1PTOB

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoB01
1ESFA 1RCVD 3BYYB 1B1ZA 4RHRA 1ENFA 1FNVA 3TSSA 1RDPD 1Z52A 3W2DA 1CT1D 2IJ0A 1LTID 1PZID 1M4VA 1I4QA 1S5BD 2RDGA 4RGMA 4O1NA 1LTRD 1PTOH 1TY0A 1UNSA 1EFID 1I4PA 1LO5D 1LT3D 1RD9D 1V1OA 1XTCD 4RFBA 3URYA 3DWAA 1PYWD 1LTTD 1FNUA 1BXTA 1S5DD 4RGNA 1ET9A 3O13A 1EU4A 1EWCA 1LT6D 1AN8A 5FKAC 1BCPD 1TS5A 4DXGA 1L0YB 3G4NA 1JCKB 1TS3A 1HTLD 1LT4D 3C0OA 1I4HA 1G8ZD 1I4XA 4BWGB 1SBBB 4L63B 1JWUD 1RF2D 2G9HD 3C0NA 1EEID 1JQYD 5I4DA 1LTBD 1QILA 1D5ZC 3BZDB 2RDHA 3EFXD 1SE2A 1F77A 1JR0D 3EA6A 1PRTD 5TSSA 1SJED 1CHQD 1PTOD 4L6TB 1TY2A 4RGTA 4RHSA 1SEBD 4C56C 5ELDA 1LT5D 2XN9C 1V1PB 4DXFA 2NTSA 1D6EC 1HQRD 4TSSA 1D5XC 1UUPA 2WV6D 1PRTB 1S5ED 2NTTA 2QILA 1KLGD 1PTOB 3SEBA 1ET6A 3BYTB 4K6LA 5ELBA 2AQ2B 3GP7A 1SE4A 3R8BA 1D5MC 1HA5A 1DYQA 4OHJA 2SEBD 1DJRD 4RCOA 2XNAC 1PZKD 1S5CD 2AQ1B 1L0XB 4Z9CB 1T5XD 1LTSD 1SJHD 5D3IB 5ELEA 2AQ3B 3DWQA 1BCPB 2TSSA 3BVZA 5ELCA 1XXGA 1AW7A 1I4GA 2CHBD 1PRTF 1LTGD 3MC0B 1PTOF 1EEFD 1TS2A 1JWSD 3OWEB 1B44D 1HXYD 4ZYSA 4RGOS 1BCPC 1KTKA 1PZJD 1LLRD 1I4RA 1SE3A 3G4OA 1EU3A 1V1PA 3KLSX 4UDUC 5ELFA 1BCPF 3C0MA 1CHPD 1FD7D 2XRQD 4RH6A 1KLUD 1PRTC 1MD2D 1FNWA 2ICIA 1PTOC 3R2IA 2O2LD 3CHBD 3BVMA 3R2TA 2J4XA 1S5FD 1GOZA 2IPKD 3DWPA 2Z8LA 1STEA 1CK1A 3BVGA 1FGBD 1CQVA 2XRSD 3MFGA 1JWMD 5D3DA 2QEJC 2R61A 5FK9C 1PREA 3V05A 1TS4A 1LTAD 1SXTA
chains in the Genus database with same CATH superfamily
1IL8A 3D6WA 1L1OC 4IUPA 1CZGA 2I5HA 1Z47A 2MO1A 1UE6A 1JE5A 5EKLA 2RA4A 5IYDH 4RA8A 1WD1A 4IZ8A 2NVTH 4PZ7A 2LXJA 2KHSA 3T56B 3URYA 3A8KE 1MSHA 5IGCA 4U68A 4ABNA 5CV4A 5FLMH 3FEWX 3TBIB 3J80i 4X6AH 3AB9A 2QKIC 4EVOA 5M5XH 1YNJD 1NY4A 3MXUA 4B3RL 2IHEA 2ZT9C 3OYYA 4A3BB 1S40A 3KFUA 2QEXA 1X9NA 4LFAQ 4B3MQ 3C0NA 1VQIA 2J0TD 3DXJC 4EGVA 5IP9G 2R7ZB 5HGQA 5I4DA 1EWHA 1KDCA 1IW7D 1UEBA 1YHBA 1NBWA 5IYCG 1SE2A 2O5IC 3S1MH 2FMMA 5DEHA 1HR0L 4X65L 3JC66 3M3YB 2XN9C 1G6PA 5M5WB 4DR4L 3PMFA 3CPFA 4L5TA 2EY5A 5M3MB 1Q90A 5IT9L 3S2HB 5I9OA 4JV5Q 2VQFQ 3CXCA 4BY1B 1L0WA 2XWJB 1F9QA 2RSOA 1TWHB 3G7LA 5CR3A 3EN2A 3VR5A 1PZKD 4IFDJ 1QNUA 1Q3LA 5DM63 1VMCA 2YU9H 5IWAQ 4ZKCB 2JA8G 5CYUA 1WTRA 2JJQA 3GTGB 2EY1A 3ND9A 2Z6KA 3RZDH 1YIJA 1LYLA 5J1ZA 4GOPC 1WVLA 4OX9L 1KAAA 1BCPC 1WTWA 5CBAE 4C3IB 1STBA 2XGTA 5KGUA 4X3SA 2NUCA 2F0NA 1VQCA 5ELFA 4IOCA 5I2XA 4LNQA 2XVSA 4R8NA 3PIPA 3HOXB 2HUGA 4MTNA 2A69C 1FNWA 3L0OA 2ZTEA 4DR3Q 4X64L 2PCFB 4DR5L 1WCMH 4HEDA 4UP9A 1YHQA 4A3FG 4K5VA 2A8VA 5M3FB 3PO2G 1SE8A 1HR0W 2XWBB 1LUZA 1WOCA 1NSNS 1SRUA 4R4QA 4LUZA 5FK9C 2D0OA 1GD7A 1QVFA 4R4IA 2RCFA 2K14A 3Q0AA 2E8GA 3S24A 5I2YA 3TS2A 3NHHA 1M4VA 3RD4A 5M5YB 4R4CA 1LM0A 3A0JA 1FVIA 3PUVA 4JBWA 2R93B 1PTOH 4LF4L 1V1OA 2QF7A 5NUCA 3NBIA 5C44H 3HOWG 3SGIA 2K5QA 3EBEA 2C9OA 1EWCA 4X66Q 1BCPD 2JA5G 4X3UA 2B2YC 1SYGA 1G8ZD 1R4PB 5E7NA 1TKWB 1ICWA 2Z6BA 2RHQB 2P5ZX 1CQFA 4EX5A 1VQHA 2Y0SG 4QB4A 3EFXD 1LACA 5CBEE 2DN8A 4L8JA 2A69D 1Y1WG 2VY3A 1QZGA 2CH4A 4WORA 1EY5A 4GN5A 4DNRB 2F0GA 3H0GB 1TWCB 1IBMQ 3UE0A 4DK0A 2WV6D 2F4VL 4IUTA 2QILA 1TWGB 1HZCA 2F0WA 4A3EB 2H1EA 1FJGL 3L2PA 3SHLA 3RLOA 4IPDA 4B3SL 4M1UB 3H09A 1X3FA 3FRPB 4MNOA 2AQ3B 4LF7Q 4DUZL 1PDQA 1Y1VG 3H91A 1A0IA 5IOCA 3J80L 1RJTA 4A3MB 2JA7B 2HHHQ 3KBGA 3LGJA 3IRBA 3PUWA 4MN3A 3HOYH 3UDFA 1JWSD 3VYUA 4KY5A 2QDLA 3HOVG 1N36L 4A75A 1LLRD 5GAEC 3PGZA 2V4DA 2HDMA 1JOOA 5FLXc 3J7ZC 4KHPL 1JJGA 1QOHA 3PO3H 1B3AA 3PUXA 3GTJB 1WTHA 1WD0A 3M85A 1I3QH 3DHQA 3SK5A 3D3RA 1QZHA 1TWAH 4K5XA 3K0XA 1KDBA 2JN4A 4A93B 3GTMH 1JORA 4J6HA 3V05A 2EJMA 4XQJA 1DCZA 1TS4A 3VA7A 5M9OA 4RHRA 3OTOL 4H0LC 1XX8A 2UU9L 1OXTA 4PV1C 2L11A 2EPBA 1I50B 1I5FA 2LMCB 3MWYW 2IWHA 3KJOA 1W3SA 1HA6A 1HH2P 1PYWD 1S5DD 2CCZA 1YEZA 4AQYQ 3ULLA 5BR8L 2ZM6Q 4DUYQ 2JA8B 1SNCA 2VB3X 1TS3A 2FHTA 4GKJL 1ZEQX 3SK6A 1K8OA 2L55A 4XYOA 3W5OA 2A74C 2RDHA 2E2IB 4KKTA 3T4AC 3J80c 1SJED 1J5EQ 1Q7YC 4UAIA 3F2UA 4DXFA 1F2ZA 4IFDG 2PYKA 3C1EA 1H9SB 2D5DA 2ZJPA 1HHVA 4KKSA 1SSOA 1SDFA 4OHJA 2SEBD 4RCOA 3IKJA 2AWNA 1BR9A 4A3FB 2Z0SA 4K6DA 3PO2B 1X6OA 3RZOB 4Y52H 1R9TB 2GA4B 3OPOA 3R93A 2N88A 3L9AX 4PMBA 1OO9B 1I4GA 2VW9A 2R92G 1HFGA 2OT2A 1SFOH 3I3CA 2ZXOA 3S9WA 4JI0Q 2UXDL 4NW2A 4ME3A 2BA0A 4NKLA 1EY7A 1XMQL 4LMQD 4G7ZC 2B29A 1X54A 2F0VA 2LY7A 3A56A 2B2TA 3HOWB 5LMUL 3RMHA 2H4OA 3CHBD 1BBWA 1DONA 1AE3A 4JI4L 2JA5B 4BBSG 5JEAG 5C3EG 1PV4A 4NPSA 5LHY1 4A3BH 4H7BA 2L9HA 2R7ZH 2Y0SB 1DOMA 4JVZA 4K0KL 2JEAI 3A74A 3PIP3 2PW5A 1GM5A 1Y1WB 1EIYB 3D8GA 3TN2A 2MPMA 1ENFA 3TSSA 3M3YH 1Q86C 5M5WH 2IJ0A 3S2HH 1G6ZA 2L0CA 2OTLA 1PH7A 2UUAL 1A2UA 2JA6G 4FVMA 2IT1A 3ND8A 3OW2A 2LSSA 1TWHH 1I6HB 5T1GA 1VS0A 1VQMA 1DOLA 2EDGA 1AN8A 2L1BA 3T1HL 5KYLA 1Y1VB 3KF6B 2ENBA 4DV3L 3CMAA 1HTLD 1HTPA 1PH2A 4JCVE 3GTGH 2GN5A 1EEID 4JYAQ 3DUZA 1EY6A 4YIJA 3HOVB 2UXBQ 3BZDB 1ICFB 3RN5A 1B2TA 3A7AB 3BDLA 4HJ8A 3ER0A 2K03A 4CGYB 4C3IH 1AP0A 3Q8DA 2VQFL 3HRZC 1V1QA 4OXPA 2A1AA 4QY7A 5EKIA 4HCEA 1E22A 1MSGA 1F9SA 2HDLA 3HOXH 1SFOB 1QUQA 4RWSC 2A68C 2AQ2B 5IE8A 1BO0A 5IWAL 1DJRD 3MA2B 2XNAC 5CV5A 1XNQL 1N32Q 1G291 1E3PA 1NTGA 4L5QA 4XT3B 2HIVA 1T5XD 1TXYA 3NQIA 4FF3A 4A3CG 2BE5C 1AH9A 1PRTF 2LS01 2DGYA 3TZUA 4CJ1B 4YWMA 4LF5L 4JOIA 1LV9A 4K14A 4POFA 3G4OA 2PZWA 4NXMQ 5M5YH 4GKKL 2R93H 1FYCA 2CQAA 4RH6A 4DR3L 3QJYA 2KECA 3S1QB 3HOZG 3TEHB 1ZXTA 1QUQB 2FINB 1H9KA 4DR2Q 2EY2A 3D0FA 5EKKA 1RTOA 3QG1A 3NENA 1QB5D 1KRSA 4A3DG 5C0XJ 2E5LQ 4J8QA 5IYBH 2A68D 1BVSA 5AJ3Q 3H3VI 3ZYYX 2RVLA 4JBJA 1RDPD 1EYGA 1YBYA 2WFWA 3H0GH 4C3HG 1TWCH 3PIOA 1I94L 2R7DA 1EIHA 2X6GA 2ALYB 2RDGA 2BE5D 4QQBX 4DR1L 3CCEA 3J7AV 1TWGH 2B8FA 2Z1CA 2K5VA 3SK4A 4A3EH 1F2YA 1CSQA 3ERSX 4X66L 2B63G 1E1TA 3OMCA 5GAHC 1EU4A 3G6EA 1PH9A 1LT6D 1HQMC 4ODGA 2IL8A 3PSIA 1JCKB 4KTAA 3TZDA 2KA7A 3EIVA 1L1OA 4A3MH 2JA7H 4C2MB 1AZQA 2R92B 2DJGC 4HAEA 1GUOA 2ZXPA 1JR0D 2VQEQ 1W6KA 4R4TA 1HNXQ 1Z6HA 2NVQH 2N49A 1IBML 4KD4A 3P75A 2BDOA 1GUWA 1EQQA 5EPLA 1VDZA 3ONAB 1SNQA 1GVPA 1YITA 1KRTA 3J81L 3GTJH 1T9HA 1UE1A 1ZYRC 2KCCA 4PZ8A 2SOBA 3ZJYC 3E6ZX 3QOLA 4BY7G 4DPGA 4BBSB 3S2DB 1GKHA 2IX3A 5C3EB 1AEXA 1E2WA 1Q1EA 1E7ZA 1EY4A 2HHHL 5J39A 3VYSA 5LMNQ 5IP9H 4KLKA 3KLSA 4NP5A 5IYCH 3KF8A 1EEFD 3GTKH 4A3LG 1B44D 1KABA 2CVRA 3RUZA 4QGUA 4G7OC 4H13C 4TRDA 5JJZA 2KEDA 3I2ZA 1EZ6A 2EXZA 1V1PA 4BXXG 1I50H 3KJPA 3MXNA 3E9IA 1BCPF 2JA6B 2R6GA 1FD7D 4KY6A 1ZKOA 4Y7NB 1LTLA 1PRTC 4NXNL 4DV2Q 4CJ2C 2D0PA 2O2LD 1PVOA 1VQFA 4CKEA 1S5FD 1TWFB 2JA8H 4GOPA 1VQEA 2IW3A 3BU2A 4N8X1 3NWTA 4KY7A 1IBLQ 3I4OA 2E2IH 1ESFA 4WFN3 3BYYB 1ZYRD 3Q22A 4DGZA 1RL2A 3ULJA 5JPMC 2NN6G 3KK7A 3OWFA 5A2QL 1S3OA 1PZID 1C4QA 4I65A 1SYCA 1UNSA 2LFNA 3AQQA 5IP7G 3DWAA 3CU7A 3H15A 4V0BA 1LTTD 1FNUA 1BXTA 4DUYL 2K04A 4KK7A 1N8RC 1KDAA 1C7YA 4HR7B 4A3FH 1H9JA 3UDIA 3PO2H 5FKAC 3KLWA 1R9TH 4RCNA 1EYDA 1U9RA 5EGTA 5IGFA 1SAPA 3T1YL 2G9HD 4OGQC 4GOPB 4YCVA 4DAVA 4GN4B 3LWUA 1J5EL 4WJ3M 1D5ZC 1PFSA 3KDFA 1PRTD 1KQSA 4OO1I 1CHQD 3BZKA 4ZKBB 2F0UA 2B2WA 2O4XA 3P1HA 4JI1L 1R4QB 4P2CB 1PFNA 3EROA 4N9PA 4Q5VA 3I90A 1VQ5A 3U4ZA 3M7NA 3BG3A 3HOZB 3HOWH 5HGTA 1HNWL 2AHOB 4O0AA 3GD7A 2B2YA 1NMGA 1TR5A 4A93G 1P16A 2KCMA 1EOVA 2NVYB 4EQOA 2K5NA 3GTPH 2JA5H 1IL2A 4IUUA 3LWEA 5ELEA 3RN2A 1A3VA 1EYCA 1V8QA 2M00A 2ZXRA 3I70A 2N8NA 2PO4A 4LK1C 1KL9A 4A3DB 2QW7A 1BDOA 3OWEB 2L12A 4HJAA 4XT1B 1PZJD 2XSCA 3MXPA 1X65A 4C3HB 3GTQB 3D4WA 2ICEC 1XNRL 5KYIA 3JAME 2LKVA 5C0XI 3MZ5A 4HJ5A 3TMEA 1UE7A 2J7ZA 2C35B 2B63B 5C4XG 2OQKA 3VA5A 4MZ9A 3P20A 5KEEA 1PH3A 1YNNC 1BBUA 3NTKA 1E2VA 1D1KA 3WOFA 1Y1VH 2EE1A 5D3DA 4LFCQ 1VQJA 1EQTA 1X55A 2HCCA 3T51B 3HOVH 3BJUA 2EZVA 3OOCA 2PQEA 1GHKA 5I9PA 3EVQA 1JB3A 2H5XA 3W2DA 5BN5A 5C3XA 1XPRA 3CRKC 5CV8A 1YHAA 3I4NG 1TY0A 4KD3A 4QF4A 1PFBA 3CCVA 1LT3D 1RD9D 1NCVA 5CV9A 4BY7B 1F2MA 3CCMA 4CBVA 1GHJA 3O13A 1N33Q 2F3WA 3RLFA 2X6LA 4ULLA 4A3IG 2K5DA 2UUBQ 2M9VA 4JYAL 1LT4D 3IFDA 3K7AH 3PIO3 5FLXL 4QIWE 2Z9HA 1B50A 3DM1A 4RKLA 3K6OA 5ELOA 4RGTA 3L7ZC 4WRDA 4C56C 1BQQT 4QUFA 2B2WC 3HG9A 4AH6A 2ES2A 3MXGA 1WTOA 1JE4A 4TQUS 4JI8L 1YNND 3H3VC 2OXPA 4YHHL 1BUVT 3M7GA 2NTTA 2R7FA 3S1QH 5ELBA 1HNZQ 5IYDG 3G4SA 3S16B 4OONA 4JPBW 1CKOA 2K5WA 4DR6L 2B2VC 2WKCA 1PH6A 4IUQA 2EYOA 1K9MC 3S15H 4JI6Q 3CRLC 1HJPA 4NB3A 4Q0FA 4A3GG 1CM9A 2CWAA 2I46A 5EJWA 1K83B 4LF8Q 2VS1A 1TVXA 3S1RH 4RGOS 4NXML 1II3A 4APVA 3U9SA 3VR2A 2Q2TA 1V43A 3I56A 1VQ9A 2JYOA 2AWOA 