1PTOB

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoB01
1LO5D 1CHQD 1JQYD 2G9HD 1GOZA 3OWEB 1FNWA 2IJ0A 1ESFA 4RGTA 2NTSA 1CHPD 1SE3A 3R2IA 3R8BA 1PREA 1CT1D 1XXGA 1MD2D 2RDHA 1B1ZA 2XN9C 4RFBA 3DWAA 1SE2A 1PRTF 1KLGD 1JR0D 1EWCA 3BZDB 1JWUD 1UUPA 2QILA 4RGMA 3V05A 1D5XC 1HQRD 1RCVD 1FD7D 2QEJC 3DWPA 5ELDA 1LTAD 4L6TB 3O13A 1LTSD 4RHSA 4Z9CB 1ET9A 1BCPC 5ELFA 1S5DD 1TS3A 5D3DA 3BYYB 1XTCD 1I4GA 1HA5A 1EFID 1LTGD 1SE4A 3BVZA 4TSSA 5FKAC 4RCOA 1I4QA 3G4NA 4L63B 3GP7A 1TS5A 1T5XD 4DXGA 1PTOC 1RDPD 5ELEA 1I4HA 3BVMA 1KLUD 4BWGB 4O1NA 2ICIA 1PRTD 1M4VA 1V1OA 4RGOS 3MC0B 1JCKB 1EEID 1SEBD 1LLRD 1JWMD 1LTID 1SBBB 1L0XB 3MFGA 1PTOH 5FK9C 5I4DA 1QILA 1SJHD 2TSSA 4OHJA 3W2DA 1BCPD 1D5ZC 3CHBD 1FGBD 1TS2A 1BCPB 1SJED 4C56C 2AQ1B 2XRQD 1RD9D 1LTTD 1PZID 1S5CD 1STEA 4RGNA 1LT4D 1B44D 4RH6A 1CQVA 3C0OA 1PTOB 3DWQA 5D3IB 3G4OA 1EU4A 1S5BD 1ET6A 1PZJD 1DJRD 1I4RA 1PTOD 1PZKD 1LTBD 1CK1A 1F77A 2IPKD 1TY0A 1TY2A 4UDUC 4DXFA 1PYWD 1TS4A 2O2LD 2NTTA 2CHBD 1EEFD 2AQ3B 1AN8A 1LT3D 3URYA 1ENFA 5ELBA 2R61A 3EA6A 1JWSD 1HXYD 1S5ED 3BYTB 5TSSA 2J4XA 2XNAC 1PRTB 1LTRD 2WV6D 1PTOF 1I4PA 3C0MA 1HTLD 1D5MC 1V1PB 4ZYSA 3BVGA 1I4XA 1RF2D 2Z8LA 1SXTA 4RHRA 3TSSA 3C0NA 1EU3A 1L0YB 1LT6D 3SEBA 3KLSX 1FNVA 1PRTC 2XRSD 4K6LA 1D6EC 5ELCA 1V1PA 2RDGA 1BCPF 1S5FD 1FNUA 3EFXD 1KTKA 1LT5D 1UNSA 1Z52A 3R2TA 1DYQA 2AQ2B 1AW7A 2SEBD 1BXTA 1G8ZD
chains in the Genus database with same CATH superfamily
1CHQD 5C4XH 3K81C 2YTXA 1VQBA 2K05A 5COYA 4I7AA 4A3JG 3GDEA 3R8BA 3S24A 1XWEA 2F0OA 4A3KB 3D6WA 1L0WA 5FLMG 1Y8NB 4JI5Q 5LMNL 1H9JA 3A54A 3OIPA 4RHSA 3TP8A 5M9OA 1XMQL 2EE1A 4DV1L 2A8VA 1G91A 5JAVA 4B3ML 3A8JE 1SNMA 2GVAA 1B7YB 4DXGA 4C1NI 3S15B 2PZWA 1GJXA 1MKHA 1O7LA 1ZYRD 4GLVB 4IFDG 3MC0B 1YJ9A 1HJPA 5CORA 3BJUA 3PCOB 1AEXA 1SRUA 2NZHA 1SROA 4KY6A 4G57A 2B63G 4X64Q 3CCVA 4KV6A 5KRUA 1NE3A 2JA5H 1PTOB 4IJHA 1ZKOA 4HIMA 4L5QA 5J1ZA 1NMFA 4PG3A 4FXKC 3TN2A 1CK1A 1MSHA 4YHHQ 2BE5C 5KYIA 4GOPB 1XNQQ 1TVXA 1PYWD 3VYUA 1CA5A 1SLJA 4DFAA 1TWFB 