3M4OB 2EVBA 3WOFA 3S2DB 2EY2A 3KLRA 1RJTA 3GD7A 1T5EA 1WTWA 2CW0C 5IGEA 2ID0A 4CHTB 4H0LC 1IKLA 4ZK9B 3SK4A 3E0JA 3GTQB 1FGBD 2KECA 1NCVA 1NSNS 2KUMA 3C46A 3R8BA 2KA7A 3P7JA 3GTPB 1SNMA 1SE3A 2B2TA 2F0SA 3F2UA 4UDUC 4K8JA 3A56A 1RKNA 1TS2A 2Q8IB 1Q1BA 3OHXC 1AZPA 5EQ0A 2VUMB 3T4AC 5C0XG 2BA1A 1TWFB 2OF1A 4RKLA 5IOCA 3E5SA 3U9OA 2SOBA 3J7YW 4K14A 5C6AA 1SAPA 4AYBB 4DAPA 5CBAE 1AFPA 1PFMA 2K04A 1KDCA 3A8KE 3TMEA 4HMJA 1EY5A 2RDFA 1Y1VB 3CQZB 4K6LA 5ELFA 1A15A 2HDMA 3AB9A 2B2UA 2L1BA 1KAAA 1FR3A 4C56C 1IKMA 2CQAA 1PTOC 1SYCA 1F9SA 3QB3A 3DWPA 4KD3A 3D8GA 5CORA 3FPUB 1CQVA 3D4DA 2L0CA 5CV4A 4XT1B 1L0YB 3K6OA 1SDFA 1Z6HA 1SNPA 1HXYD 4X3KA 1S5CD 1CA5A 3SVMA 1Y69U 2E75C 3E6ZX 4H13C 1LT3D 2PZTA 5C0XI 1E2WA 3VA5A 2EOTA 3VYSA 3ERQA 2WAQB 4ZKBB 3G6JB 2F0WA 2RKSA 2F0UA 4ZUIA 3URYA 4QUFA 1QB5D 1FNWA 1JE4A 2V4DA 1G291 3AMUA 3KF8A 4K5WA 2RSNA 3NPPA 4S3SA 4MN3A 1EOTA 4A3JB 1RCVD 2X6GA 5IIFA 5JEAG 5EPLA 1O7YA 3G4NA 3S17B 1X32A 1JOQA 3MWYW 1WCMB 4OO1G 3QIAA 4G7OC 3RZOB 1I4PA 3J7AV 2WB1B 3P75A 4XXEA 2JEBI 1GUWA 4DU9A 3HP3A 2F03A 3HKZB 1EZ6A 1LTGD 1WTOA 3SK8A 3VA7A 4RGTA 2N55A 2M00A 1Q12A 4K8IA 4BS9A 3Q22A 3CRLC 1L0XB 1TWCB 5HURA 2AQ3B 3PUXA 1PMRA 4WRDA 2H1EA 1BCPC 1NAPA 2B39A 2K28A 1ENFA 1FNVA 2Q8TA 5C4ZA 3HOUB 1NR4A 1LLRD 3O13A 2PZUA 3U9SA 3HOXB 2RA4A 5JJZA 4FO2A 4K5VA 5CR3A 3ZYYX 1YNND 4ZKCB 3S15B 5C0XJ 4XQNA 1BDOA 2IX1A 4DF7A 1G2TA 2SNSA 2R6GA 1BF4A 2DY8A 3EVQA 1WD0A 1ILQA 4IUNA 4QUCA 2KEEA 2BDNA 3BVGA 4ODGA 4QMGA 4I65A 3CRKC 4HSVA 1ICWA 2PCFB 4NDXA 1SYDA 3A55A 3TP7A 3NWSA 1TWGB 5LL6S 4N9TA 3HOVB 1BNZA 2B2VA 1TWHB 5I9PA 2HCIA 1Q90A 1DYQA 1LTSD 2EE1A 2FMMA 1B53A 1H9RA 1EY0A 3NWTA 4B9XA 2F0DA 1D5MC 1I4XA 4ULLA 1PXUA 4XDXA 4KKUA 1JORA 4LK1C 1ONLA 1J9OA 4IQZA 1BR9A 4OGQC 1KABA 4HSPA 1TY0A 2L9HA 3OOCA 4NMZA 1CM9A 2EY1A 1EY6A 4KY7A 4KV6A 2R61A 5DEHA 5CV6A 2D9UA 1EEFD 2RDGA 5ELCA 3FMCA 2EXZA 2R3ZA 3G4OA 1X3QA 2F0HA 5EPJA 1LABA 2K6AA 1CHPD 4KY5A 4DA2A 1HHVA 4X3SA 3FKIB 5JEAJ 4K5XA 2A68C 3MXPA 5J22A 4KKSA 2L12A 4ME5A 1ZEQX 4OL7A 2JXMB 4PMWA 1QCBD 5C3EB 1S5BD 2X6LA 4ZUJA 2L55A 4HCEA 2ZXOA 1YNJC 1CK1A 3FPPA 1SYBA 4WFN3 3A7LA 2D62A 4CKBA 4C2MB 4FVMA 2A6EC 1PZJD 5IGCA 1LACA 2QKIC 1DOKA 1Q8IA 3K5MA 5FK9C 1TWAB 4EQOA 1WTVA 1DD2A 4F7XA 1BO0A 2BOSA 3ITPA 1CZGA 2PPBC 3OMCA 2KEDA 5FLXE 1Y8OB 4PQXA 1K8MA 2OXPA 1R4PB 5CV5A 1QWYA 1ENAA 2A73B 5T1GA 3DUZA 1O7ZA 3C1FA 5FKAC 5KIXA 1D1IA 1IW7D 2D5DA 2K05A 1KLGD 1EIHA 2O5IC 2A69D 3HGBA 3I4MB 3H91A 2ICEC 3I4NB 3MVVA 3GQBA 5M5XB 3OIQA 1F9RA 3S1RB 2E76C 3PUZA 2MUYA 1SE2A 1FYCA 3BDLA 1GUSA 3BYTB 2VXWA 1LV9A 1HFNA 3QOJA 3TSSA 1C8CA 5DAUA 3GV3A 1OXVA 3H09A 1Y8PB 3TP6A 3K7AB 5I9OA 2J7ZA 4GZYC 2MP1A 1Z52A 1B1ZA 2F0PA 3L9AX 1H9JA 3D6CA 3K59A 1WTRA 1MGSA 3BYYB 3GV6A 5CGKA 2PNRC 1A6XA 5J1ZA 1TR5A 3R3OA 1SYFA 4YIJA 2IT1A 1EL0A 1Q3LA 2Q8RE 2FMCA 4O1NA 3HRZC 3D4WA 4KK7A 2BDOA 1DCZA 5ELDA 2WV6D 2CW0D 1NUCA 5I6WA 5HGTA 3C3LA 1PTOF 2EY5A 2K32A 4ZRZA 3GTLB 3GTKB 4A3GB 4DN4M 1CHQD 1LT4D 5LL6X 1EYDA 3I70A 4RCNA 1EYCA 2XNAC 3VR2A 3K5LA 5DNFA 1GUTA 4ABNA 5IGBA 1DOLA 3C1EA 3EJIA 2SDFA 2RVLA 1UEAB 1AP0A 1B4OA 5JAVA 3ND9A 2AUKA 4HR7B 2B8FA 4A3BB 5E4XA 3EA6A 1HTPA 1RODA 1M8AA 1ML0D 4KI0A 1E2VA 3SXHA 1S5FD 2A74C 3DEOA 2E2JB 1RTNA 2EJGC 1Y1WB 4IFDG 2AQ1B 1H9SB 4FF4A 2MHVA 1EWCA 2VB2X 4CKEA 3PO2B 2O5JC 1A3VA 2JYOA 5A2QE 1DXMA 1G91A 3GTGB 2ZXPA 3T56B 5M3FB 2BE5C 3CKIB 3OMGA 2ICIA 3X3NA 1VMPA 1I4GA 2QEJC 5ELBA 4A3IB 3VR3A 1XXGA 2MGSA 1PTOB 1TKWB 1VDZA 3QO2A 5IODA 2ZT9C 3G7LA 3DWAA 1PTOD 2CHBD 2SNMA 2AWNA 1D5XC 1CTMA 4JK1C 1DJRD 1R4QB 3AU7A 2B2YC 4RKBA 2KCNA 1U4LA 2NTTA 1DONA 3SHLA 3WOEA 1BXTA 3MHBA 1R9TB 4IZ8A 4NW2A 2VB3X 4KTAA 1HFGA 4G7ZC 2DNEA 1Q1EA 5JVH3 1RF2D 1BCPF 3MXNA 4DNTB 5JPNC 1IL8A 4IFDI 4HTHA 1SJHD 1F2YA 3BVZA 3SE0A 5DM73 5D14A 2ZXRA 3DMUA 3TZDA 1ET9A 3KBXA 1HQRD 3IFTA 5E4WC 4HAEA 5D3IB 3HS0C 2NZ1D 5KNBA 5KNDA 4CBVA 3I73A 5A2QL 4I7ZC 1I6VC 2HUGA 4J8QA 1A3UA 1PTOH 4ILWA 2EYJA 1QG7A 5BN4A 4Q5VA 2IW3A 1KNEA 1RTOA 3HOYB 2NWGA 1STAA 2QDBA 1KDAA 4QB4A 4C3IB 4ID6A 4XT3B 1CI3M 2AUJD 3H3VC 4XIGS 1OXUA 5K5PA 4LAAA 3X3MA 1BCPB 3SK6A 2G9HD 1BCPD 1O80A 4DNRB 1H9SA 5I2YA 1MI2A 4C3JB 1MD2D 3D31A 3TP5A 1A2UA 1B2TA 1A3TA 1K83B 4BA1I 1PFNA 1LO5D 5TSSA 5C5MA 4TRDA 1SMYC 1AZQA 3HOWB 1TQOA 3P1HA 4P2CB 3Q24A 4IFDJ 4DAYA 3LX0A 5NUCA 3J7AF 3J80E 1OXSC 1DM0B 3R2IA 3NQTA 3J81E 1EY7A 3V05A 2NN6H 3MFYA 1I4RA 3FVQA 4QIWB 2EJMA 2KOLA 4X3TA 3NQIA 3V96A 2RQXA 3H6MA 1D1KA 3LWUA 3RZDB 2KHSA 3RUZA 4U68A 2I46A 2L4NA 1KDBA 3Q0AA 4L6TB 4EQPA 3T51B 2F4IA 2WACA 1GHJA 2HCCA 3IKJA 3R2TA 5EPKA 1G2SA 3D3RA 1JC7A 2KQ3A 3NSWA 1U4PA 3DXJC 1RD9D 2EYMA 4HMIA 1BBXC 3PUWA 1KNAA 3LNNA 1UUPA 4A3FB 4CJ0B 2JA8B 3PIO3 5BN3A 2F0FA 1SFOB 1JQYD 5EJWA 5M9OA 5D3DA 5K36H 2IPKD 3QOLA 4X3UA 4MIUA 3J81L 2C5CA 2JEAI 2A68D 2B2WC 1EQVA 2LS01 4FF2A 3NTKA 3A54A 1IYVA 1W6KA 2AQ2B 1JCKB 5CC4A 1SNQA 1HQMC 4N9PA 4OIKA 5IGGA 1HRJA 1I4HA 3R93A 1YNJD 3I3CA 2NTSA 2JA7B 1EU4A 1T5XD 2XN9C 1JWMD 3S16B 5F2DA 2OT2A 2NB0A 2F0GA 4TSSA 3KLSA 4DAVA 2B8GA 2A6ED 4IUQA 1SEBD 1XYIA 1VMCA 3H0GB 4IUTA 2IJ0A 5CV7A 3NHHA 3IAYA 4IN3A 1STNA 3H94A 5EKLA 3M7NA 4CGYB 3S1MB 2XRQD 5IGFA 2MPMA 4R8NA 1PZKD 1U4RA 4JBWA 4QCLA 5KGUA 1C4QA 1SNOA 4KY6A 3DHQA 1GUOA 1FD7D 4B08A 1Z7TA 4A3DB 2NBFA 5C0XH 4HN7A 2LMCB 1ZYRC 5EBCA 4QF4A 2YYZA 2QCPX 5FO8B 1CQFA 3VR6A 2F0EA 1S4ZA 3I8ZA 3DWQA 3TDQA 2K01A 2Y0SB 3Q6SA 2EY6A 1GHKA 4RGNA 4L8JA 3FDTA 4C1NK 1I3QB 2HQEA 3MC0B 4CJ1B 4C3HB 1EIGA 4ZAIA 4BY7B 3PMFA 2K1BA 2Z4HA 1PRTC 3KUPA 3RD4A 3SR1A 2A6HC 1F9PA 2IX3A 3VYTA 1LTAD 3T16A 3PO3B 4RH6A 2H4OA 2RSOA 3WDNA 3V2TA 4C3IG 5C4XB 2WIIB 2B2TC 2FINB 1BQQT 3DEPA 1SE4A 3FRPB 2BA0A 3M7GA 4XQJA 3M4YA 1MSHA 1EYAA 1GJXA 3C2PA 1E2ZA 2AWOA 4A3KB 1G8ZD 3S1QB 1QNUA 4Q0FA 1GUNA 4B9WA 3MXGA 1H9MA 2QILA 1SJED 3S9WA 3KBGA 4FF3A 1IHZA 1PYWD 4V190 1GUGA 4C1NI 1EEID 2VNUD 2NVTB 2F3WA 2JA5B 3S14B 2WKDA 5C4HA 