3P7JA 4R9WA 1XMOQ 4DR2L 1FR3A 1OXXK 2VNUD 3HEJA 5AFWA 3I4MG 4HJ9A 1FGBD 1U4LA 1CQVA 2NB0A 4K8IA 3EJIA 1SR3A 2OTJA 4BBRH 5CGKA 4C2MH 2R92H 5AJ3L 1KC8C 4ALPA 4FXGC 5G3LF 4CKCA 3PF4A 1IXRA 1E1OA 1EY0A 4ZUJA 2Q2HA 1T5EA 1CA5A 3K5LA 3K59A 4DV7Q 4LUVA 4RMFA 4A4IA 4JI7Q 5F2DA 4B3TL 3GV3A 3TP6A 3NQTA 2F0JA 5IT9E 1KAWA 4POGA 1ENCA 1ET9A 5JEAH 5C3EH 3NK9A 4NDXA 4P75A 1K73C 1YI2A 2EYMA 3PUYA 4ZAIA 3HS0C 3A5UA 4C3JH 2BOSA 1X3PA 1HNXL 4A3JG 3M4YA 4IJHA 1G2SA 1MHWC 1O7ZA 4OIJA 5TSSA 1EQRA 1YZ6A 3CCLA 1TY2A 5IGDA 1B7YB 3KLRA 2KCTA 2XIWA 3AU7A 1UUPA 2JA6H 3I91A 4HN7A 1FL0A 4FO2A 5C4XB 3BYTB 4MTKA 4DV6Q 3CQZB 4KV6A 2KHIA 4FF2A 2AQ1B 4Z9CB 1TWFH 5LMNL 4PZ6A 3W1GA 5C44G 1V9PA 5ELNA 4JI5L 3GDEA 1C8CA 4KJNA 3A55A 5C4JB 1K8AC 3C3LA 1KTKA 4LF9L 4B08A 2OQ0A 3E9HA 3I4NB 1F9RA 3C0MA 1QJOA 3QOJA 3MVVA 5A35A 3NPPA 3BDOA 1GJXA 5IGBA 1PYSB 1N9WA 3TQYA 4I7AA 2QDBA 4IOAA 3I73A 1YJWA 1GOZA 2IPKD 3DWPA 4DV4L 3CMEA 3KOJA 4A3IB 4A3CH 1IBLL 4WJ4A 1GUNA 1HZBA 2IX0A 3FKIG 2F0QA 1VCIA 3NEMA 1SXTA 4L5SA 2JEBI 4QMGA 2KVMA 2B2UC 2NZHA 4B3RQ 4KHVA 3DEOA 1WTXA 1S5BD 1VQOA 3RR5A 4JI2Q 5KNCA 3CCJA 4F7XA 4NMZA 5LMNW 1Q81C 1VQNA 1PH4A 3I72A 3HOZH 1IYUA 4OIKA 1HR0Q 4X65Q 4X3KA 2NVTB 2JSOA 2WIIB 2NVYH 4FXKC 4DR4Q 3K5OA 1QVGA 1EY8A 3U50C 1EIGA 1UWVA 4BWGB 4A3GB 2F1MA 4KJOA 5BN3A 2I5LX 4A3DH 3WWVA 1O7YA 1VF5C 2PZUA 2Z4HA 3D31A 3J80E 2SDFA 3HKSA 1Q8KA 4I7ZC 1VQ4A 5M3MH 4CDFC 4YCWA 4C3HH 3JAMi 4BY1H 3GTQH 1K3BC 3CCRA 3S1MB 1ML0D 3R3OA 2UXCQ 4OX9Q 4YCUA 4FP5D 3SEBA 2WAQE 2B63H 1PHJA 4B3ML 4LFAL 2D62A 5IODA 3SE0A 1Q1BA 1DM0B 1WTPA 3I4MB 1L0XB 2F0SA 1XPOA 2NWGA 1SJHD 2AMCB 3GQBA 3SDZA 1PA6A 2QA4A 2YU9B 3NBHA 3QO2A 2F0HA 3NSWA 4X64Q 1PTOF 4JV5L 1U0LA 3BDCA 2D9UA 1HXYD 3CAMA 2PQAA 1EQVA 5CV7A 3NELA 5G3LD 5T1IA 2RF4A 1EU3A 5IY0A 5I6YA 4QL5A 4DNIA 2BDNA 5BN4A 1S4ZA 1VF7A 4DF7A 4R1JA 1HPCA 1F2LA 5KNDA 1P8LA 4BY7H 1CKNA 5M3FH 3UE1A 3BVMA 3R2TA 4K2LA 5FO7B 3AFQA 4BA2I 5D14A 1SYFA 3M4OB 4UHVA 2Z8LA 3CKIB 5CC4A 4P73A 1KD1C 5GQOA 2QGQA 4LF4Q 4LF6Q 2R61A 4A3JB 4QJFA 2G5DA 2A6HC 1X32A 4A3LH 3F8TA 2K6AA 1SNMA 3OW7A 1GUGA 2K28A 1B1ZA 1Z9FA 3VR6A 1RODA 2CKZB 2JP1A 3HGBA 2VUMG 1K0SA 1KXLA 2BH2A 3FHWA 1H9RA 4BXXH 1LTID 2PQAB 1VQAA 2DY8A 2B39A 3MFYA 3QR8A 1LTRD 3TP8A 3I4LA 1HZ9A 2AKWB 4HJ7A 2XTIA 3TP5A 3S16H 5DLQE 4HIOA 3ICEA 4B9XA 5L37A 4YY3Q 2MHVA 3RNUA 4DAYA 1CKNB 1K28A 2F0DA 3A5ZB 5C44B 3GTLB 1L0YB 1HRJA 2HQLA 5DM73 1I4XA 4IN3A 3AMUA 5K36G 1VMPA 2IY5B 4QIWB 1JQYD 1JB7A 3PV0A 2I5MX 4LWCA 3U9OA 1K83H 3J81j 1JMCA 1F77A 2NN6H 1A6XA 4RHSA 1KNAA 1B9MA 2IX1A 3V96A 1X3GA 3C46A 5COYA 3CPWA 1PRTB 4DNTB 1KLGD 1N36Q 5JJIA 4V190 1VQ6A 4AYBE 1LABA 2A6HD 4HSVA 4UY8C 4CJ0B 4CDDC 2MP1A 2B3GA 1SMXA 1ASZA 4IALA 3DWQA 4DAYB 2K1BA 4PG3A 3FKIB 1AW7A 4K5WA 4LF8L 1IKLA 2VXWA 1TS2A 1XPUA 1JOQA 1BOSA 5EPKA 3B6YA 4UDUC 3MEHA 4LF7L 2BA1A 3SR1A 1PH5A 5CV6A 1VQPA 1PTOC 1JJ2A 3R2IA 2UU9Q 4A93H 2WAQG 3F2DA 4DU9A 2HIXA 4OELB 2E2JB 5EQ0A 3A8IE 1MBYA 3BVGA 2PMZE 2VB2X 1L1OB 2K5HA 2QEJC 1NUCA 1X3QA 2FJ2A 5HY6A 3S14B 4H44C 5BR8Q 4IUVA 5D65A 3GTOB 1W2BA 1ILPA 5EBDA 4YWLA 5C5LA 1JJCB 2K4KA 2L4NA 3T13A 1NR4A 3OIPA 5LL6S 1B8AA 4O1NA 4ZUIA 1SLJA 2F0KA 5C4XH 1XTCD 1QCBD 1WTVA 3CQZH 1OTCA 3U58A 2YTVA 1TIID 2TMPA 2SNSA 3J7A5 2HT1A 4PNYA 4DV5Q 1I4HA 1SBBB 1G51A 1MGSA 5FO9B 2JA9A 1E2ZA 1GO3E 3KF8B 2UUCQ 3C2PA 1VQ7A 2DNCA 5C4JH 2L15A 2EOTA 1EYAA 1PTOD 4UP8A 1D7QA 1SNDA 4CDCC 1U4MA 1V1PB 1X3EA 3CP0A 2NTSA 3DM3A 3MXNB 2ZM6L 4AQYL 1D5XC 4EQNA 4DV6L 3I4NH 3VYTA 1ET6A 1DXMA 2UXDQ 4WJWA 2NBFA 3RZOH 5FJ8G 1S5CD 3JAMc 5JPNC 4A3IH 4L5RC 1UEAB 2MO0A 4XDXA 1EUJA 1IYJB 3ITPA 1BCPB 3BVZA 3HFZB 5C6AA 2X69A 2WP8J 2CW0C 2ZTDA 3VDYA 1O78A 2K75A 1XWEA 2VUMB 4LAAA 4LFBQ 1S72A 3TP7A 4JBMA 4GNXC 1I4RA 2KEEA 3STBC 1SE3A 1PLFA 2MFIA 1I6VC 4OO1G 4K0KQ 4JI3Q 3CW2C 1G91A 1EOTA 1STAA 1CHPD 3G71A 2XRQD 2B2VA 3FDTA 4XQNA 2IHFA 3BS1A 1HUMA 4DV1Q 3SK8A 4AYBG 3UDGA 1SYDA 4JI0L 1H95A 2UUAQ 2NVXB 5IGGA 1MKHA 2HCIA 2GVBA 1Y1WH 4A3GH 2CFMA 4RKBA 3HOUG 4HIMA 3KBXA 4A3KG 3KDFB 4OL7A 1BKBA 4X3TA 2NZ1D 2ID0A 4R4OA 3T1HQ 4DV3Q 3G48A 4IQZA 4TKOB 5I6WA 2EYPA 4JI2L 1CT1D 2WB1B 1I6HH 2F0MA 3CF5A 1NAPA 4RFBA 3K57A 4KMUC 2A6EC 2CW0D 3J81E 5C0XG 4RGNA 2PZTA 2EY6A 1WI5A 3I4MH 2F52A 3TREA 1QWYA 3H6MA 3AEVA 3M4PA 1QE6A 2AUKA 3STBD 2PI2E 3NE5B 4FF4A 3C0OA 4L63B 1RF2D 2PW7A 4G7HC 4FF1A 1EY9A 1SROA 5EAYA 1OXUA 3NTIA 1B70B 1XNQQ 4N8FA 2F0FA 4IPCA 3BZCA 4PMWA 2Q2UA 4HTHA 1SEBD 2F3IA 2E75C 2UXCL 2D2CC 1CKMA 5C4ZA 1A62A 3G6JB 4DR7Q 3NXWA 1S5ED 3HKZE 5C4HA 4LF5Q 2M2LA 2QCPX 2WAQB 4K6LA 3W1BA 2UXBL 2PNRC 3M4OH 4DV0Q 4GKKQ 4EQ5A 2PPBC 1Q82C 3GV6A 4XIGS 4A3JH 3S1NB 2CHBD 4X62Q 5DAUA 1Q46A 3ULPA 3A54A 3TDQA 1L2FA 4DFAA 4ZYSA 2A6ED 2I0QA 4KKUA 5LL6X 5JOBA 3TS0A 1FGUA 2ZTCA 5JEAJ 1N32L 1M8AA 5A2QE 3KLSX 1PXUA 1M1KC 4H02A 3MTSA 4C1NK 1JC7A 2RCNA 4R8IA 3NTHA 1ASYA 4FYDA 2ICIA 4IUNA 1I94Q 1Y69U 5FLMG 4XXEA 4LF6L 3GTLH 5IT9c 4DR1Q 1YVCA 4KN7C 5JJLA 4OWTB 1LTAD 1WTQA 1TQOA 5FOBB 2E74C 5GROA 2F0EA 4IFDH 3A8JE 3DMUA 3HZXA 3K58A 3M9BA 2RKSA 5DNFA 5GADC 5FO8B 1A15A 1EFWA 4XYQA 4CDEC 3AYHB 2FXQA 2AUJD 5JJKA 1A8VA 4P74A 3VYRA 4YY3L 3OIQA 5C3WA 4HCSA 3CC7A 2N3SA 4GLXA 3EQLC 1DGSA 2E5LL 2I07B 2EYFA 1KHIA 1GUTA 2HD3A 2A19A 3OHXC 1N34Q 1BF4A 3FKIH 4LUOA 1JWUD 4O42A 2B2UA 2F03A 3KYHC 1QILA 4YWKA 5CORA 1IKMA 2EXDA 2C5CA 1Q12A 4L6TB 2Z6KC 4XQQA 5ELDA 3J7YW 1IBKQ 4DK6C 2HQEA 1HQRD 2JK8A 1KIXA 1MI2A 2NVQB 1UE5A 3PQIA 3X3MA 1STNA 4KI0A 4BBSH 3S2DH 3OMGA 3MAQA 1SE4A 1VQBA 2F4IA 1M90C 4AYBB 1WJJA 2OEOA 4HIKA 2VQEL 2E2JH 1LTSD 2EJFC 4M8AA 1WCMG 3D6CA 4F8MA 5ELCA 4NXNQ 3HOUB 3S17B 3SVMA 4A3KB 4G4KA 3S14H 2WACA 3T53B 5K5PA 1G2TA 2NYZD 1AFPA 3GTOH 4Y7NH 3GTKB 4JG2A 1DOKA 1ESRA 3F2CA 2KJXA 4FNFA 1CI3M 3M4QA 1HUNA 2E76C 1H9SA 3HKZG 4E6IA 2BCOA 3FPPA 4C1NI 2VL6A 2YYZA 2BH8A 1STEA 3C1FA 1ENAA 3PCOB 2OCEA 4A76A 2PMZB 3MEFA 1JWMD 1MJCA 3I7FA 3DLLA 4JW0A 1ILQA 1HCZA 5FLXE 2F0LA 2EYJA 2KHJA 2Q8IB 1O7IA 4DA2A 1BBXC 3IFTA 4ID6A 4IFDI 4BA1I 4DV2L 3GO5A 3T1YQ 4OWWB 1STYA 3MHBA 4J15A 2DNEA 1STHA 5GAGC 3U4VA 1U5KA 4LW1A 5ISRA 4ZK9B 1EFID 2DJFC 3E0JA 1A3TA 2EYHA 4CHTB 3SXHA 1SYBA 4JI1Q 5CMDA 1UAPA 4AIMA 4DV5L 1JT8A 1E24A 4U673 1CA6A 4DXGA 2UUCL 2SNMA 3K7UC 1HNWQ 2E2HB 1HFNA 3ERQA 1X56A 2F3VA 3F2BA 2VUMH 3HOYG 1A3UA 3WOEA 2DY7A 2WB1E 1O7LA 3X3NA 4BBRG 2VZAA 1LT5D 5IIFA 5KIXA 2OF1A 1D6EC 3FVQA 3VR4A 1YNXA 1OXSC 3PO3G 3R8BA 2YV5A 5EBCA 3HP3A 2RSNA 1XNRQ 2N55A 4CKBA 4J1MA 5M5XB 2GVAA 1D8LA 2K7VA 3VR3A 2K32A 5D3IB 4PMCA 2ZJRA 3CCSA 2NVXH 5KRUA 3IAYA 3GTPB 3KF6A 5K36H 1XXGA 3TRZA 5E4XA 2DUDA 3K5NA 4LFBL 1TU2B 1O80A 2KENA 1LTGD 2JE6I 1ONLA 4OWXB 4G57A 1XYIA 2A5HA 5E1FA 1EL0A 3IL8A 4DAPA 4C3JG 1PH8A 1WFQA 2KQ3A 4JI3L 3H3VH 3CC4A 1D1IA 2E2DC 1TT2A 4LJZC 1C48A 3J81i 1D2BA 1A63A 1KLUD 4DV1L 3N6RA 1GUSA 1MD2D 2J4XA 2CH4W 1CSPA 2K50A 2PI2A 1Y14B 3NWSA 3LX0A 1HZAA 4DR5Q 1PH1A 1PREA 4DAMA 2MUYA 3RZDB 1VQDA 1DZ1A 2MQHA 3V2TA 1A2TA 4GZYC 4N9TA 2WINB 1NE3A 1U4PA 2YTYA 4QUCA 1RIPA 4IJLA 1DD2A 5E4WC 3D4RA 4GLAC 5HURA 1YJ9A 1AE2A 1LO5D 3K80C 3K0YA 3F1ZA 2KBNA 4LFCL 4GS3A 1JICA 1J6QA 3DEPA 1K8MA 4KN4C 4F87A 4JI8Q 4KHZA 2LXKA 3E5SA 3QB3A 1WCMB 1QG7A 4YHHQ 1MJEA 1TS5A 4GLVB 1B4OA 3G4NA 1EIFA 4ME5A 3K5MA 4HIDA 1C9OA 3NBHB 2F0IA 3S1NH 4DK3C 3UI2A 4DR6Q 1Q8IA 2EJGC 3K7AB 4B9WA 4EQPA 2KCNA 4DR7L 4ILWA 1B3QA 4RAUC 5JAVA 4IPHA 4ZLTF 2OWOA 1N33L 1XJVA 4HMIA 2UUBL 3Q24A 1K8GA 1PTOB 1J9OA 1RKNA 3HKZB 3GP7A 4DV0L 2F4VQ 1D5MC 1EZ8A 2K33A 3NP8A 2R3ZA 1DYQA 3QIAA 4P72A 1FJGQ 2B2TC 4ZQ3A 3I8ZA 1PYBA 4K8JA 4X62L 2TSSA 1PMRA 2KUMA 1SN8A 4B3SQ 4A3BG 2Q8TA 3PF5A 2MJ8A 4DUZQ 2R7ZG 1QVCA 2MNAA 2CWPA 3S15B 2EYLA 1NNXA 5C5MA 3RLNA 2F0OA 1HNZL 2WB1G 3WDNA 3CD6A 5H1SE 2A73B 3CCUA 4DKAC 5IP7H 3S1RB 1PFMA 2KOLA 5M3MG 2PNHA 2RHSB 1IHZA 4JI6L 2MGSA 4BY1G 2ATWA 5FJ8H 4KHPQ 1RHPA 2EVBA 2EQSA 1VQLA 4B3TQ 1CK1A 2XRSD 3MFGA 4DN4M 2YTXA 1AZPA 4GNXA 4DK1A 2CQOA 1J8IA 2F0PA 3HOYB 4UPAA 3L3OC 2K01A 4IO9A 1VQKA 1OXVA 2ASBA 1RCVD 4MIUA 4BBRB 4K2KA 1SNOA 3UDXA 4BS9A 1JOKA 1F9PA 1FNVA 1MIUA 1GXDC 3JAML 1Z52A 4C3IG 4OO1H 1XMOL 3OTOQ 1I4QA 4FXDA 1VQGA 1SNPA 4PQXA 1IYVA 4JK1C 2F0TA 4RGMA 3PO3B 2O5JC 1I4PA 3QWNA 1CZWA 1EWIA 1I3QB 1CFMA 3LNNA 3HOXG 1TWAB 1KNEA 1RTNA 1N34L 2RDFA 2N78A 3FPUB 3GTMB 1Y8OB 5IGEA 5M3FG 3E0EA 1Z7TA 1K0RA 4DV7L 3HOUH 3S17H 4A3KH 3CC2A 2NZOA 4JI7L 1NJIC 1H9MA 1SMYC 1LTBD 1U4RA 4GKJQ 3E3XA 3K8AA 3EA6A 4C3JB 4GNXB 2FMCA 4F88A 1IBKL 1C0AA 4IPGA 2WKDA 5J22A 4O2DA 4ZCKA 2RBMA 1Y8NB 2FFKB 1B53A 1YJNA 4JI5Q 4P71A 4ZRZA 3W3AA 1CTMA 1STGA 4TSSA 5E3FA 1IZ6A 4JOIC 3FMCA 1CUKA 2JXMB 3H94A 3PUZA 3Q23A 1VQ8A 2R93G 2K05A 4LF9Q 4IURA 5C0XH 3FP9A 5JVG3 5J3BA 2ZJQA 1HA5A 3AFPA 4UP7A 3T16A 3I55A 3N52A 4OEMB 2K52A 4JBKA 1W6JA 2Z4IA 2RQXA 3J7AF 2NN6I 3MC0B 4GN3B 4DV4Q 4HMJA 3A7LA 1YNJC 2B8GA 1XTDA 5IYBG 4FDBA 3D4DA 2Q2IA 4S3SA 1E0BA 1NR2A 3KUPA 2V1CC 3H0GG 2JQOA 3NUCA 1IW7C 2G9DA 1XMQQ 1K3RA 4JC0A 1NMFA 1QNKA 4A3EG 2EIFA 3K81C 1SMYD 4QCLA 4XTCS 5LMUQ 2Q8RE 1BNZA 1WYDA 3OSOA 4HSPA 3Q6SA 4JI4Q 3J81c 1SYEA 2L5TA 2Y0SE 2E2HH 4MHEA 4RG1A 1Y8PB 5JVH3 4A3MG 2JA7G 3CCQA 4TVAB 5EPJA 1B9NA 5KNBA