2AQ3B 1LT3D 4JI7L 2YYZA 1CQFA 2XNAC 4QJFA 2P5ZX 1IBLQ 5EPLA 5CV6A 3HOYB 2M2LA 1EZ8A 1QCBD 4HIKA 5C3EH 3T56B 3MTSA 3BVGA 4CKBA 5IY0A 3CD6A 3K5LA 3GTOB 3OWFA 2UXCL 1EU3A 1CKOA 2HQLA 4R4TA 1S40A 1E22A 1QB5D 4P75A 2E5LL 4EQNA 3VYRA 4LF4L 5ELCA 3K0YA 2PW5A 3GV3A 1XPRA 1AH9A 1FGUA 1S5FD 1AE3A 2K6AA 2F3VA 2DNCA 4MTKA 2EOTA 3C3LA 3A8KE 5G3LF 3R2TA 5IGGA 3H0GH 1Q8IA 1JJCB 2K33A 4L8JA 1JQYD 4XIGS 1VQ6A 1VQFA 1FNWA 4QB4A 4RGTA 1PVOA 2E2HB 1LYLA 2N3SA 2PZTA 2A1AA 2JA7B 2R7FA 3PMFA 4RFBA 4X62L 1T5EA 4Q5VA 1JWUD 3H6MA 3ULLA 2LXKA 5ELDA 1O78A 1B9MA 5D3DA 3RZDB 3R3OA 1NY4A 5ELEA 2F0UA 1UE5A 3CCJA 1BVSA 3I4MG 4O2DA 2XVSA 2G9DA 1EFWA 4A3GB 3I8ZA 1PRTD 4RGOS 5DNFA 4A3FB 2ZTEA 1LLRD 3VDYA 2D0OA 1QZGA 3MFGA 3K5NA 5EKLA 4HTHA 1SJHD 1NAPA 1D5ZC 4A3LG 2JA9A 1YNJC 1I6VC 2AQ1B 5BN4A 1GVPA 1SMYD 1LT4D 1NNXA 1RTNA 2E75C 5KIXA 3CCQA 3VA7A 5J3BA 4K2LA 1ICFB 2CKZB 4X3KA 1J5EL 3PF4A 4OO1H 3M4OH 5IE8A 3V96A 4JVZA 5F2DA 4JI8Q 3MWYW 5G3LD 2NVXB 1XYIA 2ZM6L 2PQEA 2O2LD 5IP9H 3UDGA 1WTWA 2X6GA 1SYEA 4ODGA 1SE8A 2LSSA 5IIFA 2B2VA 4QUCA 3HG9A 1U4MA 1HNXQ 4HR7B 1N32Q 1PTOF 4YWLA 4JI4L 5M5XB 1E2ZA 1Q3LA 5ISRA 2WAQE 2BDNA 4HIDA 3T1HQ 3RN5A 3GTKH 2F1MA 3NELA 1W6JA 4HSVA 3KLSX 2NUCA 2NVXH 1FNUA 1PYBA 1I94Q 2F0JA 5IWAQ 5AJ3Q 1IYUA 3IL8A 1KIXA 1BBUA 4JI1L 1Y69U 1STBA 1NR2A 1L1OA 4P74A 2G9HD 1KAAA 4P71A 1TWGH 3T53B 1CKNA 4JBJA 1X3QA 4JI3Q 2ALYB 3S1QB 2AKWB 1JR0D 4F87A 1RCVD 3DWPA 1LTAD 1X3EA 4HMIA 2KCMA 1S5DD 5C4XG 3S2HB 4DF7A 3TREA 4EX5A 1EWHA 2JP1A 4A3GH 1VMPA 4J8QA 1SYGA 2ENBA 2K5VA 4LUVA 2XTIA 1RDPD 3PUVA 1VQ4A 1N36L 1MGSA 1MJCA 4PV1C 4CDEC 5IYDH 3NP8A 4O1NA 1PFMA 1V1OA 3TP7A 1X32A 1YITA 3TZDA 4A3EH 4KLKA 2NN6G 4AYBB 5JPNC 3W1GA 1QILA 3GTGH 2Z4HA 3CP0A 3I70A 4BA1I 5KGUA 2NZOA 3JAML 1Y14B 3PO3G 1PZID 3BZKA 3EN2A 4DV0L 4IN3A 2SNSA 2B39A 2YU9B 1RL2A 1JICA 1O7ZA 3MXPA 3EIVA 2IY5B 1VQCA 1G6PA 1BNZA 3S2DB 2VB2X 2B2YC 2K14A 3ULJA 3PO2H 4M8AA 4BBRB 4UY8C 2I5HA 4AQYQ 1EEFD 4O0AA 5IP7H 1JMCA 1EQRA 4CDCC 5C4HA 3HS0C 4HAEA 3ONAB 4KJOA 2Z6KA 3OTOQ 