2WKCA 2DN8A 5C44B 1SXTA 2XVSA 1ZKOA 2O4XA 2GA4B 2F0IA 3EROA 3K57A 4FXDA 4WJWA 5M5WB 5BN5A 2EJFC 2JSOA 5FLXL 2JE6I 2DY7A 4FXGC 1HA5A 2PYKA 1RHPA 1G6ZA 1V8QA 2B2UC 4BBSB 2J0TD 1U4MA 3GTJB 4H7BA 5JEAH 3NBIA 1CA6A 3HEJA 1WTXA 3BS1A 4V0BA 5KEEA 2R93B 3NTHA 4OO1H 2EYPA 1OO9B 1B9NA 3BVMA 3OSOA 1TS5A 4TQUS 5I6YA 2E2HB 1PDQA 1HCZA 4M1UB 4KN7C 2BCOA 4LJZC 4U673 4OHJA 4A3MB 3D6WA 2WINB 1GXDC 4FYDA 1CT1D 1V1PB 3MFGA 4F8MA 1QNKA 2BE5D 2SEBD 4EVOA 1JR0D 1VF5C 1EWHA 5M5YB 5FO7B 5E3FA 2YU9B 4NP5A 4F88A 3C0NA 1STGA 1HTLD 1A2TA 5CV9A 2NVQB 2F1MA 1F2LA 4XQQA 1JWSD 2K33A 4RFBA 1KTKA 2K03A 2EPBA 1EQTA 1TY2A 4RHSA 1STBA 4BA2I 4RWSC 2NVYB 3VYUA 1C48A 2F0KA 3GP7A 2PQEA 1K8OA 5EKIA 1XWEA 5IGDA 1SYGA 2A5HA 2N88A 1EY8A 4Z9CB 2LFNA 3K5OA 4A3EB 5I4DA 2F0VA 1EZ8A 4H44C 3BDCA 4BWGB 1MSGA 5LHY1 1SSOA 4J6HA 5G3LF 2K5QA 1ESFA 3A8IE 4K2KA 3T13A 3LWEA 1SBBB 1DZ1A 2D2CC 3TBIB 1CZWA 3EQLC 2KVMA 3QJYA 1RDPD 4O42A 1IYUA 3PUYA 4BBRB 1VF7A 4KMUC 2G9DA 2EYLA 3NE5B 3K0YA 5IT9E 2Z4IA 4FNFA 3RMHA 3TN2A 4HCSA 1AEXA 2KCCA 1GOZA 4KHVA 2XIWA 3DM1A 3VR4A 2MJ8A 1V1OA 5KRUA 3K5NA 2QF7A 4WORA 4OIJA 4RAUC 3ONAB 5EKKA 2B2VC 2PW5A 5ISRA 1WVLA 3TZUA 2HDLA 3TP8A 1VCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HA5 A;  1LT3 D;  2Z8L A;  2XNA C;  4L63 B;  3GP7 A;  1SE3 A;  1RF2 D;  1EEF D;  2RDG A;  1BCP F;  4UDU C;  1TS3 A;  5ELC A;  1B44 D;  1JQY D;  2O2L D;  1KLU D;  4ZYS A;  5D3D A;  2IPK D;  1V1P A;  1TS2 A;  4RHR A;  3DWQ A;  3G4O A;  1TS4 A;  1LO5 D;  5TSS A;  1AN8 A;  1SJH D;  1XTC D;  4Z9C B;  1LTB D;  3URY A;  3BVZ A;  1CHP D;  1FNW A;  3EA6 A;  2J4X A;  4RGO S;  1S5E D;  5I4D A;  4RGN A;  1ET9 A;  2TSS A;  4BWG B;  1HQR D;  1PZI D;  3BVG A;  1ET6 A;  5D3I B;  3MC0 B;  1SE2 A;  3BVM A;  3R2I A;  5ELE A;  1S5F D;  3KLS X;  1PRT C;  1PRT B;  1LT6 D;  3V05 A;  1TS5 A;  1ESF A;  1FNU A;  1I4R A;  1LTT D;  1RCV D;  3BYT B;  2AQ1 B;  1D5Z C;  1S5B D;  1LTA D;  1PRT D;  2AQ2 B;  1LTI D;  3TSS A;  1JCK B;  1SBB B;  1EWC A;  4RH6 A;  3G4N A;  3W2D A;  2XRS D;  1PTO H;  1CK1 A;  1AW7 A;  3EFX D;  4K6L A;  5ELF A;  1Z52 A;  1SE4 A;  1JWU D;  1B1Z A;  1I4H A;  4OHJ A;  1PRE A;  3SEB A;  1PRT F;  1DYQ A;  1LTS D;  3BYY B;  2NTS A;  1I4P A;  1CT1 D;  1V1P B;  3MFG A;  2ICI A;  1EU4 A;  1EFI D;  1G8Z D;  1T5X D;  2SEB D;  1RDP D;  2XN9 C;  1JR0 D;  1JWM D;  3OWE B;  1LTR D;  1I4G A;  1PZJ D;  1D6E C;  2QEJ C;  2QIL A;  1SJE D;  5ELB A;  1LTG D;  4C56 C;  4TSS A;  4L6T B;  1EU3 A;  1XXG A;  5FK9 C;  1LT5 D;  1SEB D;  1PYW D;  4RGT A;  4DXG A;  1QIL A;  1D5M C;  1I4X A;  1M4V A;  1PTO C;  1PTO B;  1EEI D;  2IJ0 A;  3C0N A;  1L0X B;  1HTL D;  3C0M A;  3DWA A;  1PTO D;  4RCO A;  3DWP A;  3R2T A;  4O1N A;  2CHB D;  1S5D D;  1GOZ A;  1D5X C;  1I4Q A;  2AQ3 B;  2XRQ D;  4DXF A;  3C0O A;  1SXT A;  3CHB D;  1CQV A;  5ELD A;  2WV6 D;  1DJR D;  1JWS D;  1STE A;  3BZD B;  4RFB A;  1BCP C;  1BCP B;  1PZK D;  1UNS A;  1KTK A;  1V1O A;  2G9H D;  1RD9 D;  2NTT A;  1FGB D;  1ENF A;  1L0Y B;  1PTO F;  1FNV A;  4RGM A;  1BCP D;  1TY0 A;  2RDH A;  5FKA C;  1TY2 A;  4RHS A;  1BXT A;  1HXY D;  1LLR D;  1S5C D;  3O13 A;  1FD7 D;  1CHQ D;  1LT4 D;  1UUP A;  1MD2 D;  1KLG D;  1F77 A;  2R61 A;  3R8B A; 
#chains in the Genus database with same CATH topology
 4ZQ3 A;  2F0L A;  3EIV A;  4GKJ Q;  5IYC H;  2JJQ A;  5AFW A;  3E0E A;  4G4K A;  2K4K A;  2FJ2 A;  1SN8 A;  2XWB B;  1IBL L;  2UU9 Q;  1PFB A;  1TS3 A;  1B44 D;  4C3H G;  3IL8 A;  2WFW A;  4BY7 G;  4ZYS A;  2CH4 W;  2JA9 A;  1WTQ A;  4CJ2 C;  4PMC A;  1V1P A;  1B9M A;  4RHR A;  3I4N G;  1BVS A;  3ULP A;  1PH6 A;  1AE2 A;  1AN8 A;  5G3L D;  4H02 A;  2J4X A;  2UXD L;  1SMY D;  3TRE A;  1TXY A;  2LY7 A;  1ESR A;  1HUN A;  3MAQ A;  3I90 A;  4HJ8 A;  1WOC A;  2M2L A;  4XYQ A;  3U58 A;  5ELE A;  1LT6 D;  2Y0S E;  1IBM L;  4HED A;  4M8A A;  1Y8N B;  3M85 A;  4BBR H;  5EGT A;  2F0T A;  2OQ0 A;  2B2Y A;  1CKO A;  2XRS D;  4FXK C;  2NYZ D;  4E6I A;  1KRT A;  1NR2 A;  1HA6 A;  1V43 A;  4MNO A;  1XMQ Q;  1YJ9 A;  1JOK A;  2FFK B;  2IX0 A;  1JWU D;  2QEX A;  3S1N B;  1EY9 A;  4KJO A;  1ASY A;  3H3V H;  4GKK Q;  4KKT A;  4JI4 Q;  4K2L A;  1EFI D;  2M9V A;  3WWV A;  4JI2 L;  2OCE A;  4IUR A;  1KXL A;  3OWE B;  4NKL A;  3MXU A;  1LTR D;  2D0O A;  4LF6 L;  1D6E C;  1ZXT A;  2UXC Q;  5IT9 L;  4DK3 C;  1EY4 A;  4R4I A;  4APV A;  2F0M A;  1CKN B;  2F3V A;  4OON A;  1H9K A;  5FOB B;  3VYR A;  3C0M A;  1MBY A;  4DFA A;  3KF6 B;  4DUY L;  2GVA A;  2EIF A;  5IE8 A;  2MNA A;  4DXF A;  5KYI A;  5GAD C;  1YJW A;  2VY3 A;  3P20 A;  3NBH B;  4IPD A;  2IL8 A;  4RA8 A;  2PMZ B;  2R7Z B;  1F2M A;  1KRS A;  3HG9 A;  1D2B A;  4JBK A;  5J39 A;  3OIP A;  1TU2 B;  3W3A A;  4GNX B;  3NTI A;  4FF1 A;  4EGV A;  3JAM E;  1YNN C;  2Z8L A;  3LGJ A;  4OO1 I;  2C9O A;  1UE7 A;  4QY7 A;  5FO9 B;  1HUM A;  3A8J E;  1F2Z A;  4JI1 Q;  4UAI A;  1I6H B;  1TS4 A;  2PZW A;  3MEH A;  4KN4 C;  1PLF A;  4YCW A;  1LTB D;  1II3 A;  5C3W A;  1WD1 A;  2MO1 A;  1PVO A;  3RN5 A;  5I2X A;  1VQ6 A;  1YI2 A;  5JJK A;  1K9M C;  5LMN W;  2TSS A;  3S1N H;  3NUC A;  1TT2 A;  1PHJ A;  1L1O B;  5IYD G;  1ET6 A;  3BZC A;  4TKO B;  1X3E A;  4XYO A;  1HZC A;  2L5T A;  1YEZ A;  2L11 A;  4JI8 Q;  2G5D A;  2F0N A;  4IUV A;  2V1C C;  3OPO A;  2N3S A;  3W2D A;  2FHT A;  3J80 L;  1WI5 A;  3PO2 G;  4JI5 L;  2VQE Q;  1AW7 A;  4LF7 L;  1PH1 A;  3A7A B;  1PRT F;  4DKA C;  3PIP 3;  5HY6 A;  5M3F G;  1XPU A;  2WP8 J;  4WJ4 A;  3CC7 A;  4Y7N B;  2R92 B;  1NMG A;  2Z1C A;  1SYE A;  5JOB A;  5FLM H;  3PCO B;  3PUV A;  3W1G A;  1N36 Q;  4LF5 Q;  4LFA L;  1C7Y A;  1UWV A;  2E74 C;  1GKH A;  3SDZ A;  2R7Z H;  2F0J A;  1EU3 A;  2EYO A;  2RBM A;  3SGI A;  5IY0 A;  2DGY A;  1LT5 D;  4FP5 D;  4DXG A;  1QIL A;  4F87 A;  3J81 j;  1N34 Q;  3RLF A;  4A3C G;  1F9Q A;  4FDB A;  