chains in the Genus database with same CATH topology
1IL8A 3D6WA 4IUPA 1CZGA 1Z47A 5EKLA 2RA4A 4RA8A 1WD1A 4IZ8A 2KHSA 3T56B 3URYA 3A8KE 1MSHA 5IGCA 4U68A 4ABNA 5CV4A 3FEWX 3TBIB 3AB9A 2QKIC 4EVOA 1YNJD 3MXUA 2ZT9C 4A3BB 3C0NA 3DXJC 2J0TD 4EGVA 2R7ZB 5I4DA 1EWHA 1KDCA 1IW7D 1SE2A 2O5IC 2FMMA 5DEHA 3M3YB 2XN9C 5M5WB 3PMFA 2EY5A 5M3MB 1Q90A 5IT9L 3S2HB 5I9OA 4BY1B 2XWJB 1F9QA 2RSOA 1TWHB 3G7LA 5CR3A 3VR5A 1PZKD 4IFDJ 1QNUA 1Q3LA 5DM63 1VMCA 4ZKCB 5CYUA 1WTRA 3GTGB 2EY1A 3ND9A 5J1ZA 1WVLA 1KAAA 1BCPC 1WTWA 5CBAE 4C3IB 1STBA 5KGUA 4X3SA 2NUCA 2F0NA 5ELFA 5I2XA 2XVSA 4R8NA 3HOXB 2HUGA 2A69C 1FNWA 2PCFB 4HEDA 4K5VA 5M3FB 2XWBB 1NSNS 5FK9C 3Q0AA 5I2YA 3NHHA 1M4VA 3RD4A 5M5YB 3PUVA 2R93B 4JBWA 1PTOH 1V1OA 2QF7A 5NUCA 3NBIA 2K5QA 2C9OA 1EWCA 1BCPD 4X3UA 2B2YC 1SYGA 1G8ZD 1R4PB 1TKWB 1ICWA 1CQFA 4QB4A 3EFXD 1LACA 5CBEE 2DN8A 4L8JA 2A69D 4WORA 1EY5A 4DNRB 2F0GA 3H0GB 1TWCB 4DK0A 2WV6D 4IUTA 2QILA 1TWGB 2F0WA 4A3EB 2H1EA 3SHLA 4M1UB 3H09A 3FRPB 2AQ3B 1PDQA 3H91A 5IOCA 3J80L 1RJTA 4A3MB 2JA7B 3KBGA 4MN3A 3PUWA 1JWSD 3VYUA 4KY5A 1LLRD 2V4DA 2HDMA 1JOOA 1QOHA 1B3AA 3PUXA 3GTJB 1WD0A 3M85A 3DHQA 3SK5A 3D3RA 4K5XA 1KDBA 4A93B 1JORA 4J6HA 3V05A 2EJMA 4XQJA 1DCZA 1TS4A 3VA7A 5M9OA 4RHRA 4H0LC 1XX8A 1OXTA 4PV1C 2L11A 2EPBA 1I50B 2LMCB 3MWYW 2IWHA 1HA6A 1PYWD 1S5DD 2JA8B 1SNCA 2VB3X 1TS3A 2FHTA 1ZEQX 3SK6A 1K8OA 2L55A 4XYOA 2A74C 2RDHA 2E2IB 4KKTA 3T4AC 1SJED 4UAIA 3F2UA 4DXFA 1F2ZA 4IFDG 2PYKA 3C1EA 1H9SB 2D5DA 1HHVA 4KKSA 1SSOA 1SDFA 4OHJA 2SEBD 4RCOA 3IKJA 2AWNA 1BR9A 4A3FB 4K6DA 3PO2B 3RZOB 1R9TB 2GA4B 3OPOA 3R93A 2N88A 3L9AX 4PMBA 1OO9B 1I4GA 1HFGA 2OT2A 3I3CA 2ZXOA 3S9WA 4NW2A 2BA0A 4NKLA 1EY7A 4LMQD 4G7ZC 2F0VA 2LY7A 3A56A 2B2TA 3HOWB 3RMHA 2H4OA 3CHBD 1DONA 2JA5B 5JEAG 5LHY1 4H7BA 2L9HA 2Y0SB 1DOMA 2JEAI 3PIP3 2PW5A 1Y1WB 3D8GA 3TN2A 2MPMA 1ENFA 3TSSA 2IJ0A 1G6ZA 2L0CA 1A2UA 4FVMA 2IT1A 3ND8A 1I6HB 5T1GA 1DOLA 2EDGA 1AN8A 2L1BA 5KYLA 1Y1VB 2ENBA 1HTLD 1HTPA 1EEID 3DUZA 1EY6A 4YIJA 3HOVB 3BZDB 1B2TA 3A7AB 3BDLA 2K03A 4CGYB 1AP0A 3HRZC 5EKIA 4HCEA 1MSGA 1F9SA 2HDLA 1SFOB 4RWSC 2A68C 2AQ2B 1BO0A 1DJRD 3MA2B 2XNAC 5CV5A 1G291 4XT3B 1T5XD 3NQIA 4FF3A 2BE5C 1PRTF 2LS01 3TZUA 4CJ1B 1LV9A 4K14A 3G4OA 2PZWA 1FYCA 2CQAA 4RH6A 3QJYA 2KECA 3S1QB 1ZXTA 2FINB 1H9KA 2EY2A 5EKKA 1RTOA 3QG1A 1QB5D 5C0XJ 4J8QA 2A68D 3ZYYX 2RVLA 1RDPD 4C3HG 1EIHA 2X6GA 2RDGA 2BE5D 3J7AV 2B8FA 2Z1CA 3SK4A 1F2YA 3OMCA 1EU4A 1LT6D 1HQMC 4ODGA 2IL8A 1JCKB 4KTAA 3TZDA 2KA7A 4C2MB 1AZQA 2R92B 4HAEA 1GUOA 2ZXPA 1JR0D 1W6KA 1Z6HA 4KD4A 3P75A 2BDOA 1GUWA 5EPLA 1VDZA 3ONAB 1SNQA 3J81L 1ZYRC 2KCCA 2SOBA 3E6ZX 3QOLA 4BBSB 3S2DB 2IX3A 5C3EB 1AEXA 1E2WA 1Q1EA 1EY4A 5J39A 3VYSA 3KLSA 4NP5A 3KF8A 1EEFD 1B44D 1KABA 2CVRA 3RUZA 4G7OC 4H13C 4TRDA 5JJZA 2KEDA 1EZ6A 2EXZA 1V1PA 3MXNA 1BCPF 2JA6B 2R6GA 1FD7D 4KY6A 1ZKOA 4Y7NB 1PRTC 4CJ2C 2O2LD 4CKEA 1S5FD 1TWFB 2IW3A 3NWTA 4KY7A 1ESFA 4WFN3 3BYYB 1ZYRD 3Q22A 4DGZA 5JPMC 2NN6G 3KK7A 3OWFA 5A2QL 1PZID 1C4QA 4I65A 1SYCA 1UNSA 2LFNA 3DWAA 3CU7A 4V0BA 1LTTD 1FNUA 1BXTA 2K04A 4KK7A 1KDAA 4HR7B 1H9JA 5FKAC 4RCNA 1EYDA 1U9RA 5EGTA 5IGFA 1SAPA 2G9HD 4OGQC 4DAVA 3LWUA 1D5ZC 1PRTD 4OO1I 1CHQD 4ZKBB 2F0UA 2B2WA 2O4XA 3P1HA 1R4QB 4P2CB 1PFNA 3EROA 4N9PA 4Q5VA 3I90A 3M7NA 3BG3A 3HOZB 5HGTA 3GD7A 2B2YA 1TR5A 2NVYB 4EQOA 4IUUA 3LWEA 5ELEA 1A3VA 1EYCA 1V8QA 2M00A 4LK1C 2PO4A 2ZXRA 3I70A 4A3DB 1BDOA 3OWEB 2L12A 4XT1B 1PZJD 2XSCA 3MXPA 4C3HB 3GTQB 3D4WA 2ICEC 5KYIA 3JAME 2LKVA 5C0XI 3MZ5A 3TMEA 2J7ZA 2B63B 3VA5A 3P20A 5KEEA 1YNNC 3NTKA 1E2VA 1D1KA 3WOFA 2EE1A 5D3DA 1EQTA 2HCCA 3T51B 2EZVA 3OOCA 2PQEA 1GHKA 5I9PA 3EVQA 1JB3A 3W2DA 5BN5A 5C3XA 3CRKC 5CV8A 1TY0A 4KD3A 4QF4A 1PFBA 1LT3D 1RD9D 1NCVA 5CV9A 4BY7B 1F2MA 4CBVA 1GHJA 3O13A 2F3WA 3RLFA 2X6LA 4ULLA 2K5DA 2M9VA 1LT4D 3IFDA 3PIO3 5FLXL 1B50A 3DM1A 4RKLA 3K6OA 4RGTA 3L7ZC 4WRDA 4C56C 1BQQT 4QUFA 2B2WC 3HG9A 3MXGA 1WTOA 1JE4A 4TQUS 1YNND 3H3VC 2OXPA 1BUVT 3M7GA 2NTTA 5ELBA 3S16B 2K5WA 2B2VC 2WKCA 4IUQA 2EYOA 3CRLC 4Q0FA 1CM9A 2I46A 5EJWA 1K83B 1TVXA 4RGOS 1II3A 3U9SA 3VR2A 1V43A 2JYOA 2AWOA 3P7JA 4R9WA 1FR3A 1OXXK 2VNUD 3HEJA 5AFWA 1FGBD 1U4LA 1CQVA 2NB0A 4K8IA 3EJIA 5CGKA 4FXGC 5G3LF 4CKCA 1EY0A 4ZUJA 1T5EA 1CA5A 3K5LA 3K59A 5F2DA 3GV3A 3TP6A 3NQTA 2F0JA 5IT9E 1ENCA 1ET9A 5JEAH 3NK9A 4NDXA 2EYMA 3PUYA 4ZAIA 3HS0C 2BOSA 1X3PA 3M4YA 1G2SA 1O7ZA 4OIJA 5TSSA 1TY2A 5IGDA 3KLRA 2XIWA 3AU7A 1UUPA 3I91A 4HN7A 5C4XB 4FO2A 3BYTB 3CQZB 4KV6A 4FF2A 2AQ1B 4Z9CB 1C8CA 4KJNA 3A55A 5C4JB 3C3LA 1KTKA 4B08A 3I4NB 1F9RA 3C0MA 1QJOA 3QOJA 3MVVA 5A35A 3NPPA 3BDOA 1GJXA 5IGBA 2QDBA 3I73A 1GOZA 2IPKD 3DWPA 4A3IB 1GUNA 2IX0A 2F0QA 1VCIA 1SXTA 2JEBI 4QMGA 2KVMA 2B2UC 4KHVA 3DEOA 1WTXA 1S5BD 5KNCA 4F7XA 4NMZA 3I72A 1IYUA 4OIKA 4X3KA 2NVTB 2JSOA 2WIIB 4FXKC 3K5OA 1EY8A 1EIGA 4BWGB 4A3GB 2F1MA 4KJOA 5BN3A 1O7YA 1VF5C 2PZUA 2Z4HA 3D31A 3J80E 2SDFA 4I7ZC 3S1MB 1ML0D 3R3OA 4FP5D 3SEBA 2D62A 5IODA 3SE0A 1Q1BA 1DM0B 1WTPA 3I4MB 1L0XB 2F0SA 2NWGA 1SJHD 3GQBA 3SDZA 2YU9B 3NBHA 3QO2A 2F0HA 3NSWA 1PTOF 3BDCA 2D9UA 1HXYD 1EQVA 5CV7A 5G3LD 5T1IA 1EU3A 5I6YA 2BDNA 5BN4A 1S4ZA 1VF7A 4DF7A 1HPCA 1F2LA 5KNDA 3BVMA 3R2TA 4K2LA 5FO7B 4BA2I 5D14A 1SYFA 3M4OB 2Z8LA 3CKIB 5CC4A 2R61A 4A3JB 2A6HC 1X32A 2K6AA 1SNMA 3OW7A 1GUGA 2K28A 1B1ZA 3VR6A 1RODA 3HGBA 2JP1A 1H9RA 1LTID 2DY8A 2B39A 3MFYA 1LTRD 3TP8A 3I4LA 3TP5A 4B9XA 2MHVA 4DAYA 2F0DA 5C44B 3GTLB 1L0YB 1HRJA 5DM73 1I4XA 4IN3A 3AMUA 5K36G 1VMPA 4QIWB 1JQYD 3PV0A 3U9OA 1F77A 2NN6H 1A6XA 4RHSA 1KNAA 1B9MA 2IX1A 3V96A 3C46A 5COYA 1PRTB 4DNTB 1KLGD 4V190 1LABA 2A6HD 4HSVA 4CJ0B 2MP1A 4IALA 3DWQA 2K1BA 3FKIB 1AW7A 4K5WA 1IKLA 2VXWA 1TS2A 1JOQA 1BOSA 5EPKA 4UDUC 3MEHA 2BA1A 3SR1A 5CV6A 1PTOC 3R2IA 4DU9A 2E2JB 5EQ0A 3A8IE 1MBYA 3BVGA 2VB2X 2QEJC 1NUCA 1X3QA 2FJ2A 3S14B 4H44C 4IUVA 5D65A 3GTOB 1ILPA 5EBDA 5C5LA 2L4NA 3T13A 1NR4A 3OIPA 5LL6S 4O1NA 4ZUIA 2F0KA 1XTCD 1QCBD 1WTVA 1TIID 2TMPA 2SNSA 4PNYA 1I4HA 1SBBB 5FO9B 1MGSA 1E2ZA 3C2PA 2DNCA 2EOTA 1EYAA 1PTOD 1SNDA 1U4MA 1V1PB 2NTSA 1D5XC 4EQNA 3VYTA 1ET6A 1DXMA 4WJWA 2NBFA 1S5CD 5JPNC 1UEAB 4XDXA 3ITPA 1BCPB 3BVZA 5C6AA 2X69A 2WP8J 2CW0C 1O78A 1XWEA 2VUMB 4LAAA 3TP7A 1I4RA 2KEEA 1SE3A 1PLFA 1I6VC 4OO1G 1G91A 1EOTA 1STAA 1CHPD 2XRQD 2B2VA 3FDTA 4XQNA 3BS1A 1HUMA 3SK8A 1SYDA 2NVXB 5IGGA 2HCIA 4RKBA 3KBXA 4OL7A 4X3TA 2NZ1D 2ID0A 4IQZA 4TKOB 5I6WA 2EYPA 1CT1D 2WB1B 2F0MA 1NAPA 4RFBA 3K57A 4KMUC 2A6EC 2CW0D 3J81E 5C0XG 4RGNA 2PZTA 2EY6A 1QWYA 3H6MA 1QE6A 2AUKA 4FF4A 3NE5B 3C0OA 4L63B 1RF2D 2PW7A 4G7HC 4FF1A 1EY9A 1OXUA 3NTIA 2F0FA 4PMWA 4HTHA 1SEBD 2E75C 2D2CC 5C4ZA 3G6JB 3NXWA 1S5ED 5C4HA 2M2LA 2QCPX 2WAQB 4K6LA 2PNRC 2PPBC 3GV6A 4XIGS 3S1NB 2CHBD 5DAUA 3A54A 3TDQA 4ZYSA 4DFAA 2A6ED 4KKUA 5LL6X 5JOBA 5JEAJ 1M8AA 5A2QE 3KLSX 1PXUA 3MTSA 4C1NK 1JC7A 4R8IA 3NTHA 4FYDA 2ICIA 4IUNA 1Y69U 4XXEA 4KN7C 1LTAD 1WTQA 1TQOA 5FOBB 2E74C 2F0EA 4IFDH 3A8JE 3DMUA 3HZXA 3K58A 2RKSA 5DNFA 5FO8B 1A15A 4XYQA 2AUJD 3VYRA 3OIQA 5C3WA 4HCSA 3EQLC 2I07B 2EYFA 1GUTA 3OHXC 1BF4A 1JWUD 4O42A 2B2UA 2F03A 1QILA 5CORA 1IKMA 2C5CA 1Q12A 4L6TB 4XQQA 5ELDA 3J7YW 2HQEA 1HQRD 1MI2A 2NVQB 3X3MA 1STNA 4KI0A 3OMGA 3MAQA 1SE4A 2F4IA 4AYBB 2OEOA 1LTSD 2EJFC 4M8AA 3D6CA 4F8MA 5ELCA 3HOUB 3S17B 3SVMA 4A3KB 4G4KA 2WACA 3T53B 5K5PA 1G2TA 2NYZD 1AFPA 3GTKB 1DOKA 1ESRA 2KJXA 4FNFA 1CI3M 1HUNA 2E76C 1H9SA 4E6IA 2BCOA 3FPPA 4C1NI 2YYZA 3C1FA 1STEA 1ENAA 2PMZB 1JWMD 1ILQA 1HCZA 5FLXE 2F0LA 2EYJA 2Q8IB 4DA2A 1BBXC 3IFTA 4ID6A 4IFDI 4BA1I 3GO5A 1STYA 3MHBA 2DNEA 1STHA 5ISRA 4ZK9B 1EFID 3E0JA 1A3TA 2EYHA 4CHTB 3SXHA 1SYBA 5CMDA 1UAPA 