3CRKC 4NXML 3S16B 1WI5A 4DK1A 3IAYA 2A69D 3UE1A 2SDFA 5E1FA 5FO8B 2MO0A 3TSSA 2JA8G 2NVQB 4WJ3M 4A4IA 2Z4IA 2IX1A 2AUJD 2CQAA 2IL8A 4YCUA 1IW7C 1FJGL 1C7YA 4IALA 2WKCA 3GTQB 3F2CA 2ID0A 3C1EA 2F3IA 1LT5D 3NQTA 4UAIA 1Q81C 1STAA 3KBGA 5KNDA 2SEBD 3KBXA 1WTOA 1GHKA 3Q24A 5GAHC 2SNMA 2IPKD 1A15A 2ZTDA 3QO2A 1R9TB 3CQZB 3M7GA 3K5OA 1Q1BA 4TKOB 1PH7A 2K4KA 4ZKBB 2UUBQ 1U4RA 4JI2L 5EQ0A 1PRTF 1KLGD 4QF4A 4K5VA 3V05A 2OF1A 4JI5L 3S15H 4ABNA 3G6EA 5J22A 4B3SL 3OW2A 2LKVA 1H9MA 2K5QA 4A3CH 1EOVA 4RCOA 1X9NA 3G4NA 3PUWA 2LMCB 3N6RA 3KLWA 1ICWA 1KHIA 5KYLA 1HTPA 1CZGA 2F4VL 2R93B 1BO0A 1VQ7A 3NWTA 1J6QA 1GUSA 2YU9H 1QE6A 4HJ9A 3S14H 4IUNA 3QB3A 1U0LA 3KF6A 2EJFC 1A3UA 1Z7TA 2BOSA 5NUCA 4H02A 3UDXA 3AEVA 2RSOA 1LM0A 2B8GA 4LUZA 3OMCA 3LWEA 1Q8KA 5D3IB 5EBDA 4DV4L 2LS01 1PZJD 2VQEL 4R4OA 4R4QA 5C5LA 4OO1I 4HEDA 1QUQB 1OTCA 1N36Q 4LFAL 3CCLA 5E4WC 3Q23A 4AQYL 5IP9G 4PMWA 3VYSA 2NVTB 4JYAL 2MJ8A 4LFBL 1CA6A 4DR2L 2OT2A 2ZJQA 3S16H 1A63A 2CWAA 2DY7A 3STBD 1PRTB 1PMRA 2XSCA 3A56A 3F8TA 1U4LA 2PYKA 4H13C 2H5XA 1BOSA 3EQLC 3EROA 2F0KA 1EQVA 4RHRA 5FJ8G 1G2TA 1VQHA 1X3FA 1A3TA 1LT6D 3V2TA 3CC2A 1XTDA 4X3UA 4HN7A 1A2TA 4C3JG 2QEXA 3S1NB 1V9PA 2GA4B 2F4IA 5LMNW 1WYDA 1DOLA 3KF8A 3OIQA 2K1BA 5CV4A 3J7AF 1OXSC 3GTMH 2R3ZA 2H1EA 1IBMQ 3QOJA 2N88A 4B9XA 3F2UA 2CW0C 2EJMA 4R4IA 2F0NA 1EY9A 2JA6G 1SE3A 4IOAA 5JJLA 2Q8RE 2YTYA 5FO7B 1EOTA 3OYYA 1B9NA 1XXGA 5D65A 2R6GA 1SE2A 4OIKA 1ILPA 4LFBQ 4B3MQ 3PIPA 2F0MA 4YCVA 3GTJB 1ET9A 4X6AH 1J5EQ 3CF5A 4DR5Q 5LMNQ 4PZ7A 3QIAA 4N8X1 3GP7A 2FFKB 2MPMA 2WINB 3I7FA 3G48A 1TWCH 4C3JB 4X66L 5DM63 3H91A 2D62A 3J7AV 3ERSX 3E3XA 4ZRZA 2J7ZA 1GUGA 3HOUB 3T4AC 4DA2A 1DGSA 4BA2I 2OWOA 2VUMH 1SR3A 2WB1G 1PTOH 2HHHL 4RA8A 1D8LA 4BY7H 3QJYA 1VQPA 4DUZQ 1VQNA 2EDGA 1BCPB 4F7XA 2QCPX 2HHHQ 1XPOA 1QUQA 4IUPA 4LFCQ 2N78A 2RA4A 1Z6HA 5AFWA 1PH1A 1YNXA 3M7NA 4P73A 2AWOA 4Y52H 2YV5A 1GXDC 3K57A 3AMUA 3K80C 1I94L 4H44C 3DHQA 4C3IG 3W1BA 1EY8A 2UUAQ 2ZTCA 2IX3A 2L12A 1MIUA 1KD1C 3BU2A 4M1UB 1HXYD 4GN4B 2PMZE 