1KHI A;  2ZTC A;  1VQA A;  3CME A;  4DGZ A;  4RCO A;  5D65 A;  1S5D D;  4YCU A;  1QVG A;  1I4Q A;  4OWX B;  5JPM C;  3C0O A;  1BOS A;  1STE A;  3L7Z C;  5CYU A;  1I6H H;  3RNU A;  2EZV A;  1QUQ B;  1UNS A;  2K14 A;  4HID A;  1CSQ A;  3JAM L;  2E2I B;  2XWJ B;  4RGM A;  3N52 A;  2RDH A;  3PIO A;  5A35 A;  2EDG A;  1S40 A;  3BG3 A;  2LKV A;  3BDO A;  3FEW X;  1F77 A;  5IP7 H;  5E1F A;  2I07 B;  1STH A;  2K5W A;  1VQI A;  2PW7 A;  3GO5 A;  1YHA A;  2IWH A;  1HPC A;  1B50 A;  1ZYR D;  4BY1 B;  4A93 B;  2O2L D;  3GTM B;  3CW2 C;  1KLU D;  1BUV T;  4IFD H;  3PQI A;  1B3A A;  1E7Z A;  3I72 A;  3OWF A;  2KJX A;  2OWO A;  1JMC A;  2E2D C;  1XTC D;  3I4L A;  4DR5 L;  1CFM A;  4MHE A;  2EYF A;  1O78 A;  1JB3 A;  3W5O A;  1HZB A;  3M3Y B;  4RGO S;  3NXW A;  1SND A;  2JP1 A;  1IBL Q;  1W6J A;  3MA2 B;  3OW7 A;  1VQ9 A;  1Z47 A;  1QOH A;  2E5L L;  3CP0 A;  1SR3 A;  3NK9 A;  5CMD A;  1YJN A;  5JVG 3;  2F3I A;  3QG1 A;  4IUU A;  3KF6 A;  1V9P A;  1PRT B;  4Y7N H;  4JCV E;  2R92 H;  1DOM A;  3N6R A;  1LTT D;  2F0O A;  1PRT D;  2A6H D;  2F0Q A;  4XTC S;  3F2B A;  2UXD Q;  3NBH A;  3QWN A;  1STY A;  4KD4 A;  4KHZ A;  2XSC A;  4R8I A;  3MZ5 A;  4CKC A;  2NUC A;  1O7L A;  4G7H C;  4DK6 C;  5C3X A;  1I50 B;  3CU7 A;  3SEB A;  4DR2 L;  4GNX A;  3T53 B;  2AKW B;  1IBM Q;  2JK8 A;  3Q23 A;  1WFQ A;  3L3O C;  2GN5 A;  2NN6 G;  3ND8 A;  2AHO B;  2FXQ A;  4X65 L;  4YHH Q;  2X69 A;  4HIK A;  2E2I H;  3HOY G;  4J1M A;  5EBD A;  5CV8 A;  3KK7 A;  1JOO A;  2UUA L;  1M4V A;  4KJN A;  3D4R A;  4JVZ A;  1NMF A;  2ENB A;  4PNY A;  5JJI A;  1D7Q A;  4IAL A;  4EQN A;  1SNC A;  4JI2 Q;  2OEO A;  4JI6 L;  4LF6 Q;  5C4J B;  1L1O A;  5IWA L;  3CHB D;  2VW9 A;  4BY1 H;  1X3G A;  4A93 H;  3BZD B;  3K58 A;  4PV1 C;  3GTM H;  4L5T A;  3VR5 A;  2B2W A;  4K6D A;  3KYH C;  2F52 A;  1IW7 C;  3HOZ B;  4CDC C;  2EYH A;  5KYL A;  3KDF B;  2UXB L;  1U9R A;  1Q86 C;  2A69 C;  4PMB A;  2NVX B;  3M3Y H;  5M3M B;  4DUY Q;  1WTP A;  4DK0 A;  1OXX K;  4C3J G;  4L63 B;  1QJO A;  2K7V A;  5C5L A;  2K50 A;  3AFP A;  3RR5 A;  3UI2 A;  1TVX A;  2ATW A;  3IFD A;  2VZA A;  1X3P A;  5COY A;  2CVR A;  4JOI C;  2XTI A;  2A8V A;  3GTO B;  4R9W A;  5KNC A;  3MTS A;  3SK5 A;  1N32 L;  3CMA A;  1S5E D;  1ILP A;  4PZ6 A;  2K5D A;  3HFZ B;  3S2H B;  1E0B A;  3MXN B;  1I50 H;  3NP8 A;  3F2C A;  1PZI D;  1UAP A;  3CF5 A;  2B63 B;  2DNC A;  3H3V I;  3K80 C;  2PO4 A;  3KLS X;  3U4V A;  4QJF A;  1B70 B;  2RCN A;  1XX8 A;  4LMQ D;  2Q2T A;  1FNU A;  3STB D;  1D5Z C;  2NN6 I;  5CBE E;  5K36 G;  1JIC A;  4G57 A;  1LTI D;  5T1I A;  1QUQ A;  1I94 L;  4DPG A;  1OXT A;  3EFX D;  4ZLT F;  1J8I A;  4IUP A;  2UUC L;  2JQO A;  3JAM i;  1PRE A;  1Q46 A;  2JA6 B;  1V1Q A;  1U0L A;  1QE6 A;  4DK1 A;  5C4J H;  1TII D;  3I91 A;  5DM6 3;  3HZX A;  3PV0 A;  3CPW A;  2TMP A;  1ENC A;  4HIO A;  4LF4 Q;  3M4O B;  3HOZ H;  4JI5 Q;  2EVB A;  4LWC A;  3KF8 B;  3W1B A;  4LF7 Q;  3WOF A;  2UXC L;  3S2D B;  2NVX H;  2EY2 A;  3KLR A;  5M3M H;  4BXX G;  4JBM A;  3OYY A;  1IXR A;  1RJT A;  3GD7 A;  1T5E A;  4YWK A;  1WTW A;  1XJV A;  1N33 L;  2CW0 C;  3AFQ A;  2ID0 A;  4CHT B;  5IGE A;  4H0L C;  3A5U A;  3RN2 A;  1IKL A;  4ZK9 B;  3SK4 A;  4TVA B;  4A3L G;  3E0J A;  3GTQ B;  1FGB D;  2KEC A;  3GTO H;  1NCV A;  4A76 A;  4A4I A;  4POG A;  2IHF A;  4CDD C;  1E3P A;  1QZH A;  1NSN S;  4R1J A;  2KUM A;  3C46 A;  3R8B A;  2KA7 A;  3P7J A;  4LUZ A;  3S2H H;  5JJL A;  3GTP B;  1SNM A;  1SE3 A;  2JA8 G;  2B2T A;  2PMZ E;  2B63 H;  2F0S A;  3F2U A;  4UDU C;  4K8J A;  3A56 A;  1RKN A;  1TS2 A;  1NJI C;  2KCM A;  4DV1 L;  2Q8I B;  1Q1B A;  3OHX C;  1VQG A;  1GD7 A;  1AZP A;  5EQ0 A;  3VDY A;  2VUM B;  3T4A C;  5C0X G;  2BA1 A;  1TWF B;  2OF1 A;  2JA6 H;  4RKL A;  5IOC A;  3E5S A;  3E9I A;  3ICE A;  3U9O A;  2SOB A;  3J7Y W;  4K14 A;  5C6A A;  1SAP A;  4AYB B;  4DAP A;  4LF8 Q;  5CBA E;  2Z0S A;  4DR5 Q;  1AFP A;  1PFM A;  2K04 A;  2Q2U A;  3M4O H;  3CCL A;  1VQB A;  1KDC A;  3A8K E;  4JI8 L;  3TME A;  4HMJ A;  1EY5 A;  2RDF A;  2E5L Q;  1S3O A;  1Y1V B;  3CQZ B;  3S2D H;  3CCJ A;  1PH2 A;  4K6L A;  3KDF A;  5ELF A;  4HJ5 A;  1JT8 A;  2VQE L;  3Q8D A;  1A15 A;  2HDM A;  3AB9 A;  2JA7 G;  1YIT A;  3A5Z B;  2B2U A;  1LYL A;  3GTQ H;  2L1B A;  1KAA A;  1FR3 A;  4C56 C;  1IKM A;  2CQA A;  2ZTD A;  1KD1 C;  1PTO C;  3G71 A;  2CWA A;  4DR2 Q;  3BJU A;  3H0G G;  1SYC A;  1F9S A;  5LMN Q;  3QB3 A;  3DWP A;  4KD3 A;  3D8G A;  3GTP H;  5COR A;  2ES2 A;  3FPU B;  1CQV A;  3ZJY C;  3D4D A;  4X65 Q;  2L0C A;  2VS1 A;  3FHW A;  3UDX A;  5CV4 A;  4XT1 B;  2UUA Q;  1L0Y B;  2YTV A;  3K6O A;  1SDF A;  1Z6H A;  1SNP A;  1IYJ B;  4IJL A;  1HXY D;  4X3K A;  1S5C D;  4GOP B;  1CA5 A;  3K81 C;  3SVM A;  1Y69 U;  2VUM H;  4A3D G;  2E75 C;  3E6Z X;  4H13 C;  1LT3 D;  4JI6 Q;  2PZT A;  1TWF H;  5IWA Q;  5C0X I;  1E2W A;  3VA5 A;  2Z9H A;  3T1H Q;  2EOT A;  3NEM A;  1AE3 A;  3VYS A;  3ERQ A;  5ELO A;  2WAQ B;  2OTJ A;  1VS0 A;  4ZKB B;  4YWL A;  2UXB Q;  3G6J B;  2F0W A;  4DV0 L;  4IOA A;  2RKS A;  4IPC A;  2F0U A;  4ZUI A;  3UDG A;  3URY A;  4QUF A;  1QB5 D;  1FNW A;  4LFB L;  1JE4 A;  1Y1V H;  2Y0S G;  3CQZ H;  2V4D A;  1G29 1;  3AMU A;  3KF8 A;  4K5W A;  3M9B A;  2IHE A;  2RSN A;  3NPP A;  4S3S A;  4MN3 A;  1EOT A;  1GVP A;  1NY4 A;  4RG1 A;  4A3J B;  4DV5 L;  2YTX A;  1RCV D;  1EUJ A;  2X6G A;  5IIF A;  5JEA G;  1N32 Q;  3ERS X;  5EPL A;  1O7Y A;  3OW2 A;  3G4N A;  3CC2 A;  3S17 B;  1X32 A;  3PO3 G;  1JOQ A;  3MWY W;  1VQF A;  1HZ9 A;  1WCM B;  5C4X G;  4OO1 G;  3QIA A;  1MJC A;  4G7O C;  3RZO B;  1I4P A;  3H15 A;  2WB1 B;  3J7A V;  5GRO A;  3P75 A;  1YNX A;  1KC8 C;  4XXE A;  2JEB I;  1N8R C;  1GUW A;  1Q82 C;  4DU9 A;  3HP3 A;  4A3K G;  2F03 A;  3HKZ B;  1I94 Q;  1EZ6 A;  2QA4 A;  1LTG D;  4KHP