4U673 1CA6A 4DXGA 2SNMA 2E2HB 1HFNA 3ERQA 2F3VA 1A3UA 3WOEA 2DY7A 1O7LA 3X3NA 1LT5D 5IIFA 5KIXA 2OF1A 1D6EC 3FVQA 3VR4A 1OXSC 3R8BA 5EBCA 3HP3A 2RSNA 2N55A 4CKBA 4J1MA 5M5XB 2K7VA 3VR3A 2K32A 5D3IB 4PMCA 3IAYA 5KRUA 3GTPB 5K36H 1XXGA 5E4XA 3K5NA 1TU2B 1O80A 1LTGD 2JE6I 1ONLA 4G57A 1XYIA 2A5HA 5E1FA 1EL0A 3IL8A 4DAPA 4C3JG 2KQ3A 1D1IA 2E2DC 1TT2A 4LJZC 1C48A 1D2BA 1KLUD 3N6RA 1GUSA 1MD2D 2J4XA 3NWSA 3LX0A 1PREA 2MUYA 3RZDB 1DZ1A 3V2TA 1A2TA 4GZYC 4N9TA 2WINB 1U4PA 4QUCA 1DD2A 5E4WC 3D4RA 5HURA 1LO5D 3K0YA 1JICA 3DEPA 4KN4C 1K8MA 4F87A 4KHZA 3E5SA 3QB3A 1WCMB 1QG7A 1TS5A 1B4OA 3G4NA 4ME5A 3K5MA 2F0IA 3UI2A 1Q8IA 2EJGC 3K7AB 4B9WA 4EQPA 2KCNA 4ILWA 4RAUC 5JAVA 4ZLTF 4HMIA 3Q24A 1PTOB 1J9OA 1RKNA 3HKZB 3GP7A 1D5MC 1EZ8A 2K33A 3NP8A 2R3ZA 1DYQA 3QIAA 2B2TC 4ZQ3A 3I8ZA 4K8JA 2TSSA 1PMRA 2KUMA 2Q8TA 2MJ8A 3S15B 2EYLA 5C5MA 2F0OA 3WDNA 2A73B 3S1RB 1PFMA 2KOLA 1IHZA 2MGSA 1RHPA 2EVBA 1CK1A 2XRSD 3MFGA 4DN4M 1AZPA 4DK1A 1J8IA 2F0PA 3HOYB 3L3OC 2K01A 1OXVA 1RCVD 4BBRB 4MIUA 4K2KA 1SNOA 4BS9A 1JOKA 1F9PA 1FNVA 1GXDC 3JAML 1Z52A 4C3IG 4OO1H 1I4QA 4FXDA 1SNPA 4PQXA 1IYVA 4JK1C 2F0TA 4RGMA 3PO3B 2O5JC 1I4PA 3QWNA 1CZWA 1I3QB 1CFMA 3LNNA 1TWAB 1KNEA 1RTNA 2RDFA 3FPUB 3GTMB 1Y8OB 5IGEA 1Z7TA 1H9MA 1SMYC 1LTBD 1U4RA 3EA6A 4C3JB 2FMCA 4F88A 5J22A 2WKDA 2RBMA 1Y8NB 2FFKB 1B53A 4ZRZA 3W3AA 1CTMA 1STGA 4TSSA 5E3FA 3FMCA 3PUZA 2JXMB 3H94A 3Q23A 2K05A 4IURA 5C0XH 5JVG3 1HA5A 3T16A 3N52A 1W6JA 2Z4IA 2RQXA 3J7AF 2NN6I 3MC0B 4HMJA 3A7LA 1YNJC 2B8GA 3D4DA 4S3SA 1E0BA 1NR2A 3KUPA 3NUCA 1IW7C 2G9DA 1QNKA 1SMYD 4QCLA 4XTCS 2Q8RE 1BNZA 3OSOA 4HSPA 3Q6SA 1SYEA 2L5TA 4MHEA 1Y8PB 5JVH3 5EPJA 1B9NA 5KNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESF A;  1RCV D;  3BYY B;  1B1Z A;  4RHR A;  1ENF A;  1FNV A;  3TSS A;  1RDP D;  1Z52 A;  3W2D A;  1CT1 D;  2IJ0 A;  1LTI D;  1PZI D;  1M4V A;  1I4Q A;  1S5B D;  2RDG A;  4RGM A;  4O1N A;  1LTR D;  1PTO H;  1TY0 A;  1UNS A;  1EFI D;  1I4P A;  1LO5 D;  1LT3 D;  1RD9 D;  1V1O A;  1XTC D;  4RFB A;  3URY A;  3DWA A;  1PYW D;  1LTT D;  1FNU A;  1BXT A;  1S5D D;  4RGN A;  1ET9 A;  3O13 A;  1EU4 A;  1EWC A;  1LT6 D;  1AN8 A;  5FKA C;  1BCP D;  1TS5 A;  4DXG A;  1L0Y B;  3G4N A;  1JCK B;  1TS3 A;  1HTL D;  1LT4 D;  3C0O A;  1I4H A;  1G8Z D;  1I4X A;  4BWG B;  1SBB B;  4L63 B;  1JWU D;  1RF2 D;  2G9H D;  3C0N A;  1EEI D;  1JQY D;  5I4D A;  1LTB D;  1QIL A;  1D5Z C;  3BZD B;  2RDH A;  3EFX D;  1SE2 A;  1F77 A;  1JR0 D;  3EA6 A;  1PRT D;  5TSS A;  1SJE D;  1CHQ D;  1PTO D;  4L6T B;  1TY2 A;  4RGT A;  4RHS A;  1SEB D;  4C56 C;  5ELD A;  1LT5 D;  2XN9 C;  1V1P B;  4DXF A;  2NTS A;  1D6E C;  1HQR D;  4TSS A;  1D5X C;  1UUP A;  2WV6 D;  1PRT B;  1S5E D;  2NTT A;  2QIL A;  1KLG D;  1PTO B;  3SEB A;  1ET6 A;  3BYT B;  4K6L A;  5ELB A;  2AQ2 B;  3GP7 A;  1SE4 A;  3R8B A;  1D5M C;  1HA5 A;  1DYQ A;  4OHJ A;  2SEB D;  1DJR D;  4RCO A;  2XNA C;  1PZK D;  1S5C D;  2AQ1 B;  1L0X B;  4Z9C B;  1T5X D;  1LTS D;  1SJH D;  5D3I B;  5ELE A;  2AQ3 B;  3DWQ A;  1BCP B;  2TSS A;  3BVZ A;  5ELC A;  1XXG A;  1AW7 A;  1I4G A;  2CHB D;  1PRT F;  1LTG D;  3MC0 B;  1PTO F;  1EEF D;  1TS2 A;  1JWS D;  3OWE B;  1B44 D;  1HXY D;  4ZYS A;  4RGO S;  1BCP C;  1KTK A;  1PZJ D;  1LLR D;  1I4R A;  1SE3 A;  3G4O A;  1EU3 A;  1V1P A;  3KLS X;  4UDU C;  5ELF A;  1BCP F;  3C0M A;  1CHP D;  1FD7 D;  2XRQ D;  4RH6 A;  1KLU D;  1PRT C;  1MD2 D;  1FNW A;  2ICI A;  1PTO C;  3R2I A;  2O2L D;  3CHB D;  3BVM A;  3R2T A;  2J4X A;  1S5F D;  1GOZ A;  2IPK D;  3DWP A;  2Z8L A;  1STE A;  1CK1 A;  3BVG A;  1FGB D;  1CQV A;  2XRS D;  3MFG A;  1JWM D;  5D3D A;  2QEJ C;  2R61 A;  5FK9 C;  1PRE A;  3V05 A;  1TS4 A;  1LTA D;  1SXT A; 
#chains in the Genus database with same CATH topology
 1IL8 A;  3D6W A;  1L1O C;  4IUP A;  1CZG A;  2I5H A;  1Z47 A;  2MO1 A;  1UE6 A;  1JE5 A;  5EKL A;  2RA4 A;  5IYD H;  4RA8 A;  1WD1 A;  4IZ8 A;  2NVT H;  4PZ7 A;  2LXJ A;  2KHS A;  3T56 B;  3URY A;  3A8K E;  1MSH A;  5IGC A;  4U68 A;  4ABN A;  5CV4 A;  5FLM H;  3FEW X;  3TBI B;  3J80 i;  4X6A H;  3AB9 A;  2QKI C;  4EVO A;  5M5X H;  1YNJ D;  1NY4 A;  3MXU A;  4B3R L;  2IHE A;  2ZT9 C;  3OYY A;  4A3B B;  1S40 A;  3KFU A;  2QEX A;  1X9N A;  4LFA Q;  4B3M Q;  3C0N A;  1VQI A;  2J0T D;  3DXJ C;  4EGV A;  5IP9 G;  2R7Z B;  5HGQ A;  5I4D A;  1EWH A;  1KDC A;  1IW7 D;  1UEB A;  1YHB A;  1NBW A;  5IYC G;  1SE2 A;  2O5I C;  3S1M H;  2FMM A;  5DEH A;  1HR0 L;  4X65 L;  3JC6 6;  3M3Y B;  2XN9 C;  1G6P A;  5M5W B;  4DR4 L;  3PMF A;  3CPF A;  4L5T A;  2EY5 A;  5M3M B;  1Q90 A;  5IT9 L;  3S2H B;  5I9O A;  4JV5 Q;  2VQF Q;  3CXC A;  4BY1 B;  1L0W A;  2XWJ B;  1F9Q A;  2RSO A;  1TWH B;  3G7L A;  5CR3 A;  3EN2 A;  3VR5 A;  1PZK D;  4IFD J;  1QNU A;  1Q3L A;  5DM6 3;  1VMC A;  2YU9 H;  5IWA Q;  4ZKC B;  2JA8 G;  5CYU A;  1WTR A;  2JJQ A;  3GTG B;  2EY1 A;  3ND9 A;  2Z6K A;  3RZD H;  1YIJ A;  1LYL A;  5J1Z A;  4GOP C;  1WVL A;  4OX9 L;  1KAA A;  1BCP C;  1WTW A;  5CBA E;  4C3I B;  1STB A;  2XGT A;  5KGU A;  4X3S A;  2NUC A;  2F0N A;  1VQC A;  5ELF A;  4IOC A;  5I2X A;  4LNQ A;  2XVS A;  4R8N A;  3PIP A;  3HOX B;  2HUG A;  4MTN A;  2A69 C;  1FNW A;  3L0O A;  2ZTE A;  4DR3 Q;  4X64 L;  2PCF B;  4DR5 L;  1WCM H;  4HED A;  4UP9 A;  1YHQ A;  4A3F G;  4K5V A;  2A8V A;  5M3F B;  3PO2 G;  1SE8 A;  1HR0 W;  2XWB B;  1LUZ A;  1WOC A;  1NSN S;  1SRU A;  4R4Q A;  4LUZ A;  5FK9 C;  2D0O A;  1GD7 A;  1QVF A;  4R4I A;  2RCF A;  2K14 A;  3Q0A A;  2E8G A;  3S24 A;  5I2Y A;  3TS2 A;  3NHH A;  1M4V A;  3RD4 A;  5M5Y B;  4R4C A;  1LM0 A;  3A0J A;  1FVI A;  3PUV A;  4JBW A;  2R93 B;  1PTO H;  4LF4 L;  1V1O A;  2QF7 A;  5NUC A;  3NBI A;  5C44 H;  3HOW G;  3SGI A;  2K5Q A;  3EBE A;  2C9O A;  1EWC A;  4X66 Q;  1BCP D;  2JA5 G;  4X3U A;  2B2Y C;  1SYG A;  1G8Z D;  1R4P B;  5E7N A;  1TKW B;  1ICW A;  2Z6B A;  2RHQ B;  2P5Z X;  1CQF A;  4EX5 A;  1VQH A;  2Y0S G;  4QB4 A;  3EFX D;  1LAC A;  5CBE E;  2DN8 A;  4L8J A;  2A69 D;  1Y1W G;  2VY3 A;  1QZG A;  2CH4 A;  4WOR A;  1EY5 A;  4GN5 A;  4DNR B;  2F0G A;  3H0G B;  1TWC B;  1IBM Q;  3UE0 A;  4DK0 A;  2WV6 D;  2F4V L;  4IUT A;  2QIL A;  1TWG B;  1HZC A;  2F0W A;  4A3E B;  2H1E A;  1FJG L;  3L2P A;  3SHL A;  3RLO A;  4IPD A;  4B3S L;  4M1U B;  3H09 A;  1X3F A;  3FRP B;  4MNO A;  2AQ3 B;  4LF7 Q;  4DUZ L;  1PDQ A;  1Y1V G;  3H91 A;  1A0I A;  5IOC A;  3J80 L;  1RJT A;  4A3M B;  2JA7 B;  2HHH Q;  3KBG A;  3LGJ A;  3IRB A;  3PUW A;  4MN3 A;  3HOY H;  3UDF A;  1JWS D;  3VYU A;  4KY5 A;  2QDL A;  3HOV G;  1N36 L;  4A75 A;  1LLR D;  5GAE C;  3PGZ A;  2V4D A;  2HDM A;  1JOO A;  5FLX c;  3J7Z C;  4KHP L;  1JJG A;  1QOH A;  3PO3 H;  1B3A A;  3PUX A;  3GTJ B;  1WTH A;  1WD0 A;  3M85 A;  1I3Q H;  3DHQ A;  3SK5 A;  3D3R A;  1QZH A;  1TWA H;  4K5X A;  3K0X A;  1KDB A;  2JN4 A;  4A93 B;  3GTM H;  1JOR A;  4J6H A;  3V05 A;  2EJM A;  4XQJ A;  1DCZ A;  1TS4 A;  3VA7 A;  5M9O A;  4RHR A;  3OTO L;  4H0L C;  1XX8 A;  2UU9 L;  1OXT A;  4PV1 C;  2L11 A;  2EPB A;  1I50 B;  1I5F A;  2LMC B;  3MWY W;  2IWH A;  3KJO A;  1W3S A;  1HA6 A;  1HH2 P;  1PYW D;  1S5D D;  2CCZ A;  1YEZ A;  4AQY Q;  3ULL A;  5BR8 L;  2ZM6 Q;  4DUY Q;  2JA8 B;  1SNC A;  2VB3 X;  1TS3 A;  2FHT A;  4GKJ L;  1ZEQ X;  3SK6 A;  1K8O A;  2L55 A;  4XYO A;  3W5O A;  2A74 C;  2RDH A;  2E2I B;  4KKT A;  3T4A C;  3J80 c;  1SJE D;  1J5E Q;  1Q7Y C;  4UAI A;  3F2U A;  4DXF A;  1F2Z A;  4IFD G;  2PYK A;  3C1E A;  1H9S B;  2D5D A;  2ZJP A;  1HHV A;  4KKS A;  1SSO A;  1SDF A;  4OHJ A;  2SEB D;  4RCO A;  3IKJ A;  2AWN A;  1BR9 A;  4A3F B;  2Z0S A;  4K6D A;  3PO2 B;  1X6O A;  3RZO B;  4Y52 H;  1R9T B;  2GA4 B;  3OPO A;  3R93 A;  2N88 A;  3L9A X;  4PMB A;  1OO9 B;  1I4G A;  2VW9 A;  2R92 G;  1HFG A;  2OT2 A;  1SFO H;  3I3C A;  2ZXO A;  3S9W A;  4JI0 Q;  2UXD L;  4NW2 A;  4ME3 A;  2BA0 A;  4NKL A;  1EY7 A;  1XMQ L;  4LMQ D;  4G7Z C;  2B29 A;  1X54 A;  2F0V A;  2LY7 A;  3A56 A;  2B2T A;  3HOW B;  5LMU L;  3RMH A;  2H4O A;  3CHB D;  1BBW A;  1DON A;  1AE3 A;  4JI4 L;  2JA5 B;  4BBS G;  5JEA G;  5C3E G;  1PV4 A;  4NPS A;  5LHY 1;  4A3B H;  4H7B A;  2L9H A;  2R7Z H;  2Y0S B;  1DOM A;  4JVZ A;  4K0K L;  2JEA I;  3A74 A;  3PIP 3;  2PW5 A;  1GM5 A;  1Y1W B;  1EIY B;  3D8G