4BY1B 4A3BG 2B2UA 2WAQG 1IBKQ 1HTLD 3CW2C 2EY5A 1SXTA 4A3KH 3C1FA 5C5MA 3MXUA 2CVRA 4ZUJA 5C0XJ 4KKSA 4A3BH 3HOVG 3HOWG 2NWGA 2EYPA 1RODA 2KEEA 1WFQA 4JI6L 4LFCL 2MO1A 2R92H 3D4WA 3GTLB 3X3MA 4I7ZC 5FOBB 1AW7A 4JI2Q 3H3VC 5IGCA 1HHVA 4N9PA 4ILWA 1CKNB 1I3QH 4YY3L 3HOWH 3HOVH 3DMUA 4YHHL 1HNZL 3KLRA 2RBMA 5GQOA 2D0PA 3H3VI 2RDHA 2LFNA 3S1RH 1Y1VB 2ZT9C 1A8VA 1V8QA 5LL6X 1E2WA 3TRZA 5I6YA 4FNFA 2MNAA 3SE0A 4XYOA 2ZJPA 1HFNA 4B3TL 1HA5A 1BBWA 3OW7A 2RKSA 4UP7A 5IGEA 2Y0SG 3KDFB 5M3FG 3SVMA 1E1OA 3BVMA 1G51A 1VQIA 3NEMA 1EY5A 3HP3A 1PH3A 3WWVA 2VQEQ 1HNWL 3BDLA 3U4ZA 1H95A 1YZ6A 3VR4A 5CV7A 2E76C 1L0XB 1PA6A 4FF3A 1BCPD 5C0XI 5EKKA 5IP7G 1SNCA 2EXZA 1SN8A 1HRJA 4DK3C 4QY7A 3PO2G 4JOIA 3TS2A 1XMOQ 2RDFA 3DWQA 3TP6A 1IZ6A 2B2YA 4BY1G 4A76A 5IYCG 1EUJA 2Z6BA 4C3IH 2I46A 4OXPA 2Z6KC 4YCWA 5CMDA 1CSQA 1GKHA 4APVA 1PFBA 3DXJC 2IHFA 3M85A 1GD7A 4MZ9A 1HR0W 5IGBA 5EKIA 2VQFQ 2KA7A 4A3MB 1KDCA 4FVMA 2EIFA 1BUVT 1HCZA 3D3RA 1XNQL 4B3SQ 2IHEA 3I55A 1FL0A 3I4OA 4Y7NH 4JBKA 1JC7A 2UUCQ 3HOYG 5M3FB 2JYOA 4JW0A 1HPCA 3IFTA 1KTKA 4DV3Q 5C4XB 4A3JB 1JB7A 5T1GA 3J80c 1VQ8A 3ZYYX 1DM0B 1EY7A 4IUUA 2IJ0A 1W2BA 5L37A 4UHVA 2PPBC 1O80A 2NYZD 1D7QA 2A6HD 4XXEA 1CT1D 3J80L 1I5FA 2I07B 1B53A 1MI2A 2F03A 5C3XA 3J81L 4TVAB 3P75A 2PO4A 4DR6L 1K73C 2OEOA 4DNIA 4BXXH 4CBVA 3I4MB 2JA7H 3K5MA 3K8AA 1Q1EA 4BS9A 4DV7L 1YBYA 3D0FA 1LTID 1CSPA 1BQQT 2B8FA 1UE7A 1PXUA 2WP8J 3UI2A 3W2DA 2JA7G 5KEEA 2VL6A 3CHBD 4A3IB 5C44H 4F88A 2CH4A 4UPAA 1G291 4AYBE 2BE5D 2F0IA 2VNUD 1EIHA 2OQ0A 2RVLA 5FLXL 3MVVA 1YVCA 4RH6A 4GZYC 4DK6C 4FP5D 1EU4A 1S5BD 2Y0SB 5I9OA 1NSNS 1K3RA 4GNXC 4GOPC 4A3DH 5M3MB 3NENA 4FF1A 1W3SA 3MFYA 4A93G 4LFAQ 1XNRQ 1P16A 1AN8A 2A68C 1ENFA 4TRDA 1WCMH 1K3BC 1EZ6A 3IKJA 2BCOA 1GUOA 4ME5A 3I4NH 1I4PA 2Z1CA 4CKCA 2EYFA 1H9SA 5CV5A 3CC7A 4IOCA 4JI1Q 1VF7A 2H4OA 3OTOL 4O42A 3HOUG 2MP1A 4B9WA 4LF6L 3D31A 3EJIA 4K6LA 4DK0A 2B3GA 3D6CA 1IKMA 2WKDA 4HCEA 1IW7D 1JE5A 4EQ5A 4PMBA 2JSOA 1VF5C 2FHTA 2K52A 3NTKA 4X62Q 4KY5A 4CKEA 4LF4Q 3QR8A 