L;  4J15 A;  3PF4 A;  1WTO A;  3SK8 A;  3VA7 A;  4RGT A;  2UUC Q;  2N55 A;  4IPG A;  2M00 A;  1Q12 A;  4K8I A;  1XNR L;  4YHH L;  4BS9 A;  3Q22 A;  3RLN A;  3CRL C;  1L0X B;  2JA5 G;  1UE6 A;  1TWC B;  5HUR A;  2AQ3 B;  3PUX A;  1PMR A;  4WRD A;  2H1E A;  5C44 G;  1BCP C;  1NAP A;  2B39 A;  2K28 A;  1ENF A;  2YV5 A;  4IPH A;  4NXN L;  1FNV A;  2Q8T A;  5C4Z A;  5GAE C;  3HOU B;  1HR0 W;  1NR4 A;  1LLR D;  3O13 A;  2PZU A;  3U9S A;  1XPR A;  3HOX B;  2RA4 A;  1N33 Q;  5JJZ A;  5DLQ E;  4FO2 A;  4K5V A;  5CR3 A;  3ZYY X;  1E1T A;  1YNN D;  4ZKC B;  3K0X A;  4RMF A;  3S15 B;  5C0X J;  4UY8 C;  4ME3 A;  4A3J H;  2I5M X;  4XQN A;  4BBS G;  1BDO A;  1WYD A;  1Y14 B;  3T1Y Q;  4JI7 L;  2IX1 A;  4DF7 A;  1G2T A;  2SNS A;  2R6G A;  4JC0 A;  1BF4 A;  4LNQ A;  2DY8 A;  3EVQ A;  3S17 H;  1WD0 A;  1ILQ A;  4IUN A;  4QUC A;  5LMU L;  4DV2 L;  1WCM H;  2KEE A;  4QGU A;  2BDN A;  3BVG A;  2R93 G;  2IY5 B;  4ODG A;  1W3S A;  2DJG C;  4I65 A;  4QMG A;  3CRK C;  4HSV A;  3RZO H;  1ICW A;  2PCF B;  4NDX A;  1SYD A;  4DV1 Q;  3A55 A;  3TP7 A;  2PNH A;  3NWS A;  4IO9 A;  2Z6K A;  2I0Q A;  1TWG B;  1M90 C;  5LL6 S;  4I7A A;  4N9T A;  3HOV B;  1BNZ A;  2B2V A;  1TWH B;  4GOP A;  5I9P A;  2HCI A;  4PZ7 A;  2K5N A;  1VQ4 A;  4GS3 A;  1Q90 A;  1DYQ A;  1LTS D;  4A3M G;  1X56 A;  1TWC H;  2EE1 A;  2FMM A;  1B53 A;  4YCV A;  1H9R A;  1EY0 A;  4GN3 B;  3U4Z A;  4B3M Q;  3HOU H;  3NWT A;  4B9X A;  2F0D A;  1D5M C;  1I4X A;  3OTO L;  4ULL A;  2ZJP A;  4LF4 L;  2ZTE A;  1PXU A;  4OEL B;  2DUD A;  3HOX H;  4XDX A;  5AJ3 L;  4KKU A;  1JOR A;  4PG3 A;  4LK1 C;  1ONL A;  1J9O A;  3S15 H;  4IQZ A;  1G6P A;  3K8A A;  1BR9 A;  4OGQ C;  1KAB A;  3CPF A;  4HSP A;  1TY0 A;  3E3X A;  2L9H A;  3OOC A;  4NMZ A;  1CM9 A;  3S24 A;  2EY1 A;  1EY6 A;  4KY7 A;  4KV6 A;  2R61 A;  4NB3 A;  4N8F A;  5DEH A;  5CV6 A;  1MHW C;  1WJJ A;  2D9U A;  1EEF D;  2RDG A;  3TRZ A;  5ELC A;  3FMC A;  2ZJQ A;  2EXZ A;  2R3Z A;  3G4O A;  1X3Q A;  2F0H A;  5EPJ A;  1LAB A;  3UDI A;  2K6A A;  1CHP D;  4KY5 A;  1TWG H;  1PH5 A;  4DA2 A;  1HHV A;  4X3S A;  3FKI B;  5JEA J;  3HOV H;  4K5X A;  2A68 C;  3MXP A;  4A3E G;  5J22 A;  4KKS A;  1TWH H;  1HR0 L;  2L12 A;  4IJH A;  4ME5 A;  5IYC G;  3I2Z A;  1ZEQ X;  4OL7 A;  2JXM B;  4DV0 Q;  4PMW A;  1QCB D;  3PF5 A;  5C3E B;  1S5B D;  1VQJ A;  2X6L A;  4ZUJ A;  4LFB Q;  4DR6 L;  4LF8 L;  2HIV A;  2L55 A;  4HCE A;  2ZXO A;  1YNJ C;  1CK1 A;  3FPP A;  3CCS A;  1BKB A;  1SYB A;  4AYB E;  1CKN A;  3TS0 A;  4WFN 3;  4DV5 Q;  1HNW Q;  1KIX A;  3J81 c;  3A7L A;  2D62 A;  1PA6 A;  4CKB A;  4C2M B;  4FVM A;  2A6E C;  1PZJ D;  4QL5 A;  5IGC A;  1LAC A;  2QKI C;  1DOK A;  1Q8I A;  4BBR G;  5FK9 C;  3K5M A;  4HJ7 A;  1TWA B;  4EQO A;  1WTV A;  1A8V A;  4F7X A;  1DD2 A;  2B3G A;  4P75 A;  1BO0 A;  3I4O A;  2BOS A;  3ITP A;  1CZG A;  4DUZ L;  2PPB C;  3OMC A;  2KED A;  4R4O A;  5FLX E;  3A74 A;  1Y8O B;  4PQX A;  5LMN L;  1K8M A;  4KHP Q;  2OXP A;  1R4P B;  2F4V Q;  5CV5 A;  1QWY A;  1ENA A;  1BBW A;  1JE5 A;  2A73 B;  5T1G A;  3DUZ A;  1O7Z A;  1XNR Q;  3C1F A;  5FKA C;  3KFU A;  5KIX A;  1D1I A;  4JG2 A;  1IW7 D;  5H1S E;  3F2D A;  2D5D A;  3BZK A;  3FKI H;  2K05 A;  1KLG D;  3AYH B;  1EIH A;  2O5I C;  2A69 D;  4X62 L;  4JPB W;  4NXM Q;  3HGB A;  1ICF B;  3I4M B;  3H91 A;  4LFC L;  1GO3 E;  2ICE C;  4NXN Q;  3I4N B;  3T1H L;  5IYB H;  3KLW A;  3MVV A;  3GQB A;  1K8G A;  2CKZ B;  5C3E H;  5M5X B;  3OIQ A;  2ZJR A;  1F9R A;  3S1R B;  2E76 C;  3PUZ A;  3JC6 6;  2MUY A;  1SE2 A;  4JI0 Q;  1FYC A;  1A62 A;  3BDL A;  1GUS A;  4JI7 Q;  2WB1 G;  2KEN A;  1KQS A;  4C2M H;  3BYT B;  2VXW A;  1LV9 A;  1HFN A;  3QOJ A;  2ALY B;  3TSS A;  1C8C A;  5DAU A;  3GV3 A;  1OXV A;  3H09 A;  1Y8P B;  5LMU Q;  4DV2 Q;  3TP6 A;  1TWA H;  1EQR A;  3K7A B;  5I9O A;  1P16 A;  2J7Z A;  4GZY C;  2MP1 A;  1MIU A;  2KCT A;  1Z52 A;  1B1Z A;  2F0P A;  3L9A X;  1H9J A;  3D6C A;  3K59 A;  1WTR A;  1MGS A;  3BYY B;  3GV6 A;  5CGK A;  3J81 i;  4LUO A;  2RHQ B;  2PNR C;  1A6X A;  5J1Z A;  1TR5 A;  3R3O A;  1SYF A;  4YIJ A;  2IT1 A;  3TS2 A;  1EL0 A;  4DR1 L;  1Q3L A;  2DJF C;  2WB1 E;  2Q8R E;  1AH9 A;  2FMC A;  5ELN A;  4O1N A;  1Q8K A;  3HKZ E;  3HRZ C;  3D4W A;  4KK7 A;  2BDO A;  3I4M H;  1DCZ A;  2KHI A;  5ELD A;  2WV6 D;  1VQE A;  2CW0 D;  1NUC A;  5I6W A;  3I4N H;  5HGT A;  3UE0 A;  3ULL A;  5FLM G;  3OTO Q;  4HIM A;  3C3L A;  1PTO F;  2EY5 A;  1X65 A;  2K32 A;  4ZRZ A;  3KJP A;  3GTL B;  5M5X H;  3GTK B;  2R7Z G;  4A3G B;  4DN4 M;  1NBW A;  3S1R H;  5AJ3 Q;  1CHQ D;  1LT4 D;  5LL6 X;  1EYD A;  3I70 A;  4RCN A;  3G6E A;  3TEH B;  1NE3 A;  1EYC A;  2XNA C;  3VR2 A;  3K5L A;  1X9N A;  5DNF A;  1GUT A;  4ABN A;  1YHQ A;  5IGB A;  1DOL A;  3C1E A;  3EJI A;  2SDF A;  2RVL A;  3NEN A;  1E1O A;  1UEA B;  1AP0 A;  1B4O A;  5JAV A;  3ND9 A;  2AUK A;  4HR7 B;  2B8F A;  1K3R A;  3T1Y L;  4A3B B;  5E4X A;  3EA6 A;  1HTP A;  2B29 A;  1ROD A;  3K7A H;  1M8A A;  1ML0 D;  4KI0 A;  5IP7 G;  2E8G A;  3CCQ A;  1EOV A;  4X64 L;  1E2V A;  3NEL A;  1S5F D;  3SXH A;  5FLX c;  2A74 C;  3DEO A;  2E2J B;  2N49 A;  1B7Y B;  1RTN A;  3CC4 A;  1K73 C;  4LW1 A;  2EJG C;  1Y1W B;  2EXD A;  2AQ1 B;  2RCF A;  1H9S B;  4IFD G;  5GQO A;  4FF4 A;  2MHV A;  1EWC A;  1HNZ Q;  1HH2 P;  2VB2 X;  4CDF C;  4CKE A;  3PO2 B;  2O5J C;  2K5H A;  1A3V A;  2JYO A;  5A2Q E;  1DXM A;  1HR0 Q;  1G91 A;  3GTG B;  2ZXP A;  3T56 B;  4DV3 Q;  5M3F B;  4R4Q A;  4Y52 H;  2BE5 C;  1SRU A;  2KBN A;  4OWW B;  3CKI B;  3OMG A;  2ICI A;  1VQK A;  3X3N A;  1VMP A;  2R92 G;  1I4G A;  4DR6 Q;  1G51 A;  2QEJ C;  5ELB A;  2C35 B;  4A3I B;  3GTL H;  3VR3 A;  1XXG A;  4DAY B;  3GTK H;  4A3G H;  4JOI A;  2MGS A;  1H95 A;  1PTO B;  1TKW B;  1VDZ A;  3PGZ A;  3QO2 A;  3CXC A;  4B3M L;  5IOD