A;  3TN2 A;  2MPM A;  1ENF A;  3TSS A;  3M3Y H;  1Q86 C;  5M5W H;  2IJ0 A;  3S2H H;  1G6Z A;  2L0C A;  2OTL A;  1PH7 A;  2UUA L;  1A2U A;  2JA6 G;  4FVM A;  2IT1 A;  3ND8 A;  3OW2 A;  2LSS A;  1TWH H;  1I6H B;  5T1G A;  1VS0 A;  1VQM A;  1DOL A;  2EDG A;  1AN8 A;  2L1B A;  3T1H L;  5KYL A;  1Y1V B;  3KF6 B;  2ENB A;  4DV3 L;  3CMA A;  1HTL D;  1HTP A;  1PH2 A;  4JCV E;  3GTG H;  2GN5 A;  1EEI D;  4JYA Q;  3DUZ A;  1EY6 A;  4YIJ A;  3HOV B;  2UXB Q;  3BZD B;  1ICF B;  3RN5 A;  1B2T A;  3A7A B;  3BDL A;  4HJ8 A;  3ER0 A;  2K03 A;  4CGY B;  4C3I H;  1AP0 A;  3Q8D A;  2VQF L;  3HRZ C;  1V1Q A;  4OXP A;  2A1A A;  4QY7 A;  5EKI A;  4HCE A;  1E22 A;  1MSG A;  1F9S A;  2HDL A;  3HOX H;  1SFO B;  1QUQ A;  4RWS C;  2A68 C;  2AQ2 B;  5IE8 A;  1BO0 A;  5IWA L;  1DJR D;  3MA2 B;  2XNA C;  5CV5 A;  1XNQ L;  1N32 Q;  1G29 1;  1E3P A;  1NTG A;  4L5Q A;  4XT3 B;  2HIV A;  1T5X D;  1TXY A;  3NQI A;  4FF3 A;  4A3C G;  2BE5 C;  1AH9 A;  1PRT F;  2LS0 1;  2DGY A;  3TZU A;  4CJ1 B;  4YWM A;  4LF5 L;  4JOI A;  1LV9 A;  4K14 A;  4POF A;  3G4O A;  2PZW A;  4NXM Q;  5M5Y H;  4GKK L;  2R93 H;  1FYC A;  2CQA A;  4RH6 A;  4DR3 L;  3QJY A;  2KEC A;  3S1Q B;  3HOZ G;  3TEH B;  1ZXT A;  1QUQ B;  2FIN B;  1H9K A;  4DR2 Q;  2EY2 A;  3D0F A;  5EKK A;  1RTO A;  3QG1 A;  3NEN A;  1QB5 D;  1KRS A;  4A3D G;  5C0X J;  2E5L Q;  4J8Q A;  5IYB H;  2A68 D;  1BVS A;  5AJ3 Q;  3H3V I;  3ZYY X;  2RVL A;  4JBJ A;  1RDP D;  1EYG A;  1YBY A;  2WFW A;  3H0G H;  4C3H G;  1TWC H;  3PIO A;  1I94 L;  2R7D A;  1EIH A;  2X6G A;  2ALY B;  2RDG A;  2BE5 D;  4QQB X;  4DR1 L;  3CCE A;  3J7A V;  1TWG H;  2B8F A;  2Z1C A;  2K5V A;  3SK4 A;  4A3E H;  1F2Y A;  1CSQ A;  3ERS X;  4X66 L;  2B63 G;  1E1T A;  3OMC A;  5GAH C;  1EU4 A;  3G6E A;  1PH9 A;  1LT6 D;  1HQM C;  4ODG A;  2IL8 A;  3PSI A;  1JCK B;  4KTA A;  3TZD A;  2KA7 A;  3EIV A;  1L1O A;  4A3M H;  2JA7 H;  4C2M B;  1AZQ A;  2R92 B;  2DJG C;  4HAE A;  1GUO A;  2ZXP A;  1JR0 D;  2VQE Q;  1W6K A;  4R4T A;  1HNX Q;  1Z6H A;  2NVQ H;  2N49 A;  1IBM L;  4KD4 A;  3P75 A;  2BDO A;  1GUW A;  1EQQ A;  5EPL A;  1VDZ A;  3ONA B;  1SNQ A;  1GVP A;  1YIT A;  1KRT A;  3J81 L;  3GTJ H;  1T9H A;  1UE1 A;  1ZYR C;  2KCC A;  4PZ8 A;  2SOB A;  3ZJY C;  3E6Z X;  3QOL A;  4BY7 G;  4DPG A;  4BBS B;  3S2D B;  1GKH A;  2IX3 A;  5C3E B;  1AEX A;  1E2W A;  1Q1E A;  1E7Z A;  1EY4 A;  2HHH L;  5J39 A;  3VYS A;  5LMN Q;  5IP9 H;  4KLK A;  3KLS A;  4NP5 A;  5IYC H;  3KF8 A;  1EEF D;  3GTK H;  4A3L G;  1B44 D;  1KAB A;  2CVR A;  3RUZ A;  4QGU A;  4G7O C;  4H13 C;  4TRD A;  5JJZ A;  2KED A;  3I2Z A;  1EZ6 A;  2EXZ A;  1V1P A;  4BXX G;  1I50 H;  3KJP A;  3MXN A;  3E9I A;  1BCP F;  2JA6 B;  2R6G A;  1FD7 D;  4KY6 A;  1ZKO A;  4Y7N B;  1LTL A;  1PRT C;  4NXN L;  4DV2 Q;  4CJ2 C;  2D0P A;  2O2L D;  1PVO A;  1VQF A;  4CKE A;  1S5F D;  1TWF B;  2JA8 H;  4GOP A;  1VQE A;  2IW3 A;  3BU2 A;  4N8X 1;  3NWT A;  4KY7 A;  1IBL Q;  3I4O A;  2E2I H;  1ESF A;  4WFN 3;  3BYY B;  1ZYR D;  3Q22 A;  4DGZ A;  1RL2 A;  3ULJ A;  5JPM C;  2NN6 G;  3KK7 A;  3OWF A;  5A2Q L;  1S3O A;  1PZI D;  1C4Q A;  4I65 A;  1SYC A;  1UNS A;  2LFN A;  3AQQ A;  5IP7 G;  3DWA A;  3CU7 A;  3H15 A;  4V0B A;  1LTT D;  1FNU A;  1BXT A;  4DUY L;  2K04 A;  4KK7 A;  1N8R C;  1KDA A;  1C7Y A;  4HR7 B;  4A3F H;  1H9J A;  3UDI A;  3PO2 H;  5FKA C;  3KLW A;  1R9T H;  4RCN A;  1EYD A;  1U9R A;  5EGT A;  5IGF A;  1SAP A;  3T1Y L;  2G9H D;  4OGQ C;  4GOP B;  4YCV A;  4DAV A;  4GN4 B;  3LWU A;  1J5E L;  4WJ3 M;  1D5Z C;  1PFS A;  3KDF A;  1PRT D;  1KQS A;  4OO1 I;  1CHQ D;  3BZK A;  4ZKB B;  2F0U A;  2B2W A;  2O4X A;  3P1H A;  4JI1 L;  1R4Q B;  4P2C B;  1PFN A;  3ERO A;  4N9P A;  4Q5V A;  3I90 A;  1VQ5 A;  3U4Z A;  3M7N A;  3BG3 A;  3HOZ B;  3HOW H;  5HGT A;  1HNW L;  2AHO B;  4O0A A;  3GD7 A;  2B2Y A;  1NMG A;  1TR5 A;  4A93 G;  1P16 A;  2KCM A;  1EOV A;  2NVY B;  4EQO A;  2K5N A;  3GTP H;  2JA5 H;  1IL2 A;  4IUU A;  3LWE A;  5ELE A;  3RN2 A;  1A3V A;  1EYC A;  1V8Q A;  2M00 A;  2ZXR A;  3I70 A;  2N8N A;  2PO4 A;  4LK1 C;  1KL9 A;  4A3D B;  2QW7 A;  1BDO A;  3OWE B;  2L12 A;  4HJA A;  4XT1 B;  1PZJ D;  2XSC A;  3MXP A;  1X65 A;  4C3H B;  3GTQ B;  3D4W A;  2ICE C;  1XNR L;  5KYI A;  3JAM E;  2LKV A;  5C0X I;  3MZ5 A;  4HJ5 A;  3TME A;  1UE7 A;  2J7Z A;  2C35 B;  2B63 B;  5C4X G;  2OQK A;  3VA5 A;  4MZ9 A;  3P20 A;  5KEE A;  1PH3 A;  1YNN C;  1BBU A;  3NTK A;  1E2V A;  1D1K A;  3WOF A;  1Y1V H;  2EE1 A;  5D3D A;  4LFC Q;  1VQJ A;  1EQT A;  1X55 A;  2HCC A;  3T51 B;  3HOV H;  3BJU A;  2EZV A;  3OOC A;  2PQE A;  1GHK A;  5I9P A;  3EVQ A;  1JB3 A;  2H5X A;  3W2D A;  5BN5 A;  5C3X A;  1XPR A;  3CRK C;  5CV8 A;  1YHA A;  3I4N G;  1TY0 A;  4KD3 A;  4QF4 A;  1PFB A;  3CCV A;  1LT3 D;  1RD9 D;  1NCV A;  5CV9 A;  4BY7 B;  1F2M A;  3CCM A;  4CBV A;  1GHJ A;  3O13 A;  1N33 Q;  2F3W A;  3RLF A;  2X6L A;  4ULL A;  4A3I G;  2K5D A;  2UUB Q;  2M9V A;  4JYA L;  1LT4 D;  3IFD A;  3K7A H;  3PIO 3;  5FLX L;  4QIW E;  2Z9H A;  1B50 A;  3DM1 A;  4RKL A;  3K6O A;  5ELO A;  4RGT A;  3L7Z C;  4WRD A;  4C56 C;  1BQQ T;  4QUF A;  2B2W C;  3HG9 A;  4AH6 A;  2ES2 A;  3MXG A;  1WTO A;  1JE4 A;  4TQU S;  4JI8 L;  1YNN D;  3H3V C;  2OXP A;  4YHH L;  1BUV T;  3M7G A;  2NTT A;  2R7F A;  3S1Q H;  5ELB A;  1HNZ Q;  5IYD G;  3G4S A;  3S16 B;  4OON A;  4JPB W;  1CKO A;  2K5W A;  4DR6 L;  2B2V C;  2WKC A;  1PH6 A;  4IUQ A;  2EYO A;  1K9M C;  3S15 H;  4JI6 Q;  3CRL C;  1HJP A;  4NB3 A;  4Q0F A;  4A3G G;  1CM9 A;  2CWA A;  2I46 A;  5EJW A;  1K83 B;  4LF8 Q;  2VS1 A;  1TVX A;  3S1R H;  4RGO S;  4NXM L;  1II3 A;  4APV A;  3U9S A;  3VR2 A;  2Q2T A;  1V43 A;  3I56 A;  1VQ9 A;  2JYO A;  2AWO A;  3P7J A;  4R9W A;  1XMO Q;  4DR2 L;  1FR3 A;  1OXX K;  2VNU D;  3HEJ A;  5AFW A;  3I4M G;  4HJ9 A;  1FGB D;  1U4L A;  1CQV A;  2NB0 A;  4K8I A;  3EJI A;  1SR3 A;  2OTJ A;  4BBR H;  5CGK A;  4C2M H;  2R92 H;  5AJ3 L;  1KC8 C;  4ALP A;  4FXG C;  5G3L F;  4CKC A;  3PF4 A;  1IXR A;  1E1O A;  1EY0 A;  4ZUJ A;  2Q2H A;  1T5E A;  1CA5 A;  3K5L A;  3K59 A;  4DV7 Q;  4LUV A;  4RMF A;  4A4I A;  4JI7 Q;  5F2D A;  4B3T L;  3GV3 A;  3TP6 A;  3NQT A;  2F0J A;  5IT9 E;  1KAW A;  4POG A;  1ENC A;  1ET9 A;  5JEA H;  5C3E H;  3NK9 A;  4NDX A;  4P75 A;  1K73 C;  1YI2 A;  2EYM A;  3PUY A;  4ZAI A;  3HS0 C;  3A5U A;  4C3J H;  2BOS A;  1X3P A;  1HNX L;  4A3J G;  3M4Y A;  4IJH A;  1G2S A;  1MHW C;  1O7Z A;  4OIJ A;  5TSS A;  1EQR A;  1YZ6 A;  3CCL A;  1TY2 A;  5IGD A;  1B7Y B;  3KLR A;  2KCT A;  2XIW A;  3AU7 A;  1UUP A;  2JA6 H;  3I91 A;  4HN7 A;  1FL0 A;  4FO2 A;  5C4X B;  3BYT B;  4MTK A;  4DV6 Q;  3CQZ B;  4KV6 A;  2KHI A;  4FF2 A;  2AQ1 B;  4Z9C B;  1TWF H;  5LMN L;  4PZ6 A;  3W1G A;  5C44 G;  1V9P A;  5ELN A;  4JI5 L;  3GDE A;  1C8C A;  4KJN A;  3A55 A;  5C4J B;  1K8A C;  3C3L A;  1KTK A;  4LF9 L;  4B08 A;  2OQ0 A;  3E9H A;  3I4N B;  1F9R A;  3C0M A;  1QJO A;  3QOJ A;  3MVV A;  5A35 A;  3NPP A;  3BDO A;  1GJX A;  5IGB A;  1PYS B;  1N9W A;  3TQY A;  4I7A A;  2QDB A;  4IOA A;  3I73 A;  1YJW A;  1GOZ A;  2IPK D;  3DWP A;  4DV4 L;  3CME A;  3KOJ A;  4A3I B;  4A3C H;  1IBL L;  4WJ4 A;  1GUN A;  1HZB A;  2IX0 A;  3FKI G;  2F0Q A;  1VCI A;  3NEM A;  1SXT A;  4L5S A;  2JEB I;  4QMG A;  2KVM A;  2B2U C;  2NZH A;  4B3R Q;  4KHV A;  3DEO A;  1WTX A;  1S5B D;  1VQO A;  3RR5 A;  4JI2 Q;  5KNC A;  3CCJ A;  4F7X A;  4NMZ A;  5LMN W;  1Q81 C;  1VQN A;  1PH4 A;  3I72 A;  3HOZ H;  1IYU A;  4OIK A;  1HR0 Q;  4X65 Q;  4X3K A;  2NVT B;  2JSO A;  2WII B;  2NVY H;  4FXK C;  4DR4 Q;  3K5O A;  1QVG A;  1EY8 A;  3U50 C;  1EIG A;  1UWV A;  4BWG B;  4A3G B;  2F1M A;  4KJO A;  5BN3 A;  2I5L X;  4A3D H;  3WWV A;  1O7Y A;  1VF5 C;  2PZU A;  2Z4H A;  3D31 A;  3J80 E;  2SDF A;  3HKS A;  1Q8K A;  4I7Z C;  1VQ4 A;  5M3M H;  4CDF C;  4YCW A;  4C3H H;  3JAM i;  4BY1 H;  3GTQ H;  1K3B C;  3CCR A;  3S1M B;  1ML0 D;  3R3O A;  2UXC Q;  4OX9 Q;  4YCU A;  4FP5 D;  3SEB A;  2WAQ E;  2B63 H;  1PHJ A;  4B3M L;  4LFA L;  2D62 A;  5IOD A;  3SE0 A;  1Q1B A;  1DM0 B;  1WTP A;  3I4M B;  1L0X B;  2F0S A;  1XPO A;  2NWG A;  1SJH D;  2AMC B;  3GQB A;  3SDZ A;  1PA6 A;  2QA4 A;  2YU9 B;  3NBH A;  3QO2 A;  2F0H A;  3NSW A;  4X64 Q;  1PTO F;  