3ULPA 1RHPA 3IFDA 1ESFA 3W5OA 5C3WA 1AP0A 2NTSA 1Q12A 1K0RA 3NK9A 1C4QA 1MD2D 4JPBW 2OXPA 2ZXPA 3CPWA 1X65A 3I4MH 4RGMA 4U68A 3H0GG 1Q82C 4K8JA 2N8NA 4IQZA 5JEAG 4OONA 1GM5A 4DV7Q 3GO5A 3BDCA 3SK4A 2EYMA 1Y1WG 1I50H 4KD3A 3MA2B 3I56A 4DR2Q 3E0EA 1EYDA 1CKMA 4G7ZC 3AU7A 2N55A 2NZ1D 3RN2A 5C6AA 3KF6B 4G7OC 3E6ZX 4HCSA 3HOXG 2SOBA 2XWJB 5JEAH 4G7HC 1IBLL 2B2TA 3HOZH 3KF8B 4GN5A 3RUZA 1K83H 5FK9C 1YHBA 1X55A 1A62A 3NUCA 5CYUA 3PO3H 1OO9B 5M3FH 3I90A 4RGNA 4UP8A 1YJWA 3BS1A 4B08A 4A3MG 1N34Q 3HOZG 3PV0A 4DPGA 3G4OA 2M00A 1B70B 1TWAB 2GVBA 4K8IA 2F52A 1HR0Q 5C4JH 4DGZA 2PNRC 4R9WA 3NWSA 1PTOD 2Q2UA 1LTBD 1Y8PB 4OELB 5C4ZA 1Q7YC 1JOKA 4LMQD 4G4KA 4GN3B 1Y1WH 3HOUH 1K0SA 1D1KA 1VQMA 2KUMA 4OWXB 1RIPA 2J4XA 3TMEA 1F9PA 4OEMB 5M5XH 2BA1A 2K32A 1SFOB 3SK5A 4BBSG 1R4QB 2CWPA 3MEFA 1NTGA 1V1PB 4ZYSA 5EAYA 3RNUA 3D4DA 1PH4A 1SDFA 1NBWA 1K8AC 1R4PB 2B2TC 2HDMA 3BZCA 3RZOB 1KNAA 2KEDA 1EYCA 3ER0A 3HKSA 3PUZA 5EBCA 3M4OB 3FVQA 4DAYA 3GTPB 1QWYA 1Z52A 1WD0A 1I6HH 1HR0L 1SMYC 2XWBB 1K28A 4LF5L 4ME3A 4P72A 2Q2TA 5C0XH 3F2BA 1KABA 2FINB 1TWHH 4A3JH 2AWNA 3T16A 2CW0D 3PGZA 1PREA 4EVOA 3FEWX 3KDFA 3HKZE 2PQAA 1SNOA 2JXMB 5I2XA 2WIIB 4RAUC 4A93B 1EYAA 1C9OA 1PLFA 2PW7A 3WOEA 4IJLA 1ONLA 2ES2A 2DN8A 3KLSA 3KOJA 3VR2A 2QDBA 3M3YB 4UP9A 1I50B 5FKAC 4A3CG 1LV9A 4ZCKA 2HQEA 3K6OA 4DV2Q 3OHXC 3TBIB 4NKLA 5IYBH 4K6DA 4EQPA 2PZUA 2NVTH 1U4PA 3RR5A 2AHOB 1A3VA 4DV2L 1QVFA 4NXNQ 1F2MA 4DAYB 3JC66 3U4VA 3HOVB 1U5KA 5IT9L 1M90C 4POGA 1G6ZA 3CU7A 4WORA 1RKNA 3KJPA 5LMUQ 1FGBD 4A75A 1E24A 3A74A 3AFPA 2NBFA 3OPOA 5A2QL 3Q22A 2F0HA 1VQGA 2L9HA 4MN3A 2R7ZB 2E2JB 1VQEA 1EWIA 4IPHA 1EQQA 4JI4Q 2R93H 5CV8A 2PI2A 1Q46A 3H15A 3T13A 3CCSA 2D9UA 2BA0A 1SNDA 1HA6A 1A2UA 4C2MH 2M9VA 3S17B 1LTRD 1HNXL 4C3HG 3P1HA 5JVH3 3G7LA 3DEPA 4K0KQ 1RF2D 2EY6A 3BDOA 2K28A 1R9TH 3ICEA 4QMGA 2QW7A 3SEBA 1J9OA 3STBC 3WOFA 4KHPQ 1FYCA 3SXHA 1PRTC 2XIWA 4N8FA 3S9WA 4DUZL 4JV5L 3RLNA 5HURA 4NP5A 4GLXA 2A68D 3CQZH 1I6HB 3EFXD 4HJ7A 1HZCA 4A3IG 1JORA 3U50C 4S3SA 4QL5A 