A;  2ZT9 C;  3G7L A;  4P72 A;  3DWA A;  1PTO D;  2CHB D;  2SNM A;  4EQ5 A;  4GLX A;  2AWN A;  1D5X C;  4B3S Q;  1CTM A;  2LXJ A;  1RL2 A;  4JK1 C;  1DJR D;  1R4Q B;  2A1A A;  3AU7 A;  3EN2 A;  2B2Y C;  4RKB A;  2KCN A;  1U4L A;  3M4Q A;  2NTT A;  2H5X A;  1DON A;  3SHL A;  2PQA B;  3WOE A;  2MQH A;  1BXT A;  3CCM A;  4K0K L;  4A3B H;  3MHB A;  1R9T B;  4DUZ Q;  4IZ8 A;  1FL0 A;  4NW2 A;  2VB3 X;  4KTA A;  1HFG A;  4G7Z C;  5IYD H;  3M4P A;  2DNE A;  4R4T A;  1Q1E A;  5JVH 3;  1RF2 D;  1BCP F;  3MXN A;  4DNT B;  2E2J H;  4BY1 G;  5JPN C;  1VQH A;  1VQC A;  4A93 G;  2BH8 A;  1Y1W H;  1IL8 A;  4IFD I;  1NNX A;  5C3E G;  1IBK L;  1EFW A;  4HTH A;  1SJH D;  1F2Y A;  3BVZ A;  3PO2 H;  3SE0 A;  5DM7 3;  5D14 A;  2ZXR A;  3DMU A;  1PV4 A;  4X62 Q;  4UHV A;  3TZD A;  3GTG H;  1ET9 A;  1HNX Q;  1S72 A;  3KBX A;  4OX9 L;  2EQS A;  1HQR D;  5M3F H;  3IFT A;  5E4W C;  4HAE A;  5D3I B;  3HS0 C;  4LFC Q;  2NZ1 D;  3K7U C;  5KNB A;  5KND A;  4GLV B;  4CBV A;  2UUB L;  4KLK A;  3I73 A;  5A2Q L;  4I7Z C;  1I6V C;  3I56 A;  2HUG A;  4A3I H;  1RIP A;  4J8Q A;  1A3U A;  4A3C H;  1PTO H;  4ILW A;  1VQ8 A;  2EYJ A;  1XMO L;  4UP7 A;  2NZH A;  4DR3 L;  1J5E L;  4L5R C;  1QG7 A;  1EIY B;  5BN4 A;  4Q5V A;  2IW3 A;  1KNE A;  1YHB A;  1RTO A;  1N9W A;  1GM5 A;  4AQY L;  4ZCK A;  1HNW L;  3HOY B;  3AEV A;  2NWG A;  1STA A;  4LF9 L;  2QDB A;  1KDA A;  4QB4 A;  4C3I B;  2XGT A;  4ID6 A;  4XT3 B;  1CI3 M;  1R9T H;  2HIX A;  1VQL A;  2AUJ D;  1I5F A;  5IP9 H;  2HHH L;  1MJE A;  3H3V C;  2HQL A;  4XIG S;  5J3B A;  4GN5 A;  1OXU A;  1C9O A;  3I4M G;  5K5P A;  4LAA A;  3X3M A;  4MTK A;  1BCP B;  2GVB A;  3SK6 A;  2G9H D;  4OXP A;  4ALP A;  4DR1 Q;  1BCP D;  4A75 A;  1O80 A;  3HOZ G;  4DNR B;  1H9S A;  5I2Y A;  2F4V L;  1MI2 A;  4C3J B;  1JB7 A;  1MD2 D;  5M3M G;  1SRO A;  3TQY A;  1IZ6 A;  3D31 A;  1CKM A;  3TP5 A;  1Q7Y C;  3CD6 A;  1UEB A;  1A2U A;  4NXM L;  1B2T A;  1A3T A;  1K83 B;  4BA1 I;  1PFN A;  1B3Q A;  1LO5 D;  5TSS A;  5C5M A;  4TRD A;  1SMY C;  1K0S A;  1AZQ A;  3HOW B;  1TQO A;  3P1H A;  4P2C B;  3Q24 A;  1JJG A;  4IFD J;  1X6O A;  1PH9 A;  4DV4 L;  4DAY A;  3LX0 A;  1XNQ L;  1L2F A;  5NUC A;  3J7A F;  3J80 E;  1OXS C;  1X54 A;  5HGQ A;  1DM0 B;  3R2I A;  3NQT A;  3J81 E;  2OTL A;  1EY7 A;  2B63 G;  1XTD A;  3V05 A;  2NN6 H;  3MFY A;  1I4R A;  4JI0 L;  1E24 A;  2N78 A;  3FVQ A;  3HOY H;  2NZO A;  1LM0 A;  2MFI A;  2A19 A;  4JW0 A;  4QIW B;  4WJ3 M;  2EJM A;  2KOL A;  4C3I H;  4X3T A;  3NQI A;  2PQA A;  4X64 Q;  3V96 A;  5FJ8 H;  2RQX A;  3H6M A;  2JA6 G;  1D1K A;  3LWU A;  3RZD B;  2KHS A;  3RUZ A;  4U68 A;  2I46 A;  2L4N A;  1KDB A;  3Q0A A;  2R7F A;  4L6T B;  3L0O A;  4EQP A;  3T51 B;  4A3G G;  2F4I A;  4C3J H;  2WAC A;  1GHJ A;  2HCC A;  3F1Z A;  3IKJ A;  3R2T A;  5EPK A;  1G2S A;  3D3R A;  1JC7 A;  2KQ3 A;  4GLA C;  3NSW A;  4N8X 1;  1PH8 A;  1EIF A;  1K83 H;  1U4P A;  3DXJ C;  1RD9 D;  2EYM A;  4HMI A;  1HJP A;  1FGU A;  3IRB A;  1BBX C;  3HOW H;  2CWP A;  3PUW A;  4NPS A;  4A3B G;  1KNA A;  3LNN A;  4GNX C;  4B3T L;  1UUP A;  4A3F B;  1K8A C;  4CJ0 B;  1DGS A;  1P8L A;  5IT9 c;  4JV5 L;  2JA8 B;  4B3R L;  3PIO 3;  5BN3 A;  5E7N A;  2F0F A;  1SFO B;  2CFM A;  1JQY D;  5EJW A;  5M9O A;  5D3D A;  5K36 H;  2IPK D;  3E9H A;  4UP9 A;  3QOL A;  4K0K Q;  1Y1W G;  1FJG L;  4OWT B;  4X3U A;  2JN4 A;  3EBE A;  4MIU A;  3J81 L;  1T9H A;  4DR4 L;  1L1O C;  3F8T A;  2HT1 A;  2VUM G;  2C5C A;  2JEA I;  2A68 D;  4X66 L;  2B2W C;  1EQV A;  2LS0 1;  4FF2 A;  3NTK A;  3A54 A;  2Z6B A;  3RZD H;  1IBK Q;  4YY3 L;  4AYB G;  1IYV A;  4DAM A;  1KAW A;  1W6K A;  2AQ2 B;  2LXK A;  1CUK A;  3A0J A;  1JCK B;  5CC4 A;  3DLL A;  4A3I G;  1FVI A;  1SNQ A;  1HQM C;  4N9P A;  4OIK A;  2YTY A;  5IGG A;  4OX9 Q;  3MEF A;  1HRJ A;  3AQQ A;  4BXX H;  2VQF L;  1Y1V G;  1HNZ L;  1QVC A;  1I4H A;  4GN4 B;  3R93 A;  1YNJ D;  3I3C A;  2UUB Q;  2NTS A;  2JA7 B;  2K75 A;  4DV3 L;  1X55 A;  1EU4 A;  4A3L H;  1D8L A;  1T5X D;  2ZM6 L;  2XN9 C;  1JWM D;  3S16 B;  5F2D A;  1W2B A;  2OT2 A;  2NB0 A;  2F0G A;  1LUZ A;  1VQ5 A;  4TSS A;  3KLS A;  4DAV A;  2B8G A;  2A6E D;  4IUQ A;  1SEB D;  1XYI A;  1VMC A;  1XMO Q;  3H0G B;  3PIP A;  4DR3 Q;  4IUT A;  1J5E Q;  2IJ0 A;  5CV7 A;  1Q81 C;  4A3F H;  3NHH A;  3IAY A;  1IL2 A;  4IN3 A;  1STN A;  2LSS A;  2JA8 H;  3H94 A;  5IP9 G;  1C0A A;  5EKL A;  3M7N A;  4AQY Q;  3J80 c;  4CGY B;  2CCZ A;  3S1M B;  2XRQ D;  5IGF A;  1SFO H;  2MPM A;  1YIJ A;  4R8N A;  3DM3 A;  1PZK D;  4LF9 Q;  4IOC A;  1U4R A;  4B3S L;  4JBW A;  1A63 A;  4QCL A;  5KGU A;  1C4Q A;  1SNO A;  1OTC A;  4KY6 A;  2R7D A;  3RLO A;  3DHQ A;  1GUO A;  1FD7 D;  2HHH Q;  4B08 A;  1Z7T A;  4A3D B;  2NBF A;  3I55 A;  5C0X H;  4HN7 A;  1NTG A;  2LMC B;  1ZYR C;  5EBC A;  1PH3 A;  4QF4 A;  2D0P A;  2YYZ A;  2QCP X;  5FO8 B;  3QR8 A;  1CQF A;  4P73 A;  3VR6 A;  2F0E A;  1S4Z A;  4DV7 L;  3I8Z A;  2WAQ G;  1BBU A;  3DWQ A;  3TDQ A;  3CAM A;  2Q2H A;  2K01 A;  2Y0S B;  3Q6S A;  2EY6 A;  2RHS B;  1GHK A;  2VL6 A;  4RGN A;  4DV6 L;  4L8J A;  3JAM c;  3FDT A;  4C1N K;  1I3Q B;  2HQE A;  3MC0 B;  1O7I A;  4JI3 L;  4CJ1 B;  5BR8 L;  1HNX L;  4JYA L;  4C3H B;  1EIG A;  4ZAI A;  2JA7 H;  3HKS A;  3PMF A;  4L5S A;  2K1B A;  4BY7 B;  2Z4H A;  1PRT C;  1PYS B;  4UP8 A;  3KUP A;  3RD4 A;  3SR1 A;  2A6H C;  1F9P A;  1K3B C;  4A3J G;  2IX3 A;  3S16 H;  3VYT A;  1LTA D;  3T16 A;  3PO3 B;  4RH6 A;  2H4O A;  1B8A A;  2RSO A;  4DV4 Q;  3WDN A;  2QGQ A;  3V2T A;  1EQQ A;  1XNQ Q;  3H0G H;  4C3I G;  5C4X B;  2WII B;  2B2T C;  2FIN B;  1BQQ T;  3DEP A;  1MKH A;  1SE4 A;  3FRP B;  2BA0 A;  3M7G A;  2WAQ E;  4XQJ A;  1WCM G;  3M4Y A;  5FJ8 G;  1MSH A;  1EYA A;  4PZ8 A;  1GJX A;  3C2P A;  1E2Z A;  3S1M H;  2AWO A;  4A3K B;  1G8Z D;  3S1Q B;  