4JV5 L;  1U0L A;  3BDC A;  2D9U A;  1HXY D;  3CAM A;  2PQA A;  1EQV A;  5CV7 A;  3NEL A;  5G3L D;  5T1I A;  2RF4 A;  1EU3 A;  5IY0 A;  5I6Y A;  4QL5 A;  4DNI A;  2BDN A;  5BN4 A;  1S4Z A;  1VF7 A;  4DF7 A;  4R1J A;  1HPC A;  1F2L A;  5KND A;  1P8L A;  4BY7 H;  1CKN A;  5M3F H;  3UE1 A;  3BVM A;  3R2T A;  4K2L A;  5FO7 B;  3AFQ A;  4BA2 I;  5D14 A;  1SYF A;  3M4O B;  4UHV A;  2Z8L A;  3CKI B;  5CC4 A;  4P73 A;  1KD1 C;  5GQO A;  2QGQ A;  4LF4 Q;  4LF6 Q;  2R61 A;  4A3J B;  4QJF A;  2G5D A;  2A6H C;  1X32 A;  4A3L H;  3F8T A;  2K6A A;  1SNM A;  3OW7 A;  1GUG A;  2K28 A;  1B1Z A;  1Z9F A;  3VR6 A;  1ROD A;  2CKZ B;  2JP1 A;  3HGB A;  2VUM G;  1K0S A;  1KXL A;  2BH2 A;  3FHW A;  1H9R A;  4BXX H;  1LTI D;  2PQA B;  1VQA A;  2DY8 A;  2B39 A;  3MFY A;  3QR8 A;  1LTR D;  3TP8 A;  3I4L A;  1HZ9 A;  2AKW B;  4HJ7 A;  2XTI A;  3TP5 A;  3S16 H;  5DLQ E;  4HIO A;  3ICE A;  4B9X A;  5L37 A;  4YY3 Q;  2MHV A;  3RNU A;  4DAY A;  1CKN B;  1K28 A;  2F0D A;  3A5Z B;  5C44 B;  3GTL B;  1L0Y B;  1HRJ A;  2HQL A;  5DM7 3;  1I4X A;  4IN3 A;  3AMU A;  5K36 G;  1VMP A;  2IY5 B;  4QIW B;  1JQY D;  1JB7 A;  3PV0 A;  2I5M X;  4LWC A;  3U9O A;  1K83 H;  3J81 j;  1JMC A;  1F77 A;  2NN6 H;  1A6X A;  4RHS A;  1KNA A;  1B9M A;  2IX1 A;  3V96 A;  1X3G A;  3C46 A;  5COY A;  3CPW A;  1PRT B;  4DNT B;  1KLG D;  1N36 Q;  5JJI A;  4V19 0;  1VQ6 A;  4AYB E;  1LAB A;  2A6H D;  4HSV A;  4UY8 C;  4CJ0 B;  4CDD C;  2MP1 A;  2B3G A;  1SMX A;  1ASZ A;  4IAL A;  3DWQ A;  4DAY B;  2K1B A;  4PG3 A;  3FKI B;  1AW7 A;  4K5W A;  4LF8 L;  1IKL A;  2VXW A;  1TS2 A;  1XPU A;  1JOQ A;  1BOS A;  5EPK A;  3B6Y A;  4UDU C;  3MEH A;  4LF7 L;  2BA1 A;  3SR1 A;  1PH5 A;  5CV6 A;  1VQP A;  1PTO C;  1JJ2 A;  3R2I A;  2UU9 Q;  4A93 H;  2WAQ G;  3F2D A;  4DU9 A;  2HIX A;  4OEL B;  2E2J B;  5EQ0 A;  3A8I E;  1MBY A;  3BVG A;  2PMZ E;  2VB2 X;  1L1O B;  2K5H A;  2QEJ C;  1NUC A;  1X3Q A;  2FJ2 A;  5HY6 A;  3S14 B;  4H44 C;  5BR8 Q;  4IUV A;  5D65 A;  3GTO B;  1W2B A;  1ILP A;  5EBD A;  4YWL A;  5C5L A;  1JJC B;  2K4K A;  2L4N A;  3T13 A;  1NR4 A;  3OIP A;  5LL6 S;  1B8A A;  4O1N A;  4ZUI A;  1SLJ A;  2F0K A;  5C4X H;  1XTC D;  1QCB D;  1WTV A;  3CQZ H;  1OTC A;  3U58 A;  2YTV A;  1TII D;  2TMP A;  2SNS A;  3J7A 5;  2HT1 A;  4PNY A;  4DV5 Q;  1I4H A;  1SBB B;  1G51 A;  1MGS A;  5FO9 B;  2JA9 A;  1E2Z A;  1GO3 E;  3KF8 B;  2UUC Q;  3C2P A;  1VQ7 A;  2DNC A;  5C4J H;  2L15 A;  2EOT A;  1EYA A;  1PTO D;  4UP8 A;  1D7Q A;  1SND A;  4CDC C;  1U4M A;  1V1P B;  1X3E A;  3CP0 A;  2NTS A;  3DM3 A;  3MXN B;  2ZM6 L;  4AQY L;  1D5X C;  4EQN A;  4DV6 L;  3I4N H;  3VYT A;  1ET6 A;  1DXM A;  2UXD Q;  4WJW A;  2NBF A;  3RZO H;  5FJ8 G;  1S5C D;  3JAM c;  5JPN C;  4A3I H;  4L5R C;  1UEA B;  2MO0 A;  4XDX A;  1EUJ A;  1IYJ B;  3ITP A;  1BCP B;  3BVZ A;  3HFZ B;  5C6A A;  2X69 A;  2WP8 J;  2CW0 C;  2ZTD A;  3VDY A;  1O78 A;  2K75 A;  1XWE A;  2VUM B;  4LAA A;  4LFB Q;  1S72 A;  3TP7 A;  4JBM A;  4GNX C;  1I4R A;  2KEE A;  3STB C;  1SE3 A;  1PLF A;  2MFI A;  1I6V C;  4OO1 G;  4K0K Q;  4JI3 Q;  3CW2 C;  1G91 A;  1EOT A;  1STA A;  1CHP D;  3G71 A;  2XRQ D;  2B2V A;  3FDT A;  4XQN A;  2IHF A;  3BS1 A;  1HUM A;  4DV1 Q;  3SK8 A;  4AYB G;  3UDG A;  1SYD A;  4JI0 L;  1H95 A;  2UUA Q;  2NVX B;  5IGG A;  1MKH A;  2HCI A;  2GVB A;  1Y1W H;  4A3G H;  2CFM A;  4RKB A;  3HOU G;  4HIM A;  3KBX A;  4A3K G;  3KDF B;  4OL7 A;  1BKB A;  4X3T A;  2NZ1 D;  2ID0 A;  4R4O A;  3T1H Q;  4DV3 Q;  3G48 A;  4IQZ A;  4TKO B;  5I6W A;  2EYP A;  4JI2 L;  1CT1 D;  2WB1 B;  1I6H H;  2F0M A;  3CF5 A;  1NAP A;  4RFB A;  3K57 A;  4KMU C;  2A6E C;  2CW0 D;  3J81 E;  5C0X G;  4RGN A;  2PZT A;  2EY6 A;  1WI5 A;  3I4M H;  2F52 A;  3TRE A;  1QWY A;  3H6M A;  3AEV A;  3M4P A;  1QE6 A;  2AUK A;  3STB D;  2PI2 E;  3NE5 B;  4FF4 A;  3C0O A;  4L63 B;  1RF2 D;  2PW7 A;  4G7H C;  4FF1 A;  1EY9 A;  1SRO A;  5EAY A;  1OXU A;  3NTI A;  1B70 B;  1XNQ Q;  4N8F A;  2F0F A;  4IPC A;  3BZC A;  4PMW A;  2Q2U A;  4HTH A;  1SEB D;  2F3I A;  2E75 C;  2UXC L;  2D2C C;  1CKM A;  5C4Z A;  1A62 A;  3G6J B;  4DR7 Q;  3NXW A;  1S5E D;  3HKZ E;  5C4H A;  4LF5 Q;  2M2L A;  2QCP X;  2WAQ B;  4K6L A;  3W1B A;  2UXB L;  2PNR C;  3M4O H;  4DV0 Q;  4GKK Q;  4EQ5 A;  2PPB C;  1Q82 C;  3GV6 A;  4XIG S;  4A3J H;  3S1N B;  2CHB D;  4X62 Q;  5DAU A;  1Q46 A;  3ULP A;  3A54 A;  3TDQ A;  1L2F A;  4DFA A;  4ZYS A;  2A6E D;  2I0Q A;  4KKU A;  5LL6 X;  5JOB A;  3TS0 A;  1FGU A;  2ZTC A;  5JEA J;  1N32 L;  1M8A A;  5A2Q E;  3KLS X;  1PXU A;  1M1K C;  4H02 A;  3MTS A;  4C1N K;  1JC7 A;  2RCN A;  4R8I A;  3NTH A;  1ASY A;  4FYD A;  2ICI A;  4IUN A;  1I94 Q;  1Y69 U;  5FLM G;  4XXE A;  4LF6 L;  3GTL H;  5IT9 c;  4DR1 Q;  1YVC A;  4KN7 C;  5JJL A;  4OWT B;  1LTA D;  1WTQ A;  1TQO A;  5FOB B;  2E74 C;  5GRO A;  2F0E A;  4IFD H;  3A8J E;  3DMU A;  3HZX A;  3K58 A;  3M9B A;  2RKS A;  5DNF A;  5GAD C;  5FO8 B;  1A15 A;  1EFW A;  4XYQ A;  4CDE C;  3AYH B;  2FXQ A;  2AUJ D;  5JJK A;  1A8V A;  4P74 A;  3VYR A;  4YY3 L;  3OIQ A;  5C3W A;  4HCS A;  3CC7 A;  2N3S A;  4GLX A;  3EQL C;  1DGS A;  2E5L L;  2I07 B;  2EYF A;  1KHI A;  1GUT A;  2HD3 A;  2A19 A;  3OHX C;  1N34 Q;  1BF4 A;  3FKI H;  4LUO A;  1JWU D;  4O42 A;  2B2U A;  2F03 A;  3KYH C;  1QIL A;  4YWK A;  5COR A;  1IKM A;  2EXD A;  2C5C A;  1Q12 A;  4L6T B;  2Z6K C;  4XQQ A;  5ELD A;  3J7Y W;  1IBK Q;  4DK6 C;  2HQE A;  1HQR D;  2JK8 A;  1KIX A;  1MI2 A;  2NVQ B;  1UE5 A;  3PQI A;  3X3M A;  1STN A;  4KI0 A;  4BBS H;  3S2D H;  3OMG A;  3MAQ A;  1SE4 A;  1VQB A;  2F4I A;  1M90 C;  4AYB B;  1WJJ A;  2OEO A;  4HIK A;  2VQE L;  2E2J H;  1LTS D;  2EJF C;  4M8A A;  1WCM G;  3D6C A;  4F8M A;  5ELC A;  4NXN Q;  3HOU B;  3S17 B;  3SVM A;  4A3K B;  4G4K A;  3S14 H;  2WAC A;  3T53 B;  5K5P A;  1G2T A;  2NYZ D;  1AFP A;  3GTO H;  4Y7N H;  3GTK B;  4JG2 A;  1DOK A;  1ESR A;  3F2C A;  2KJX A;  4FNF A;  1CI3 M;  3M4Q A;  1HUN A;  2E76 C;  1H9S A;  3HKZ G;  4E6I A;  2BCO A;  3FPP A;  4C1N I;  2VL6 A;  2YYZ A;  2BH8 A;  1STE A;  3C1F A;  1ENA A;  3PCO B;  2OCE A;  4A76 A;  2PMZ B;  3MEF A;  1JWM D;  1MJC A;  3I7F A;  3DLL A;  4JW0 A;  1ILQ A;  1HCZ A;  5FLX E;  2F0L A;  2EYJ A;  2KHJ A;  2Q8I B;  1O7I A;  4DA2 A;  1BBX C;  3IFT A;  4ID6 A;  4IFD I;  4BA1 I;  4DV2 L;  3GO5 A;  3T1Y Q;  4OWW B;  1STY A;  3MHB A;  4J15 A;  2DNE A;  1STH A;  5GAG C;  3U4V A;  1U5K A;  4LW1 A;  5ISR A;  4ZK9 B;  1EFI D;  2DJF C;  3E0J A;  1A3T A;  2EYH A;  4CHT B;  3SXH A;  1SYB A;  4JI1 Q;  5CMD A;  1UAP A;  4AIM A;  4DV5 L;  1JT8 A;  1E24 A;  4U67 3;  1CA6 A;  4DXG A;  2UUC L;  2SNM A;  3K7U C;  1HNW Q;  2E2H B;  1HFN A;  3ERQ A;  1X56 A;  2F3V A;  3F2B A;  2VUM H;  3HOY G;  1A3U A;  3WOE A;  2DY7 A;  2WB1 E;  1O7L A;  3X3N A;  4BBR G;  2VZA A;  1LT5 D;  5IIF A;  5KIX A;  2OF1 A;  1D6E C;  3FVQ A;  3VR4 A;  1YNX A;  1OXS C;  3PO3 G;  3R8B A;  2YV5 A;  5EBC A;  3HP3 A;  2RSN A;  1XNR Q;  2N55 A;  4CKB A;  4J1M A;  5M5X B;  2GVA A;  1D8L A;  2K7V A;  3VR3 A;  2K32 A;  5D3I B;  4PMC A;  2ZJR A;  3CCS A;  2NVX H;  5KRU A;  3IAY A;  3GTP B;  3KF6 A;  5K36 H;  1XXG A;  3TRZ A;  5E4X A;  2DUD A;  3K5N A;  4LFB L;  1TU2 B;  1O80 A;  2KEN A;  1LTG D;  2JE6 I;  1ONL A;  4OWX B;  4G57 A;  1XYI A;  2A5H A;  5E1F A;  1EL0 A;  3IL8 A;  4DAP A;  4C3J G;  1PH8 A;  1WFQ A;  2KQ3 A;  4JI3 L;  3H3V H;  3CC4 A;  1D1I A;  2E2D C;  1TT2 A;  4LJZ C;  1C48 A;  3J81 i;  1D2B A;  1A63 A;  1KLU D;  4DV1 L;  3N6R A;  1GUS A;  1MD2 D;  2J4X A;  2CH4 W;  1CSP A;  2K50 A;  2PI2 A;  1Y14 B;  3NWS A;  3LX0 A;  1HZA A;  4DR5 Q;  1PH1 A;  1PRE A;  4DAM A;  2MUY A;  3RZD B;  1VQD A;  1DZ1 A;  2MQH A;  3V2T A;  1A2T A;  4GZY C;  4N9T A;  2WIN B;  1NE3 A;  1U4P A;  2YTY A;  4QUC A;  1RIP A;  4IJL A;  1DD2 A;  5E4W C;  3D4R A;  4GLA C;  5HUR A;  1YJ9 A;  1AE2 A;  1LO5 D;  3K80 C;  3K0Y A;  3F1Z A;  2KBN A;  4LFC L;  4GS3 A;  1JIC A;  1J6Q A;  3DEP A;  1K8M A;  4KN4 C;  4F87 A;  4JI8 Q;  4KHZ A;  2LXK A;  3E5S A;  3QB3 A;  1WCM B;  1QG7 A;  4YHH Q;  1MJE A;  1TS5 A;  4GLV B;  1B4O A;  3G4N A;  1EIF A;  4ME5 A;  3K5M A;  4HID A;  1C9O A;  3NBH B;  2F0I A;  3S1N H;  4DK3 C;  3UI2 A;  4DR6 Q;  1Q8I A;  2EJG C;  3K7A B;  4B9W