2JA8H 2XGTA 1XJVA 3NTHA 1P8LA 3RLFA 5A2QE 1HNZQ 4B3RQ 3HOWB 2VUMB 2K75A 4KJNA 1JOOA 1CUKA 1FVIA 2K5DA 4LW1A 4L5SA 4R8NA 1RJTA 4OGQC 4A3EG 1HQRD 4A3FH 4U673 1PDQA 4LF9Q 2QF7A 4C3HH 1KC8C 3BYYB 3PIOA 1X6OA 2HT1A 3P7JA 1DOMA 1T5XD 1XPUA 2B2VC 4CGYB 4YIJA 1B50A 4DR1L 1M4VA 2N49A 3JAMc 1VMCA 2EYLA 3LWUA 3FDTA 2FMCA 2RQXA 4ZK9B 1SEBD 2KCTA 1JWMD 2D2CC 2HIXA 1WTRA 4HSPA 1DXMA 1E0BA 1OXTA 4DV5L 2BDOA 1NJIC 1ZEQX 2E2JH 2RCNA 1PFNA 5K36G 1TR5A 5ELOA 5IT9c 3D4RA 2DJGC 5IOCA 4PZ8A 1B3AA 4JI8L 4CHTB 2EVBA 2PQAB 4MNOA 2AUKA 1TKWB 4H0LC 3EVQA 1UEAB 1D2BA 1CTMA 1UEBA 1Y1VG 4YWMA 5C44G 3NXWA 4RKBA 4J15A 4OL7A 2F0QA 1UE6A 3BYTB 3DEOA 1WOCA 5C3EB 3KYHC 3TZUA 4EGVA 1WTXA 3LNNA 3M4YA 4FF4A 1YNJD 5JJZA 1CM9A 3GQBA 3PF5A 3UDFA 3A7AB 1B2TA 4X64L 3CRLC 2JA6B 2EPBA 2PI2E 5E3FA 4JV5Q 4ID6A 3PSIA 5IT9E 1QJOA 2F0WA 5IYBG 4LF5Q 2WACA 4LK1C 1V43A 1PH9A 1GUWA 4JYAQ 5HGTA 3T1YL 1ENAA 1C0AA 5DAUA 2L4NA 3HZXA 5K36H 1DD2A 4OWTB 3A55A 1YJNA 1EY6A 2A6HC 4K5XA 2WAQB 5CV9A 3OWEB 4FYDA 3E9IA 4LWCA 2ZXOA 4LF7Q 3SHLA 2UXBL 1B1ZA 2XN9C 2NVYB 4L5TA 4KY7A 3RZOH 1UUPA 4DV6Q 4LF9L 2GN5A 4QUFA 3GTKB 1KDBA 2EQSA 3I4NB 2KENA 1IYJB 5I6WA 4QIWB 3FP9A 2JQOA 1K8MA 4L63B 4R8IA 2OQKA 1AZPA 2Z0SA 4C3HB 2UUBL 2TMPA 2VB3X 2Y0SE 5I9PA 1XMQQ 1BDOA 1EYGA 3L7ZC 3TS0A 2CQOA 1KRSA 5LMUL 4KN7C 4IFDI 3DUZA 3WDNA 3NSWA 2JJQA 4QIWE 1SYFA 4OIJA 4JK1C 3QG1A 1SNPA 2CH4W 3S1RB 1EL0A 3GV6A 1WD1A 1KXLA 4A3GG 3CKIB 1N33Q 4A3IH 1LTTD 2MUYA 1STEA 1B44D 3C0OA 2K01A 3MHBA 1HZBA 1TU2B 2L11A 1PFSA 2EYJA 2UXDL 1MJEA 4XDXA 2R93G 1H9KA 1QNKA 1WVLA 1C8CA 3TQYA 4A3BB 4MTNA 4FDBA 4K0KL 4HMJA 3EA6A 1IXRA 2IWHA 4GOPA 2UUCL 5TSSA 5DLQE 3VR6A 1YI2A 3AB9A 2E2IH 2K5HA 4CJ2C 2Z8LA 3C0NA 1HQMC 3HOXH 4MHEA 1LUZA 4LJZC 3K59A 2ZJRA 4DR3L 3FHWA 3S1MH 4LUOA 1KRTA 3FMCA 2B2WA 2EYOA 2KCCA 2LY7A 3A7LA 1STNA 1SMXA 1NCVA 2VY3A 2K7VA 5JVG3 1AE2A 4YWKA 1WTQA 3CMEA 4PMCA 1Q90A 2B2UC 3GTOH 3LGJA 2UXDQ 4Y7NB 4DN4M 3ND8A 3R2IA 4DU9A 2JA8B 3HGBA 1TXYA 2E2IB 1MSGA 4P2CB 3C2PA 1PH6A 1TQOA 3GTQH 2A69C 3FKIB 3A5UA 