1QNU A;  4Q0F A;  1GUN A;  4R4C A;  4B9W A;  3CCE A;  4EX5 A;  1KL9 A;  3MXG A;  1A0I A;  1H9M A;  1SJE D;  2QIL A;  1Z9F A;  2QDL A;  3S9W A;  3KBG A;  3HKZ G;  4AIM A;  4FF3 A;  1IHZ A;  4DR7 L;  1PYW D;  4V19 0;  1GUG A;  4C1N I;  1EEI D;  2VNU D;  2NVT B;  2F3W A;  1CSP A;  3B6Y A;  3S14 B;  2JA5 B;  4A3D H;  2WKD A;  5C4H A;  2WKC A;  3PSI A;  2DN8 A;  3J80 i;  5C44 B;  2PI2 A;  4GKJ L;  1SXT A;  2OQK A;  2XVS A;  1ZKO A;  1VQ7 A;  2UU9 L;  2O4X A;  2GA4 B;  1J6Q A;  5GAH C;  2F0I A;  3ERO A;  3K57 A;  4FXD A;  3HOW G;  4WJW A;  3HOU G;  3ER0 A;  5M5W B;  5BN5 A;  2EJF C;  2JSO A;  2K52 A;  5FLX L;  4OEM B;  2JE6 I;  2DY7 A;  1EYG A;  1PFS A;  1HA5 A;  2PYK A;  1RHP A;  4FXG C;  3HOX G;  1E22 A;  1G6Z A;  1SE8 A;  1I3Q H;  1V8Q A;  2B2U C;  4C3H H;  4BY7 H;  3ULJ A;  4BBS B;  2J0T D;  1U4M A;  3GTJ B;  1LTL A;  4H7B A;  5JEA H;  3NBI A;  1CA6 A;  3HEJ A;  5EAY A;  1QVF A;  2AMC B;  1WTX A;  3PO3 H;  4B3T Q;  2BH2 A;  3BS1 A;  4V0B A;  4JV5 Q;  2N8N A;  4B3R Q;  5KEE A;  5C4X H;  1X3F A;  2R93 B;  3NTH A;  4OO1 H;  2RF4 A;  2EYP A;  1OO9 B;  2MO0 A;  1B9N A;  3BVM A;  1VQD A;  1XMQ L;  3STB C;  3OSO A;  4A3K H;  3S1Q H;  1TS5 A;  4GKK L;  1FJG Q;  4JI4 L;  4TQU S;  1PYB A;  5I6Y A;  2E2H B;  1PDQ A;  1HCZ A;  4M1U B;  3L2P A;  4DR4 Q;  4KN7 C;  2BCO A;  2NVT H;  4DNI A;  1VQM A;  2JA5 H;  3S14 H;  1K28 A;  4LJZ C;  3CCU A;  4X66 Q;  4U67 3;  3HOV G;  4OHJ A;  4A3M B;  2HD3 A;  3D6W A;  2WIN B;  1GXD C;  4QQB X;  4FYD A;  5C44 H;  4CDE C;  4LFA Q;  1CT1 D;  1V1P B;  3D0F A;  3MFG A;  4F8M A;  4YY3 Q;  1VQO A;  1QNK A;  2BE5 D;  2SEB D;  4EVO A;  4QIW E;  1JR0 D;  1WTH A;  1VF5 C;  3I7F A;  2P5Z X;  1EWH A;  4X6A H;  5M5Y B;  3J7Z C;  5FO7 B;  5E3F A;  3G48 A;  2VQF Q;  2YU9 B;  4NP5 A;  4F88 A;  5M5W H;  3C0N A;  1STG A;  1XPO A;  2I5L X;  2I5H A;  1UE1 A;  1HTL D;  4A3F G;  5GAG C;  1A2T A;  4O0A A;  5CV9 A;  2NVQ B;  1M1K C;  1SMX A;  2ZM6 Q;  4LUV A;  2F1M A;  1F2L A;  3FP9 A;  4HJ9 A;  4XQQ A;  4BBS H;  1JWS D;  2K33 A;  4RFB A;  3KJO A;  3GTJ H;  5L37 A;  1KTK A;  4JI1 L;  2K03 A;  2EPB A;  2CH4 A;  1EQT A;  1TY2 A;  4RHS A;  4UPA A;  1STB A;  1PH7 A;  2KHJ A;  4BA2 I;  1JJC B;  4RWS C;  3G4S A;  2R93 H;  2NVY B;  1EWI A;  1C48 A;  3VYU A;  2F0K A;  2Q2I A;  3GP7 A;  2CQO A;  4HJA A;  2PQE A;  1K8O A;  5EKI A;  1HZA A;  1XWE A;  5IGD A;  1SYG A;  2A5H A;  1PH4 A;  3GDE A;  2E2H H;  1ASZ A;  2N88 A;  4JBJ A;  1EY8 A;  3KOJ A;  4Z9C B;  4MTN A;  2LFN A;  3K5O A;  1YZ6 A;  4A3E B;  1YVC A;  5I4D A;  2F0V A;  1EZ8 A;  4H44 C;  3BDC A;  3FKI G;  1JJ2 A;  4BWG B;  1MSG A;  5LHY 1;  4A3M H;  4POF A;  1SSO A;  4J6H A;  5G3L F;  2K5Q A;  4DV7 Q;  3J7A 5;  1ESF A;  3A8I E;  4L5Q A;  4YWM A;  4P74 A;  1UE5 A;  4K2K A;  5IYB G;  5M5Y H;  3T13 A;  1VQN A;  3LWE A;  1SBB B;  2PI2 E;  3U50 C;  1N36 L;  4LF5 L;  4DV6 Q;  2YU9 H;  4JI3 Q;  1DZ1 A;  1N34 L;  5BR8 Q;  4JYA Q;  2D2C C;  2L15 A;  3UE1 A;  3TBI B;  2NVQ H;  1CZW A;  3EQL C;  2KVM A;  1U5K A;  1QZG A;  3QJY A;  1RDP D;  1YBY A;  4O42 A;  1IYU A;  3CCR A;  3PUY A;  4BBR B;  1VF7 A;  4KMU C;  2G9D A;  2EYL A;  3NE5 B;  3K0Y A;  4P71 A;  5IT9 E;  1SLJ A;  2Z4I A;  4FNF A;  2NVY H;  3CCV A;  3RMH A;  3TN2 A;  4HCS A;  2QW7 A;  1AEX A;  2KCC A;  1VQP A;  1GOZ A;  4KHV A;  2ASB A;  4O2D A;  2XIW A;  3DM1 A;  3VR4 A;  1L0W A;  2Z6K C;  3UDF A;  2MJ8 A;  2K5V A;  1V1O A;  4DR7 Q;  5KRU A;  3K5N A;  2QF7 A;  4WOR A;  1K0R A;  4OIJ A;  4RAU C;  4MZ9 A;  3ONA B;  4AH6 A;  5EKK A;  2B2V C;  2PW5 A;  4GOP C;  5ISR A;  1WVL A;  3BU2 A;  4A3E H;  3TZU A;  2HDL A;  3TP8 A;  1VCI A; 
#chains in the Genus database with same CATH homology
 4ZQ3 A;  2F0L A;  5AFW A;  4G4K A;  2XWB B;  2FJ2 A;  1PFB A;  1TS3 A;  1B44 D;  4C3H G;  3IL8 A;  4ZYS A;  1WTQ A;  4CJ2 C;  4PMC A;  1V1P A;  1B9M A;  4RHR A;  1AN8 A;  5G3L D;  2J4X A;  1SMY D;  2LY7 A;  1ESR A;  1HUN A;  3MAQ A;  3I90 A;  2M2L A;  4XYQ A;  5ELE A;  1LT6 D;  4HED A;  4M8A A;  1Y8N B;  3M85 A;  5EGT A;  2F0T A;  2B2Y A;  2XRS D;  4FXK C;  2NYZ D;  4E6I A;  1NR2 A;  1HA6 A;  1V43 A;  1JOK A;  2FFK B;  2IX0 A;  1JWU D;  3S1N B;  1EY9 A;  4KJO A;  4KKT A;  4K2L A;  1EFI D;  2M9V A;  4IUR A;  3OWE B;  4NKL A;  3MXU A;  1LTR D;  1D6E C;  1ZXT A;  5IT9 L;  1EY4 A;  2F0M A;  2F3V A;  1H9K A;  5FOB B;  3VYR A;  3C0M A;  1MBY A;  4DFA A;  4DXF A;  5KYI A;  3P20 A;  4RA8 A;  2IL8 A;  2PMZ B;  2R7Z B;  1F2M A;  3HG9 A;  1D2B A;  5J39 A;  3OIP A;  1TU2 B;  3W3A A;  3NTI A;  4FF1 A;  4EGV A;  3JAM E;  1YNN C;  2Z8L A;  4OO1 I;  2C9O A;  5FO9 B;  1HUM A;  3A8J E;  1F2Z A;  4UAI A;  1I6H B;  1TS4 A;  2PZW A;  3MEH A;  4KN4 C;  1PLF A;  1LTB D;  1II3 A;  5C3W A;  1WD1 A;  5I2X A;  2TSS A;  3NUC A;  1TT2 A;  1ET6 A;  4TKO B;  4XYO A;  2L5T A;  2L11 A;  2F0N A;  4IUV A;  3OPO A;  3W2D A;  2FHT A;  3J80 L;  1AW7 A;  3A7A B;  1PRT F;  3PIP 3;  2WP8 J;  4Y7N B;  2R92 B;  2Z1C A;  1SYE A;  5JOB A;  3PUV A;  2E74 C;  3SDZ A;  2F0J A;  1EU3 A;  2EYO A;  2RBM A;  1LT5 D;  4FP5 D;  4DXG A;  1QIL A;  4F87 A;  3RLF A;  1F9Q A;  4DGZ A;  4RCO A;  5D65 A;  1S5D D;  1I4Q A;  5JPM C;  3C0O A;  1BOS A;  1STE A;  3L7Z C;  5CYU A;  2EZV A;  1UNS A;  3JAM L;  2E2I B;  2XWJ B;  4RGM A;  3N52 A;  2RDH A;  5A35 A;  2EDG A;  3BG3 A;  2LKV A;  3BDO A;  3FEW X;  1F77 A;  5E1F A;  2I07 B;  1STH A;  2K5W A;  2PW7 A;  3GO5 A;  2IWH A;  1HPC A;  1B50 A;  1ZYR D;  4BY1 B;  4A93 B;  2O2L D;  3GTM B;  1KLU D;  1BUV T;  4IFD H;  1B3A A;  3I72 A;  3OWF A;  2KJX A;  2E2D C;  1XTC D;  3I4L A;  1CFM A;  4MHE A;  2EYF A;  1O78 A;  1JB3 A;  3M3Y B;  4RGO S;  3NXW A;  1SND A;  2JP1 A;  1W6J A;  3MA2 B;  3OW7 A;  1Z47 A;  1QOH A;  3NK9 A;  5CMD A;  5JVG 3;  3QG1 A;  4IUU A;  1PRT B;  1DOM A;  3N6R A;  1LTT D;  2F0O A;  