A;  4EQP A;  2KCN A;  4DR7 L;  4ILW A;  1B3Q A;  4RAU C;  5JAV A;  4IPH A;  4ZLT F;  2OWO A;  1N33 L;  1XJV A;  4HMI A;  2UUB L;  3Q24 A;  1K8G A;  1PTO B;  1J9O A;  1RKN A;  3HKZ B;  3GP7 A;  4DV0 L;  2F4V Q;  1D5M C;  1EZ8 A;  2K33 A;  3NP8 A;  2R3Z A;  1DYQ A;  3QIA A;  4P72 A;  1FJG Q;  2B2T C;  4ZQ3 A;  3I8Z A;  1PYB A;  4K8J A;  4X62 L;  2TSS A;  1PMR A;  2KUM A;  1SN8 A;  4B3S Q;  4A3B G;  2Q8T A;  3PF5 A;  2MJ8 A;  4DUZ Q;  2R7Z G;  1QVC A;  2MNA A;  2CWP A;  3S15 B;  2EYL A;  1NNX A;  5C5M A;  3RLN A;  2F0O A;  1HNZ L;  2WB1 G;  3WDN A;  3CD6 A;  5H1S E;  2A73 B;  3CCU A;  4DKA C;  5IP7 H;  3S1R B;  1PFM A;  2KOL A;  5M3M G;  2PNH A;  2RHS B;  1IHZ A;  4JI6 L;  2MGS A;  4BY1 G;  2ATW A;  5FJ8 H;  4KHP Q;  1RHP A;  2EVB A;  2EQS A;  1VQL A;  4B3T Q;  1CK1 A;  2XRS D;  3MFG A;  4DN4 M;  2YTX A;  1AZP A;  4GNX A;  4DK1 A;  2CQO A;  1J8I A;  2F0P A;  3HOY B;  4UPA A;  3L3O C;  2K01 A;  4IO9 A;  1VQK A;  1OXV A;  2ASB A;  1RCV D;  4MIU A;  4BBR B;  4K2K A;  1SNO A;  3UDX A;  4BS9 A;  1JOK A;  1F9P A;  1FNV A;  1MIU A;  1GXD C;  3JAM L;  1Z52 A;  4C3I G;  4OO1 H;  1XMO L;  3OTO Q;  1I4Q A;  4FXD A;  1VQG A;  1SNP A;  4PQX A;  1IYV A;  4JK1 C;  2F0T A;  4RGM A;  3PO3 B;  2O5J C;  1I4P A;  3QWN A;  1CZW A;  1EWI A;  1I3Q B;  1CFM A;  3LNN A;  3HOX G;  1TWA B;  1KNE A;  1RTN A;  1N34 L;  2RDF A;  2N78 A;  3FPU B;  3GTM B;  1Y8O B;  5IGE A;  5M3F G;  3E0E A;  1Z7T A;  1K0R A;  4DV7 L;  3HOU H;  3S17 H;  4A3K H;  3CC2 A;  2NZO A;  4JI7 L;  1NJI C;  1H9M A;  1SMY C;  1LTB D;  1U4R A;  4GKJ Q;  3E3X A;  3K8A A;  3EA6 A;  4C3J B;  4GNX B;  2FMC A;  4F88 A;  1IBK L;  1C0A A;  4IPG A;  2WKD A;  5J22 A;  4O2D A;  4ZCK A;  2RBM A;  1Y8N B;  2FFK B;  1B53 A;  1YJN A;  4JI5 Q;  4P71 A;  4ZRZ A;  3W3A A;  1CTM A;  1STG A;  4TSS A;  5E3F A;  1IZ6 A;  4JOI C;  3FMC A;  1CUK A;  2JXM B;  3H94 A;  3PUZ A;  3Q23 A;  1VQ8 A;  2R93 G;  2K05 A;  4LF9 Q;  4IUR A;  5C0X H;  3FP9 A;  5JVG 3;  5J3B A;  2ZJQ A;  1HA5 A;  3AFP A;  4UP7 A;  3T16 A;  3I55 A;  3N52 A;  4OEM B;  2K52 A;  4JBK A;  1W6J A;  2Z4I A;  2RQX A;  3J7A F;  2NN6 I;  3MC0 B;  4GN3 B;  4DV4 Q;  4HMJ A;  3A7L A;  1YNJ C;  2B8G A;  1XTD A;  5IYB G;  4FDB A;  3D4D A;  2Q2I A;  4S3S A;  1E0B A;  1NR2 A;  3KUP A;  2V1C C;  3H0G G;  2JQO A;  3NUC A;  1IW7 C;  2G9D A;  1XMQ Q;  1K3R A;  4JC0 A;  1NMF A;  1QNK A;  4A3E G;  2EIF A;  3K81 C;  1SMY D;  4QCL A;  4XTC S;  5LMU Q;  2Q8R E;  1BNZ A;  1WYD A;  3OSO A;  4HSP A;  3Q6S A;  4JI4 Q;  3J81 c;  1SYE A;  2L5T A;  2Y0S E;  2E2H H;  4MHE A;  4RG1 A;  1Y8P B;  5JVH 3;  4A3M G;  2JA7 G;  3CCQ A;  4TVA B;  5EPJ A;  1B9N A;  5KNB A; 
#chains in the Genus database with same CATH homology
 1IL8 A;  3D6W A;  4IUP A;  1CZG A;  1Z47 A;  5EKL A;  2RA4 A;  4RA8 A;  1WD1 A;  4IZ8 A;  2KHS A;  3T56 B;  3URY A;  3A8K E;  1MSH A;  5IGC A;  4U68 A;  4ABN A;  5CV4 A;  3FEW X;  3TBI B;  3AB9 A;  2QKI C;  4EVO A;  1YNJ D;  3MXU A;  2ZT9 C;  4A3B B;  3C0N A;  3DXJ C;  2J0T D;  4EGV A;  2R7Z B;  5I4D A;  1EWH A;  1KDC A;  1IW7 D;  1SE2 A;  2O5I C;  2FMM A;  5DEH A;  3M3Y B;  2XN9 C;  5M5W B;  3PMF A;  2EY5 A;  5M3M B;  1Q90 A;  5IT9 L;  3S2H B;  5I9O A;  4BY1 B;  2XWJ B;  1F9Q A;  2RSO A;  1TWH B;  3G7L A;  5CR3 A;  3VR5 A;  1PZK D;  4IFD J;  1QNU A;  1Q3L A;  5DM6 3;  1VMC A;  4ZKC B;  5CYU A;  1WTR A;  3GTG B;  2EY1 A;  3ND9 A;  5J1Z A;  1WVL A;  1KAA A;  1BCP C;  1WTW A;  5CBA E;  4C3I B;  1STB A;  5KGU A;  4X3S A;  2NUC A;  2F0N A;  5ELF A;  5I2X A;  2XVS A;  4R8N A;  3HOX B;  2HUG A;  2A69 C;  1FNW A;  2PCF B;  4HED A;  4K5V A;  5M3F B;  2XWB B;  1NSN S;  5FK9 C;  3Q0A A;  5I2Y A;  3NHH A;  1M4V A;  3RD4 A;  5M5Y B;  3PUV A;  2R93 B;  4JBW A;  1PTO H;  1V1O A;  2QF7 A;  5NUC A;  3NBI A;  2K5Q A;  2C9O A;  1EWC A;  1BCP D;  4X3U A;  2B2Y C;  1SYG A;  1G8Z D;  1R4P B;  1TKW B;  1ICW A;  1CQF A;  4QB4 A;  3EFX D;  1LAC A;  5CBE E;  2DN8 A;  4L8J A;  2A69 D;  4WOR A;  1EY5 A;  4DNR B;  2F0G A;  3H0G B;  1TWC B;  4DK0 A;  2WV6 D;  4IUT A;  2QIL A;  1TWG B;  2F0W A;  4A3E B;  2H1E A;  3SHL A;  4M1U B;  3H09 A;  3FRP B;  2AQ3 B;  1PDQ A;  3H91 A;  5IOC A;  3J80 L;  1RJT A;  4A3M B;  2JA7 B;  3KBG A;  4MN3 A;  3PUW A;  1JWS D;  3VYU A;  4KY5 A;  1LLR D;  2V4D A;  2HDM A;  1JOO A;  1QOH A;  1B3A A;  3PUX A;  3GTJ B;  1WD0 A;  3M85 A;  3DHQ A;  3SK5 A;  3D3R A;  4K5X A;  1KDB A;  4A93 B;  1JOR A;  4J6H A;  3V05 A;  2EJM A;  4XQJ A;  1DCZ A;  1TS4 A;  3VA7 A;  5M9O A;  4RHR A;  4H0L C;  1XX8 A;  1OXT A;  4PV1 C;  2L11 A;  2EPB A;  1I50 B;  2LMC B;  3MWY W;  2IWH A;  1HA6 A;  1PYW D;  1S5D D;  2JA8 B;  1SNC A;  2VB3 X;  1TS3 A;  2FHT A;  1ZEQ X;  3SK6 A;  1K8O A;  2L55 A;  4XYO A;  2A74 C;  2RDH A;  2E2I B;  4KKT A;  3T4A C;  1SJE D;  4UAI A;  3F2U A;  4DXF A;  1F2Z A;  4IFD G;  2PYK A;  3C1E A;  1H9S B;  2D5D A;  1HHV A;  4KKS A;  1SSO A;  1SDF A;  4OHJ A;  2SEB D;  4RCO A;  3IKJ A;  2AWN A;  1BR9 A;  4A3F B;  4K6D A;  3PO2 B;  3RZO B;  1R9T B;  2GA4 B;  3OPO A;  3R93 A;  2N88 A;  3L9A X;  4PMB A;  1OO9 B;  1I4G A;  1HFG A;  2OT2 A;  3I3C A;  2ZXO A;  3S9W A;  4NW2 A;  2BA0 A;  4NKL A;  1EY7 A;  4LMQ D;  4G7Z C;  2F0V A;  2LY7 A;  3A56 A;  2B2T A;  3HOW B;  3RMH A;  2H4O A;  3CHB D;  1DON A;  2JA5 B;  5JEA G;  5LHY 1;  4H7B A;  2L9H A;  2Y0S B;  1DOM A;  2JEA I;  3PIP 3;  2PW5 A;  1Y1W B;  3D8G A;  3TN2 A;  2MPM A;  1ENF A;  3TSS A;  2IJ0 A;  1G6Z A;  2L0C A;  1A2U A;  4FVM A;  2IT1 A;  3ND8 A;  1I6H B;  5T1G A;  1DOL A;  2EDG A;  1AN8 A;  2L1B A;  5KYL A;  1Y1V B;  2ENB A;  1HTL D;  1HTP A;  1EEI D;  3DUZ A;  1EY6 A;  4YIJ A;  3HOV B;  3BZD B;  1B2T A;  3A7A B;  3BDL A;  2K03 A;  4CGY B;  1AP0 A;  3HRZ C;  5EKI A;  4HCE A;  1MSG A;  1F9S A;  2HDL A;  1SFO B;  4RWS C;  2A68 C;  2AQ2 B;  1BO0 A;  1DJR D;  3MA2 B;  2XNA C;  5CV5 A;  1G29 1;  4XT3 B;  1T5X D;  3NQI A;  4FF3 A;  2BE5 C;  1PRT F;  2LS0 1;  3TZU A;  4CJ1 B;  1LV9 A;  4K14 A;  3G4O A;  2PZW A;  1FYC A;  2CQA A;  4RH6 A;  3QJY A;  2KEC A;  3S1Q B;  1ZXT A;  2FIN B;  1H9K A;  2EY2 A;  5EKK A;  1RTO A;  3QG1 A;  1QB5 D;  5C0X J;  4J8Q A;  2A68 D;  3ZYY X;  2RVL A;  1RDP D;  4C3H G;  1EIH A;  2X6G A;  2RDG A;  2BE5 D;  3J7A V;  2B8F A;  2Z1C A;  3SK4 A;  1F2Y A;  3OMC A;  1EU4 A;  1LT6 D;  1HQM C;  4ODG A;  2IL8 A;  1JCK B;  4KTA A;  3TZD A;  2KA7 A;  4C2M B;  1AZQ A;  2R92 B;  4HAE A;  1GUO A;  2ZXP A;  1JR0 D;  1W6K A;  1Z6H A;  4KD4 A;  3P75 A;  2BDO A;  1GUW A;  5EPL A;  1VDZ A;  3ONA B;  1SNQ A;  3J81 L;  1ZYR C;  2KCC A;  2SOB A;  3E6Z X;  3QOL A;  4BBS B;  3S2D B;  2IX3 A;  5C3E B;  1AEX A;  1E2W A;  1Q1E A;  1EY4 A;  5J39 A;  3VYS A;  3KLS A;  4NP5 A;  3KF8 A;  1EEF D;  1B44 D;  1KAB A;  2CVR A;  3RUZ A;  4G7O C;  4H13 C;  4TRD A;  5JJZ A;  2KED A;  1EZ6 A;  2EXZ A;  1V1P A;  3MXN A;  1BCP F;  2JA6 B;  2R6G A;  1FD7 D;  4KY6 A;  1ZKO A;  4Y7N B;  1PRT C;  4CJ2 C;  2O2L D;  4CKE A;  1S5F D;  1TWF B;  2IW3 A;  3NWT A;  4KY7 A;  1ESF A;  4WFN 3;  3BYY B;  1ZYR D;  3Q22 A;  4DGZ A;  5JPM C;  2NN6 G;  3KK7 A;  3OWF A;  5A2Q L;  1PZI D;  1C4Q A;  4I65 A;  1SYC A;  1UNS A;  2LFN A;  3DWA A;  3CU7 A;  4V0B A;  1LTT D;  1FNU A;  1BXT A;  2K04 A;  4KK7 A;  1KDA A;  4HR7 B;  1H9J A;  5FKA C;  4RCN A;  1EYD A;  1U9R A;  5EGT A;  5IGF A;  1SAP A;  2G9H D;  4OGQ C;  4DAV A;  3LWU A;  1D5Z C;  1PRT D;  4OO1 I;  1CHQ D;  4ZKB B;  2F0U A;  2B2W A;  2O4X A;  3P1H A;  1R4Q B;  4P2C B;  1PFN A;  3ERO A;  4N9P A;  4Q5V A;  3I90 A;  3M7N A;  3BG3 A;  3HOZ B;  5HGT A;  3GD7 A;  2B2Y A;  1TR5 A;  2NVY B;  4EQO A;  4IUU A;  3LWE A;  5ELE A;  1A3V A;  1EYC A;  1V8Q A;  2M00 A;  4LK1 C;  2PO4 A;  2ZXR A;  3I70 A;  4A3D B;  1BDO A;  3OWE B;  2L12 A;  4XT1 B;  1PZJ D;  2XSC A;  3MXP A;  4C3H B;  3GTQ B;  3D4W A;  2ICE C;  5KYI A;  3JAM E;  2LKV A;  5C0X I;  3MZ5 A;  3TME A;  2J7Z A;  2B63 B;  3VA5 A;  3P20 A;  5KEE A;  1YNN C;  3NTK A;  1E2V A;  1D1K A;  3WOF A;  2EE1 A;  5D3D A;  1EQT A;  2HCC A;  3T51 B;  2EZV A;  3OOC A;  2PQE A;  1GHK A;  5I9P A;  3EVQ A;  1JB3 A;  3W2D A;  5BN5 A;  5C3X A;  3CRK C;  5CV8 A;  1TY0 A;  4KD3 A;  4QF4 A;  1PFB A;  1LT3 D;  1RD9 D;  1NCV A;  5CV9 A;  4BY7 B;  1F2M A;  4CBV A;  1GHJ A;  3O13 A;  