1EWCA 2K5WA 2AMCB 1GUNA 2JN4A 3I72A 4NXNL 5IYCH 4BY1H 2HIVA 4H7BA 3I73A 2R92G 3TP5A 1BCPC 1F9SA 2D5DA 1XTCD 1SE4A 2DY8A 3BVZA 3FPUB 5M5YH 2OTLA 3U9SA 1O7IA 1EY4A 3HFZB 3S2HH 3MXNB 4RWSC 1SYDA 1VQLA 4JCVE 5IGDA 1O7YA 2JA5G 4BWGB 4DNTB 1WCMB 2KHJA 1TWFH 3Q8DA 1CZWA 2JA5B 1SBBB 3AQQA 3QWNA 1F9RA 4XYQA 1X54A 3F1ZA 3GD7A 3RD4A 3PO2B 2I5LX 4OHJA 4GKJQ 1TS2A 1ZXTA 5DM73 5IODA 4BY7B 4Q0FA 1TWHB 1B4OA 5E4XA 1LACA 4DV6L 1BBXC 1T9HA 4AYBG 4FF2A 3S1NH 4KK7A 1H9RA 1ET6A 3DM1A 3B6YA 3J7YW 1ENCA 3K7UC 2C35B 3J80E 3ITPA 2KHSA 1TY2A 4AH6A 1B3QA 1ZYRC 1NR4A 2L1BA 1STGA 3UE0A 5CGKA 1PH2A 2MGSA 4QQBX 1JWSD 4IPDA 4DNRB 1IHZA 4KN4C 2NN6I 5EGTA 4DUYL 2Z9HA 2C9OA 2F0GA 4KTAA 1F2YA 2KECA 2ZM6Q 3OOCA 3A0JA 4GKKQ 2KOLA 3SGIA 4JOIC 2J0TD 1VDZA 1KL9A 2MHVA 2K04A 1RTOA 4JI7Q 1SYBA 1UAPA 4ZLTF 4LF6Q 4ZUIA 2O5JC 2QKIC 4K14A 2DUDA 2F0FA 2RDGA 2FMMA 5HGQA 3GTLH 1VQAA 2R7ZG 2AQ2B 1XX8A 1X3PA 1G8ZD 1QZHA 5GAEC 1EY0A 1GOZA 1NMGA 2L5TA 4PZ6A 3M4QA 3J81j 4KI0A 3PQIA 2RSNA 1K8GA 4DR7L 5I2YA 1U9RA 3J7ZC 1FJGQ 3ND9A 4ALPA 2A5HA 3J81i 1HH2P 4POFA 5DEHA 1YHQA 3K0XA 3VA5A 1JE4A 4L6TB 4ULLA 4ZQ3A 4K2KA 1YEZA 3CCUA 1PH5A 3S14B 4TSSA 2O5IC 1DONA 1E2VA 3DM3A 2CFMA 1I4HA 4A3MH 3VR3A 1CFMA 4X3SA 2KQ3A 1E7ZA 4KHZA 2UXBQ 4JBMA 4MIUA 4PNYA 4CJ1B 1SAPA 3J7A5 4IZ8A 1SYCA 3QOLA 5GADC 1BKBA 3NTIA 3SK6A 3D8GA 3HKZB 5CBEE 2Q2HA 1CI3M 2WB1B 3GTPH 1STHA 1EIYB 3NPPA 2OTJA 1I4RA 1PZKD 2B29A 2PCFB 1D1IA 1F77A 3C46A 3Q6SA 1DZ1A 4DV0Q 1K83B 2NB0A 2JA6H 5BN3A 2JK8A 5J39A 1VQJA 3E0JA 1GUTA 3AYHB 3VYTA 1L1OB 2KBNA 2ICEC 2G5DA 2O4XA 4BBRG 4CDFC 5BR8L 4DV4Q 1XNRL 3KJOA 2HD3A 2OCEA 4KHPL 3MEHA 4A93H 2VXWA 5H1SE 4JBWA 5M5YB 4A3DG 2IX0A 1ILQA 1L0YB 1KNEA 2QGQA 5JOBA 3CXCA 1Y1VH 3L9AX 5GAGC 4R4CA 4BBRH 4GNXA 4NXMQ 1TWGB 2E74C 1QVGA 5FLMH 4B3RL 2VQFL 2V1CC 2A6ED 1L1OC 2DGYA 1YNNC 1AZQA 3PIP3 1TT2A 2K03A 3JAME 4OO1G 1UNSA 2RHQB 2VW9A 2IW3A 5C44B 4DAVA 4IO9A 3T1HL 4N9TA 1S4ZA 5KNBA 1BXTA 2EZVA 4IPGA 1QG7A 3FKIG 4DR3Q 1ASZA 1B8AA 4L5RC 3T51B 1W6KA 3UDIA 1E3PA 4GS3A 2F0EA 3S1MB 