1PRT D;  2A6H D;  2F0Q A;  4XTC S;  3NBH A;  3QWN A;  1STY A;  4KD4 A;  4KHZ A;  2XSC A;  4R8I A;  3MZ5 A;  4CKC A;  2NUC A;  1O7L A;  4G7H C;  5C3X A;  1I50 B;  3CU7 A;  3SEB A;  3T53 B;  3Q23 A;  3L3O C;  2NN6 G;  3ND8 A;  2X69 A;  4J1M A;  5EBD A;  5CV8 A;  3KK7 A;  1JOO A;  1M4V A;  4KJN A;  3D4R A;  2ENB A;  4PNY A;  4IAL A;  4EQN A;  1SNC A;  2OEO A;  5C4J B;  3CHB D;  3BZD B;  3K58 A;  4PV1 C;  3VR5 A;  2B2W A;  4K6D A;  1IW7 C;  3HOZ B;  2EYH A;  5KYL A;  1U9R A;  2A69 C;  4PMB A;  2NVX B;  5M3M B;  1WTP A;  4DK0 A;  1OXX K;  4C3J G;  4L63 B;  1QJO A;  2K7V A;  5C5L A;  3UI2 A;  1TVX A;  3IFD A;  1X3P A;  5COY A;  2CVR A;  3GTO B;  5KNC A;  4R9W A;  3MTS A;  3SK5 A;  1S5E D;  1ILP A;  2K5D A;  3S2H B;  1E0B A;  3NP8 A;  1PZI D;  1UAP A;  2B63 B;  2DNC A;  2PO4 A;  3KLS X;  1XX8 A;  4LMQ D;  1FNU A;  1D5Z C;  2NN6 I;  5CBE E;  5K36 G;  1JIC A;  4G57 A;  1LTI D;  5T1I A;  1OXT A;  3EFX D;  4ZLT F;  1J8I A;  4IUP A;  1PRE A;  2JA6 B;  1QE6 A;  4DK1 A;  1TII D;  3I91 A;  5DM6 3;  3HZX A;  3PV0 A;  2TMP A;  1ENC A;  3M4O B;  2EVB A;  3WOF A;  3S2D B;  2EY2 A;  3KLR A;  1RJT A;  3GD7 A;  1T5E A;  1WTW A;  2CW0 C;  5IGE A;  2ID0 A;  4CHT B;  4H0L C;  1IKL A;  4ZK9 B;  3SK4 A;  3E0J A;  3GTQ B;  1FGB D;  2KEC A;  1NCV A;  1NSN S;  2KUM A;  3C46 A;  3R8B A;  2KA7 A;  3P7J A;  3GTP B;  1SNM A;  1SE3 A;  2B2T A;  2F0S A;  3F2U A;  4UDU C;  4K8J A;  3A56 A;  1RKN A;  1TS2 A;  2Q8I B;  1Q1B A;  3OHX C;  1AZP A;  5EQ0 A;  2VUM B;  3T4A C;  5C0X G;  2BA1 A;  1TWF B;  2OF1 A;  4RKL A;  5IOC A;  3E5S A;  3U9O A;  2SOB A;  3J7Y W;  4K14 A;  5C6A A;  1SAP A;  4AYB B;  4DAP A;  5CBA E;  1AFP A;  1PFM A;  2K04 A;  1KDC A;  3A8K E;  3TME A;  4HMJ A;  1EY5 A;  2RDF A;  1Y1V B;  3CQZ B;  4K6L A;  5ELF A;  1A15 A;  2HDM A;  3AB9 A;  2B2U A;  2L1B A;  1KAA A;  1FR3 A;  4C56 C;  1IKM A;  2CQA A;  1PTO C;  1SYC A;  1F9S A;  3QB3 A;  3DWP A;  4KD3 A;  3D8G A;  5COR A;  3FPU B;  1CQV A;  3D4D A;  2L0C A;  5CV4 A;  4XT1 B;  1L0Y B;  3K6O A;  1SDF A;  1Z6H A;  1SNP A;  1HXY D;  4X3K A;  1S5C D;  1CA5 A;  3SVM A;  1Y69 U;  2E75 C;  3E6Z X;  4H13 C;  1LT3 D;  2PZT A;  5C0X I;  1E2W A;  3VA5 A;  2EOT A;  3VYS A;  3ERQ A;  2WAQ B;  4ZKB B;  3G6J B;  2F0W A;  2RKS A;  2F0U A;  4ZUI A;  3URY A;  4QUF A;  1QB5 D;  1FNW A;  1JE4 A;  2V4D A;  1G29 1;  3AMU A;  3KF8 A;  4K5W A;  2RSN A;  3NPP A;  4S3S A;  4MN3 A;  1EOT A;  4A3J B;  1RCV D;  2X6G A;  5IIF A;  5JEA G;  5EPL A;  1O7Y A;  3G4N A;  3S17 B;  1X32 A;  1JOQ A;  3MWY W;  1WCM B;  4OO1 G;  3QIA A;  4G7O C;  3RZO B;  1I4P A;  3J7A V;  2WB1 B;  3P75 A;  4XXE A;  2JEB I;  1GUW A;  4DU9 A;  3HP3 A;  2F03 A;  3HKZ B;  1EZ6 A;  1LTG D;  1WTO A;  3SK8 A;  3VA7 A;  4RGT A;  2N55 A;  2M00 A;  1Q12 A;  4K8I A;  4BS9 A;  3Q22 A;  3CRL C;  1L0X B;  1TWC B;  5HUR A;  2AQ3 B;  3PUX A;  1PMR A;  4WRD A;  2H1E A;  1BCP C;  1NAP A;  2B39 A;  2K28 A;  1ENF A;  1FNV A;  2Q8T A;  5C4Z A;  3HOU B;  1NR4 A;  1LLR D;  3O13 A;  2PZU A;  3U9S A;  3HOX B;  2RA4 A;  5JJZ A;  4FO2 A;  4K5V A;  5CR3 A;  3ZYY X;  1YNN D;  4ZKC B;  3S15 B;  5C0X J;  4XQN A;  1BDO A;  2IX1 A;  4DF7 A;  1G2T A;  2SNS A;  2R6G A;  1BF4 A;  2DY8 A;  3EVQ A;  1WD0 A;  1ILQ A;  4IUN A;  4QUC A;  2KEE A;  2BDN A;  3BVG A;  4ODG A;  4QMG A;  4I65 A;  3CRK C;  4HSV A;  1ICW A;  2PCF B;  4NDX A;  1SYD A;  3A55 A;  3TP7 A;  3NWS A;  1TWG B;  5LL6 S;  4N9T A;  3HOV B;  1BNZ A;  2B2V A;  1TWH B;  5I9P A;  2HCI A;  1Q90 A;  1DYQ A;  1LTS D;  2EE1 A;  2FMM A;  1B53 A;  1H9R A;  1EY0 A;  3NWT A;  4B9X A;  2F0D A;  1D5M C;  1I4X A;  4ULL A;  1PXU A;  4XDX A;  4KKU A;  1JOR A;  4LK1 C;  1ONL A;  1J9O A;  4IQZ A;  1BR9 A;  4OGQ C;  1KAB A;  4HSP A;  1TY0 A;  2L9H A;  3OOC A;  4NMZ A;  1CM9 A;  2EY1 A;  1EY6 A;  4KY7 A;  4KV6 A;  2R61 A;  5DEH A;  5CV6 A;  2D9U A;  1EEF D;  2RDG A;  5ELC A;  3FMC A;  2EXZ A;  2R3Z A;  3G4O A;  1X3Q A;  2F0H A;  5EPJ A;  1LAB A;  2K6A A;  1CHP D;  4KY5 A;  4DA2 A;  1HHV A;  4X3S A;  3FKI B;  5JEA J;  4K5X A;  2A68 C;  3MXP A;  5J22 A;  4KKS A;  2L12 A;  4ME5 A;  1ZEQ X;  4OL7 A;  2JXM B;  4PMW A;  1QCB D;  5C3E B;  1S5B D;  2X6L A;  4ZUJ A;  2L55 A;  4HCE A;  2ZXO A;  1YNJ C;  1CK1 A;  3FPP A;  1SYB A;  4WFN 3;  3A7L A;  2D62 A;  4CKB A;  4C2M B;  4FVM A;  2A6E C;  1PZJ D;  5IGC A;  1LAC A;  2QKI C;  1DOK A;  1Q8I A;  3K5M A;  5FK9 C;  1TWA B;  4EQO A;  1WTV A;  1DD2 A;  4F7X A;  1BO0 A;  2BOS A;  3ITP A;  1CZG A;  2PPB C;  3OMC A;  2KED A;  5FLX E;  1Y8O B;  4PQX A;  1K8M A;  2OXP A;  1R4P B;  5CV5 A;  1QWY A;  1ENA A;  2A73 B;  5T1G A;  3DUZ A;  1O7Z A;  3C1F A;  5FKA C;  5KIX A;  1D1I A;  1IW7 D;  2D5D A;  2K05 A;  1KLG D;  1EIH A;  2O5I C;  2A69 D;  3HGB A;  3I4M B;  3H91 A;  2ICE C;  3I4N B;  3MVV A;  3GQB A;  5M5X B;  3OIQ A;  1F9R A;  3S1R B;  2E76 C;  3PUZ A;  2MUY A;  1SE2 A;  1FYC A;  3BDL A;  1GUS A;  3BYT B;  2VXW A;  1LV9 A;  1HFN A;  3QOJ A;  3TSS A;  1C8C A;  5DAU A;  3GV3 A;  1OXV A;  3H09 A;  1Y8P B;  3TP6 A;  3K7A B;  5I9O A;  2J7Z A;  4GZY C;  2MP1 A;  1Z52 A;  1B1Z A;  2F0P A;  3L9A X;  1H9J A;  3D6C A;  3K59 A;  1WTR A;  1MGS A;  3BYY B;  3GV6 A;  5CGK A;  2PNR C;  1A6X A;  5J1Z A;  1TR5 A;  3R3O A;  1SYF A;  4YIJ A;  2IT1 A;  1EL0 A;  1Q3L A;  2Q8R E;  2FMC A;  4O1N A;  3HRZ C;  3D4W A;  4KK7 A;  2BDO A;  1DCZ A;  5ELD A;  2WV6 D;  2CW0 D;  1NUC A;  5I6W A;  5HGT A;  3C3L A;  1PTO F;  2EY5 A;  2K32 A;  4ZRZ A;  3GTL B;  3GTK B;  4A3G B;  4DN4 M;  1CHQ D;  1LT4 D;  5LL6 X;  1EYD A;  3I70 A;  4RCN A;  1EYC A;  2XNA C;  3VR2 A;  3K5L A;  5DNF A;  1GUT A;  4ABN A;  5IGB A;  1DOL A;  3C1E A;  3EJI A;  2SDF A;  2RVL A;  1UEA B;  1AP0 A;  1B4O A;  5JAV A;  3ND9 A;  2AUK A;  4HR7 B;  2B8F A;  4A3B B;  5E4X A;  3EA6 A;  1HTP A;  1ROD A;  1M8A A;  1ML0 