2F3W A;  3RLF A;  2X6L A;  4ULL A;  2K5D A;  2M9V A;  1LT4 D;  3IFD A;  3PIO 3;  5FLX L;  1B50 A;  3DM1 A;  4RKL A;  3K6O A;  4RGT A;  3L7Z C;  4WRD A;  4C56 C;  1BQQ T;  4QUF A;  2B2W C;  3HG9 A;  3MXG A;  1WTO A;  1JE4 A;  4TQU S;  1YNN D;  3H3V C;  2OXP A;  1BUV T;  3M7G A;  2NTT A;  5ELB A;  3S16 B;  2K5W A;  2B2V C;  2WKC A;  4IUQ A;  2EYO A;  3CRL C;  4Q0F A;  1CM9 A;  2I46 A;  5EJW A;  1K83 B;  1TVX A;  4RGO S;  1II3 A;  3U9S A;  3VR2 A;  1V43 A;  2JYO A;  2AWO A;  3P7J A;  4R9W A;  1FR3 A;  1OXX K;  2VNU D;  3HEJ A;  5AFW A;  1FGB D;  1U4L A;  1CQV A;  2NB0 A;  4K8I A;  3EJI A;  5CGK A;  4FXG C;  5G3L F;  4CKC A;  1EY0 A;  4ZUJ A;  1T5E A;  1CA5 A;  3K5L A;  3K59 A;  5F2D A;  3GV3 A;  3TP6 A;  3NQT A;  2F0J A;  5IT9 E;  1ENC A;  1ET9 A;  5JEA H;  3NK9 A;  4NDX A;  2EYM A;  3PUY A;  4ZAI A;  3HS0 C;  2BOS A;  1X3P A;  3M4Y A;  1G2S A;  1O7Z A;  4OIJ A;  5TSS A;  1TY2 A;  5IGD A;  3KLR A;  2XIW A;  3AU7 A;  1UUP A;  3I91 A;  4HN7 A;  5C4X B;  4FO2 A;  3BYT B;  3CQZ B;  4KV6 A;  4FF2 A;  2AQ1 B;  4Z9C B;  1C8C A;  4KJN A;  3A55 A;  5C4J B;  3C3L A;  1KTK A;  4B08 A;  3I4N B;  1F9R A;  3C0M A;  1QJO A;  3QOJ A;  3MVV A;  5A35 A;  3NPP A;  3BDO A;  1GJX A;  5IGB A;  2QDB A;  3I73 A;  1GOZ A;  2IPK D;  3DWP A;  4A3I B;  1GUN A;  2IX0 A;  2F0Q A;  1VCI A;  1SXT A;  2JEB I;  4QMG A;  2KVM A;  2B2U C;  4KHV A;  3DEO A;  1WTX A;  1S5B D;  5KNC A;  4F7X A;  4NMZ A;  3I72 A;  1IYU A;  4OIK A;  4X3K A;  2NVT B;  2JSO A;  2WII B;  4FXK C;  3K5O A;  1EY8 A;  1EIG A;  4BWG B;  4A3G B;  2F1M A;  4KJO A;  5BN3 A;  1O7Y A;  1VF5 C;  2PZU A;  2Z4H A;  3D31 A;  3J80 E;  2SDF A;  4I7Z C;  3S1M B;  1ML0 D;  3R3O A;  4FP5 D;  3SEB A;  2D62 A;  5IOD A;  3SE0 A;  1Q1B A;  1DM0 B;  1WTP A;  3I4M B;  1L0X B;  2F0S A;  2NWG A;  1SJH D;  3GQB A;  3SDZ A;  2YU9 B;  3NBH A;  3QO2 A;  2F0H A;  3NSW A;  1PTO F;  3BDC A;  2D9U A;  1HXY D;  1EQV A;  5CV7 A;  5G3L D;  5T1I A;  1EU3 A;  5I6Y A;  2BDN A;  5BN4 A;  1S4Z A;  1VF7 A;  4DF7 A;  1HPC A;  1F2L A;  5KND A;  3BVM A;  3R2T A;  4K2L A;  5FO7 B;  4BA2 I;  5D14 A;  1SYF A;  3M4O B;  2Z8L A;  3CKI B;  5CC4 A;  2R61 A;  4A3J B;  2A6H C;  1X32 A;  2K6A A;  1SNM A;  3OW7 A;  1GUG A;  2K28 A;  1B1Z A;  3VR6 A;  1ROD A;  3HGB A;  2JP1 A;  1H9R A;  1LTI D;  2DY8 A;  2B39 A;  3MFY A;  1LTR D;  3TP8 A;  3I4L A;  3TP5 A;  4B9X A;  2MHV A;  4DAY A;  2F0D A;  5C44 B;  3GTL B;  1L0Y B;  1HRJ A;  5DM7 3;  1I4X A;  4IN3 A;  3AMU A;  5K36 G;  1VMP A;  4QIW B;  1JQY D;  3PV0 A;  3U9O A;  1F77 A;  2NN6 H;  1A6X A;  4RHS A;  1KNA A;  1B9M A;  2IX1 A;  3V96 A;  3C46 A;  5COY A;  1PRT B;  4DNT B;  1KLG D;  4V19 0;  1LAB A;  2A6H D;  4HSV A;  4CJ0 B;  2MP1 A;  4IAL A;  3DWQ A;  2K1B A;  3FKI B;  1AW7 A;  4K5W A;  1IKL A;  2VXW A;  1TS2 A;  1JOQ A;  1BOS A;  5EPK A;  4UDU C;  3MEH A;  2BA1 A;  3SR1 A;  5CV6 A;  1PTO C;  3R2I A;  4DU9 A;  2E2J B;  5EQ0 A;  3A8I E;  1MBY A;  3BVG A;  2VB2 X;  2QEJ C;  1NUC A;  1X3Q A;  2FJ2 A;  3S14 B;  4H44 C;  4IUV A;  5D65 A;  3GTO B;  1ILP A;  5EBD A;  5C5L A;  2L4N A;  3T13 A;  1NR4 A;  3OIP A;  5LL6 S;  4O1N A;  4ZUI A;  2F0K A;  1XTC D;  1QCB D;  1WTV A;  1TII D;  2TMP A;  2SNS A;  4PNY A;  1I4H A;  1SBB B;  5FO9 B;  1MGS A;  1E2Z A;  3C2P A;  2DNC A;  2EOT A;  1EYA A;  1PTO D;  1SND A;  1U4M A;  1V1P B;  2NTS A;  1D5X C;  4EQN A;  3VYT A;  1ET6 A;  1DXM A;  4WJW A;  2NBF A;  1S5C D;  5JPN C;  1UEA B;  4XDX A;  3ITP A;  1BCP B;  3BVZ A;  5C6A A;  2X69 A;  2WP8 J;  2CW0 C;  1O78 A;  1XWE A;  2VUM B;  4LAA A;  3TP7 A;  1I4R A;  2KEE A;  1SE3 A;  1PLF A;  1I6V C;  4OO1 G;  1G91 A;  1EOT A;  1STA A;  1CHP D;  2XRQ D;  2B2V A;  3FDT A;  4XQN A;  3BS1 A;  1HUM A;  3SK8 A;  1SYD A;  2NVX B;  5IGG A;  2HCI A;  4RKB A;  3KBX A;  4OL7 A;  4X3T A;  2NZ1 D;  2ID0 A;  4IQZ A;  4TKO B;  5I6W A;  2EYP A;  1CT1 D;  2WB1 B;  2F0M A;  1NAP A;  4RFB A;  3K57 A;  4KMU C;  2A6E C;  2CW0 D;  3J81 E;  5C0X G;  4RGN A;  2PZT A;  2EY6 A;  1QWY A;  3H6M A;  1QE6 A;  2AUK A;  4FF4 A;  3NE5 B;  3C0O A;  4L63 B;  1RF2 D;  2PW7 A;  4G7H C;  4FF1 A;  1EY9 A;  1OXU A;  3NTI A;  2F0F A;  4PMW A;  4HTH A;  1SEB D;  2E75 C;  2D2C C;  5C4Z A;  3G6J B;  3NXW A;  1S5E D;  5C4H A;  2M2L A;  2QCP X;  2WAQ B;  4K6L A;  2PNR C;  2PPB C;  3GV6 A;  4XIG S;  3S1N B;  2CHB D;  5DAU A;  3A54 A;  3TDQ A;  4ZYS A;  4DFA A;  2A6E D;  4KKU A;  5LL6 X;  5JOB A;  5JEA J;  1M8A A;  5A2Q E;  3KLS X;  1PXU A;  3MTS A;  4C1N K;  1JC7 A;  4R8I A;  3NTH A;  4FYD A;  2ICI A;  4IUN A;  1Y69 U;  4XXE A;  4KN7 C;  1LTA D;  1WTQ A;  1TQO A;  5FOB B;  2E74 C;  2F0E A;  4IFD H;  3A8J E;  3DMU A;  3HZX A;  3K58 A;  2RKS A;  5DNF A;  5FO8 B;  1A15 A;  4XYQ A;  2AUJ D;  3VYR A;  3OIQ A;  5C3W A;  4HCS A;  3EQL C;  2I07 B;  2EYF A;  1GUT A;  3OHX C;  1BF4 A;  1JWU D;  4O42 A;  2B2U A;  2F03 A;  1QIL A;  5COR A;  1IKM A;  2C5C A;  1Q12 A;  4L6T B;  4XQQ A;  5ELD A;  3J7Y W;  2HQE A;  1HQR D;  1MI2 A;  2NVQ B;  3X3M A;  1STN A;  4KI0 A;  3OMG A;  3MAQ A;  1SE4 A;  2F4I A;  4AYB B;  2OEO A;  1LTS D;  2EJF C;  4M8A A;  3D6C A;  4F8M A;  5ELC A;  3HOU B;  3S17 B;  3SVM A;  4A3K B;  4G4K A;  2WAC A;  3T53 B;  5K5P A;  1G2T A;  2NYZ D;  1AFP A;  3GTK B;  1DOK A;  1ESR A;  2KJX A;  4FNF A;  1CI3 M;  1HUN A;  2E76 C;  1H9S A;  4E6I A;  2BCO A;  3FPP A;  4C1N I;  2YYZ A;  3C1F A;  1STE A;  1ENA A;  2PMZ B;  1JWM D;  1ILQ A;  1HCZ A;  5FLX E;  2F0L A;  2EYJ A;  2Q8I B;  4DA2 A;  1BBX C;  3IFT A;  4ID6 A;  4IFD I;  4BA1 I;  3GO5 A;  1STY A;  3MHB A;  2DNE A;  1STH A;  5ISR A;  4ZK9 B;  1EFI D;  3E0J A;  1A3T A;  2EYH A;  4CHT B;  3SXH A;  1SYB A;  5CMD A;  1UAP A;  4U67 3;  1CA6 A;  4DXG A;  2SNM A;  2E2H B;  1HFN A;  3ERQ A;  2F3V A;  1A3U A;  3WOE A;  2DY7 A;  1O7L A;  3X3N A;  1LT5 D;  5IIF A;  5KIX A;  2OF1 A;  1D6E C;  3FVQ A;  3VR4 A;  1OXS C;  3R8B A;  5EBC A;  3HP3 A;  2RSN A;  2N55 A;  4CKB A;  4J1M A;  5M5X B;  2K7V A;  3VR3 A;  2K32 A;  5D3I B;  4PMC A;  3IAY A;  5KRU A;  3GTP B;  5K36 H;  1XXG A;  5E4X A;  3K5N A;  1TU2 B;  1O80 A;  1LTG D;  2JE6 I;  1ONL A;  4G57 A;  1XYI A;  2A5H A;  5E1F A;  1EL0 A;  3IL8 A;  4DAP A;  4C3J G;  2KQ3 A;  1D1I A;  2E2D C;  1TT2 A;  4LJZ C;  1C48 A;  1D2B A;  1KLU D;  3N6R A;  1GUS A;  1MD2 D;  2J4X A;  3NWS A;  3LX0 A;  1PRE A;  2MUY A;  3RZD B;  1DZ1 A;  3V2T A;  1A2T A;  4GZY C;  4N9T A;  2WIN B;  1U4P A;  4QUC A;  1DD2 A;  5E4W C;  3D4R A;  5HUR A;  1LO5 D;  3K0Y A;  1JIC A;  3DEP A;  4KN4 C;  1K8M A;  4F87 A;  4KHZ A;  3E5S A;  3QB3 A;  1WCM B;  1QG7 A;  1TS5 A;  1B4O A;  3G4N A;  4ME5 A;  3K5M A;  2F0I A;  3UI2 A;  1Q8I A;  2EJG C;  3K7A B;  4B9W A;  4EQP A;  2KCN A;  4ILW A;  4RAU C;  5JAV A;  4ZLT F;  4HMI A;  3Q24 A;  1PTO B;  1J9O A;  1RKN A;  3HKZ B;  3GP7 A;  1D5M C;  1EZ8 A;  2K33 A;  3NP8 A;  2R3Z A;  1DYQ A;  3QIA A;  2B2T C;  4ZQ3 A;  3I8Z A;  4K8J A;  2TSS A;  1PMR A;  2KUM A;  2Q8T A;  2MJ8 A;  3S15 B;  2EYL A;  5C5M A;  2F0O A;  3WDN A;  2A73 B;  3S1R B;  1PFM A;  2KOL A;  1IHZ A;  2MGS A;  1RHP A;  2EVB A;  1CK1 A;  2XRS D;  3MFG A;  4DN4 M;  1AZP A;  4DK1 A;  1J8I A;  2F0P A;  3HOY B;  3L3O C;  2K01 A;  1OXV A;  1RCV D;  4BBR B;  4MIU A;  4K2K A;  1SNO A;  4BS9 A;  1JOK A;  1F9P A;  1FNV A;  1GXD C;  3JAM L;  1Z52 A;  4C3I G;  4OO1 H;  1I4Q A;  4FXD A;  1SNP A;  4PQX A;  1IYV A;  4JK1 C;  2F0T A;  4RGM A;  3PO3 B;  2O5J C;  1I4P A;  3QWN A;  1CZW A;  1I3Q B;  1CFM A;  3LNN A;  1TWA B;  1KNE A;  1RTN A;  2RDF A;  3FPU B;  3GTM B;  1Y8O B;  5IGE A;  1Z7T A;  1H9M A;  1SMY C;  1LTB D;  1U4R A;  3EA6 A;  4C3J B;  2FMC A;  4F88 A;  5J22 A;  2WKD A;  2RBM A;  1Y8N B;  2FFK B;  1B53 A;  4ZRZ A;  3W3A A;  1CTM A;  1STG A;  4TSS A;  5E3F A;  3FMC A;  3PUZ A;  2JXM B;  3H94 A;  3Q23 A;  2K05 A;  4IUR A;  5C0X H;  5JVG 3;  1HA5 A;  3T16 A;  3N52 A;  1W6J A;  2Z4I A;  2RQX A;  3J7A F;  2NN6 I;  3MC0 B;  4HMJ A;  3A7L A;  1YNJ C;  2B8G A;  3D4D A;  4S3S A;  1E0B A;  1NR2 A;  3KUP A;  3NUC A;  1IW7 C;  2G9D A;  1QNK A;  1SMY D;  4QCL A;  4XTC S;  2Q8R E;  1BNZ A;  3OSO A;  4HSP A;  3Q6S A;  1SYE A;  2L5T A;  4MHE A;  1Y8P B;  5JVH 3;  5EPJ A;  1B9N A;  5KNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...