D;  4KI0 A;  1E2V A;  3SXH A;  1S5F D;  2A74 C;  3DEO A;  2E2J B;  1RTN A;  2EJG C;  1Y1W B;  4IFD G;  2AQ1 B;  1H9S B;  4FF4 A;  2MHV A;  1EWC A;  2VB2 X;  4CKE A;  3PO2 B;  2O5J C;  1A3V A;  2JYO A;  5A2Q E;  1DXM A;  1G91 A;  3GTG B;  2ZXP A;  3T56 B;  5M3F B;  2BE5 C;  3CKI B;  3OMG A;  2ICI A;  3X3N A;  1VMP A;  1I4G A;  2QEJ C;  5ELB A;  4A3I B;  3VR3 A;  1XXG A;  2MGS A;  1PTO B;  1TKW B;  1VDZ A;  3QO2 A;  5IOD A;  2ZT9 C;  3G7L A;  3DWA A;  1PTO D;  2CHB D;  2SNM A;  2AWN A;  1D5X C;  1CTM A;  4JK1 C;  1DJR D;  1R4Q B;  3AU7 A;  2B2Y C;  4RKB A;  2KCN A;  1U4L A;  2NTT A;  1DON A;  3SHL A;  3WOE A;  1BXT A;  3MHB A;  1R9T B;  4IZ8 A;  4NW2 A;  2VB3 X;  4KTA A;  1HFG A;  4G7Z C;  2DNE A;  1Q1E A;  5JVH 3;  1RF2 D;  1BCP F;  3MXN A;  4DNT B;  5JPN C;  1IL8 A;  4IFD I;  4HTH A;  1SJH D;  1F2Y A;  3BVZ A;  3SE0 A;  5DM7 3;  5D14 A;  2ZXR A;  3DMU A;  3TZD A;  1ET9 A;  3KBX A;  1HQR D;  3IFT A;  5E4W C;  4HAE A;  5D3I B;  3HS0 C;  2NZ1 D;  5KNB A;  5KND A;  4CBV A;  3I73 A;  5A2Q L;  4I7Z C;  1I6V C;  2HUG A;  4J8Q A;  1A3U A;  1PTO H;  4ILW A;  2EYJ A;  1QG7 A;  5BN4 A;  4Q5V A;  2IW3 A;  1KNE A;  1RTO A;  3HOY B;  2NWG A;  1STA A;  2QDB A;  1KDA A;  4QB4 A;  4C3I B;  4ID6 A;  4XT3 B;  1CI3 M;  2AUJ D;  3H3V C;  4XIG S;  1OXU A;  5K5P A;  4LAA A;  3X3M A;  1BCP B;  3SK6 A;  2G9H D;  1BCP D;  1O80 A;  4DNR B;  1H9S A;  5I2Y A;  1MI2 A;  4C3J B;  1MD2 D;  3D31 A;  3TP5 A;  1A2U A;  1B2T A;  1A3T A;  1K83 B;  4BA1 I;  1PFN A;  1LO5 D;  5TSS A;  5C5M A;  4TRD A;  1SMY C;  1AZQ A;  3HOW B;  1TQO A;  3P1H A;  4P2C B;  3Q24 A;  4IFD J;  4DAY A;  3LX0 A;  5NUC A;  3J7A F;  3J80 E;  1OXS C;  1DM0 B;  3R2I A;  3NQT A;  3J81 E;  1EY7 A;  3V05 A;  2NN6 H;  3MFY A;  1I4R A;  3FVQ A;  4QIW B;  2EJM A;  2KOL A;  4X3T A;  3NQI A;  3V96 A;  2RQX A;  3H6M A;  1D1K A;  3LWU A;  3RZD B;  2KHS A;  3RUZ A;  4U68 A;  2I46 A;  2L4N A;  1KDB A;  3Q0A A;  4L6T B;  4EQP A;  3T51 B;  2F4I A;  2WAC A;  1GHJ A;  2HCC A;  3IKJ A;  3R2T A;  5EPK A;  1G2S A;  3D3R A;  1JC7 A;  2KQ3 A;  3NSW A;  1U4P A;  3DXJ C;  1RD9 D;  2EYM A;  4HMI A;  1BBX C;  3PUW A;  1KNA A;  3LNN A;  1UUP A;  4A3F B;  4CJ0 B;  2JA8 B;  3PIO 3;  5BN3 A;  2F0F A;  1SFO B;  1JQY D;  5EJW A;  5M9O A;  5D3D A;  5K36 H;  2IPK D;  3QOL A;  4X3U A;  4MIU A;  3J81 L;  2C5C A;  2JEA I;  2A68 D;  2B2W C;  1EQV A;  2LS0 1;  4FF2 A;  3NTK A;  3A54 A;  1IYV A;  1W6K A;  2AQ2 B;  1JCK B;  5CC4 A;  1SNQ A;  1HQM C;  4N9P A;  4OIK A;  5IGG A;  1HRJ A;  1I4H A;  3R93 A;  1YNJ D;  3I3C A;  2NTS A;  2JA7 B;  1EU4 A;  1T5X D;  2XN9 C;  1JWM D;  3S16 B;  5F2D A;  2OT2 A;  2NB0 A;  2F0G A;  4TSS A;  3KLS A;  4DAV A;  2B8G A;  2A6E D;  4IUQ A;  1SEB D;  1XYI A;  1VMC A;  3H0G B;  4IUT A;  2IJ0 A;  5CV7 A;  3NHH A;  3IAY A;  4IN3 A;  1STN A;  3H94 A;  5EKL A;  3M7N A;  4CGY B;  3S1M B;  2XRQ D;  5IGF A;  2MPM A;  4R8N A;  1PZK D;  1U4R A;  4JBW A;  4QCL A;  5KGU A;  1C4Q A;  1SNO A;  4KY6 A;  3DHQ A;  1GUO A;  1FD7 D;  4B08 A;  1Z7T A;  4A3D B;  2NBF A;  5C0X H;  4HN7 A;  2LMC B;  1ZYR C;  5EBC A;  4QF4 A;  2YYZ A;  2QCP X;  5FO8 B;  1CQF A;  3VR6 A;  2F0E A;  1S4Z A;  3I8Z A;  3DWQ A;  3TDQ A;  2K01 A;  2Y0S B;  3Q6S A;  2EY6 A;  1GHK A;  4RGN A;  4L8J A;  3FDT A;  4C1N K;  1I3Q B;  2HQE A;  3MC0 B;  4CJ1 B;  4C3H B;  1EIG A;  4ZAI A;  4BY7 B;  3PMF A;  2K1B A;  2Z4H A;  1PRT C;  3KUP A;  3RD4 A;  3SR1 A;  2A6H C;  1F9P A;  2IX3 A;  3VYT A;  1LTA D;  3T16 A;  3PO3 B;  4RH6 A;  2H4O A;  2RSO A;  3WDN A;  3V2T A;  4C3I G;  5C4X B;  2WII B;  2B2T C;  2FIN B;  1BQQ T;  3DEP A;  1SE4 A;  3FRP B;  2BA0 A;  3M7G A;  4XQJ A;  3M4Y A;  1MSH A;  1EYA A;  1GJX A;  3C2P A;  1E2Z A;  2AWO A;  4A3K B;  1G8Z D;  3S1Q B;  1QNU A;  4Q0F A;  1GUN A;  4B9W A;  3MXG A;  1H9M A;  2QIL A;  1SJE D;  3S9W A;  3KBG A;  4FF3 A;  1IHZ A;  1PYW D;  4V19 0;  1GUG A;  4C1N I;  1EEI D;  2VNU D;  2NVT B;  2F3W A;  2JA5 B;  3S14 B;  2WKD A;  5C4H A;  2WKC A;  2DN8 A;  5C44 B;  1SXT A;  2XVS A;  1ZKO A;  2O4X A;  2GA4 B;  2F0I A;  3ERO A;  3K57 A;  4FXD A;  4WJW A;  5M5W B;  5BN5 A;  2EJF C;  2JSO A;  5FLX L;  2JE6 I;  2DY7 A;  4FXG C;  1HA5 A;  2PYK A;  1RHP A;  1G6Z A;  1V8Q A;  2B2U C;  4BBS B;  2J0T D;  1U4M A;  3GTJ B;  4H7B A;  5JEA H;  3NBI A;  1CA6 A;  3HEJ A;  1WTX A;  3BS1 A;  4V0B A;  5KEE A;  2R93 B;  3NTH A;  4OO1 H;  2EYP A;  1OO9 B;  1B9N A;  3BVM A;  3OSO A;  1TS5 A;  4TQU S;  5I6Y A;  2E2H B;  1PDQ A;  1HCZ A;  4M1U B;  4KN7 C;  2BCO A;  4LJZ C;  4U67 3;  4OHJ A;  4A3M B;  3D6W A;  2WIN B;  1GXD C;  4FYD A;  1CT1 D;  1V1P B;  3MFG A;  4F8M A;  1QNK A;  2BE5 D;  2SEB D;  4EVO A;  1JR0 D;  1VF5 C;  1EWH A;  5M5Y B;  5FO7 B;  5E3F A;  2YU9 B;  4NP5 A;  4F88 A;  3C0N A;  1STG A;  1HTL D;  1A2T A;  5CV9 A;  2NVQ B;  2F1M A;  1F2L A;  4XQQ A;  1JWS D;  2K33 A;  4RFB A;  1KTK A;  2K03 A;  2EPB A;  1EQT A;  1TY2 A;  4RHS A;  1STB A;  4BA2 I;  4RWS C;  2NVY B;  3VYU A;  1C48 A;  2F0K A;  3GP7 A;  2PQE A;  1K8O A;  5EKI A;  1XWE A;  5IGD A;  1SYG A;  2A5H A;  2N88 A;  1EY8 A;  4Z9C B;  2LFN A;  3K5O A;  4A3E B;  5I4D A;  2F0V A;  1EZ8 A;  4H44 C;  3BDC A;  4BWG B;  1MSG A;  5LHY 1;  1SSO A;  4J6H A;  5G3L F;  2K5Q A;  1ESF A;  3A8I E;  4K2K A;  3T13 A;  3LWE A;  1SBB B;  1DZ1 A;  2D2C C;  3TBI B;  1CZW A;  3EQL C;  2KVM A;  3QJY A;  1RDP D;  4O42 A;  1IYU A;  3PUY A;  4BBR B;  1VF7 A;  4KMU C;  2G9D A;  2EYL A;  3NE5 B;  3K0Y A;  5IT9 E;  2Z4I A;  4FNF A;  3RMH A;  3TN2 A;  4HCS A;  1AEX A;  2KCC A;  1GOZ A;  4KHV A;  2XIW A;  3DM1 A;  3VR4 A;  2MJ8 A;  1V1O A;  5KRU A;  3K5N A;  2QF7 A;  4WOR A;  4OIJ A;  4RAU C;  3ONA B;  5EKK A;  2B2V C;  2PW5 A;  5ISR A;  1WVL A;  3TZU A;  2HDL A;  3TP8 A;  1VCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...