5M5WH 2I0QA 1IL2A 4JI0Q 4V0BA 4NDXA 4GKKL 1FD7D 3PUYA 3HOXB 3HKZG 3O13A 1LTSD 4JI0L 1TS3A 4C1NK 1HUNA 1I4QA 3R93A 1IBKL 2FXQA 1PV4A 5JPMC 3NE5B 1ML0D 5C0XG 1IL8A 3IRBA 5FO9B 1HZ9A 1M1KC 4C2MB 4EQOA 1JB3A 1EIGA 4WRDA 2HDLA 4GKJL 4JC0A 4LF8L 3A8IE 3PUXA 1JCKB 1X56A 4K5WA 2JEBI 5E7NA 4X65L 1YNND 3J81c 1N33L 4XQJA 1QOHA 1TWAH 3OSOA 3SR1A 1N34L 1YHAA 3TEHB 1N9WA 4NMZA 3U58A 4C56C 1SJED 4A3LH 3MAQA 1RD9D 3CAMA 2K5NA 3NBHB 1S5CD 3I3CA 4OWWB 5ELNA 4DR4L 2EY2A 2RHSB 1SSOA 1LABA 1VCIA 4IPCA 3G4SA 4DR5L 1TY0A 1UE1A 1KDAA 4IUTA 4UDUC 3KUPA 5FLXc 2NTTA 3I4LA 2NVQH 3HRZC 2CHBD 3NBIA 2YTVA 2DNEA 4AIMA 2R61A 1PH8A 3GTJH 4WJ4A 1LTLA 3G6JB 2Q8TA 4C3JH 5BR8Q 4CJ0B 2NN6H 3MZ5A 5D14A 2FJ2A 1EQTA 1D5MC 2F0TA 2L0CA 2KJXA 3RMHA 1J8IA 4I65A 1BF4A 1X3GA 5M5WB 2B2WC 3T1YQ 1FNVA 5EPJA 2XRSD 2F4VQ 1D6EC 4RCNA 5M3MG 1OXUA 4DV1Q 2F0LA 4RG1A 4TQUS 1ESRA 2L55A 3I4NG 1F2LA 1PYSB 1VQOA 5C4JB 3JAMi 3GTMB 1L2FA 1LO5D 3ERQA 4FXGC 4HJAA 4WJWA 4KKTA 4QGUA 1BR9A 3MXNA 3CCRA 2MQHA 3DWAA 1TIID 1SFOH 3BZDB 4DAMA 4FO2A 2QEJC 3VR5A 3CPFA 4HJ5A 4OX9L 5K5PA 3K7AH 5ELFA 4Z9CB 4IFDH 4KMUC 4LNQA 1ASYA 1EFID 2MFIA 4J6HA 3RLOA 4XQQA 3CC4A 4PQXA 1SNQA 3KK7A 1TS5A 4RMFA 2KHIA 5LL6S 4CDDC 3U9OA 2A74C 1HNWQ 4F8MA 5BN5A 3L2PA 1KAWA 2HUGA 2ICIA 1WCMG 3RZDH 1A6XA 4GLAC 1WTHA 3EBEA 5KNCA 4IFDJ 2WFWA 1OXXK 1EEID 3SK8A 4E6IA 1JT8A 4X66Q 3H94A 3I2ZA 5CBAE 4YY3Q 1IKLA 2R7DA 2TSSA 1Z9FA 2ZXRA 3FKIH 4R1JA 3PO3B 2R92B 2Q8IB 4DKAC 3HOZB 1I3QB 1CQVA 4DR1Q 3GTGB 4DUYQ 2F3WA 4LF8Q 5EPKA 4QCLA 3FRPB 4X3TA 2PNHA 1VQ5A 2BH2A 3P20A 1AFPA 1HUMA 3M4PA 2RF4A 2VZAA 2LXJA 4DXFA 4DR6Q 3S17H 1IBML 3J81E 1HFGA 1STYA 2UU9L 4A3KG 4JI6Q 3URYA 5ELBA 2F0VA 5JJKA 1GO3E 2HCIA 1VQDA 3AFQA 2I5MX 1EIFA 5T1IA 5IGFA 5JEAJ 1WTVA 3C0MA 2E5LQ 4ZKCB 4BY7G 1Y1WB 3SDZA 3MXGA 1QVCA 2KVMA 3H09A 1M8AA 3HEJA 1Q86C 1JOQA 3NBHA 1DOKA 5GROA 2EYHA 1Y8OB 2ATWA 1XMOL 3J80i 2HCCA 3H0GB 3K58A 4BBSB 4LF7L 1BCPF 1N8RC 5JJIA 2UXCQ 4A3DB 2E2DC 2EJGC 4ZAIA 2B63B 2KCNA 3CCMA 1DYQA 3CMAA 1VS0A 4IUQA 5CR3A 4NPSA 2RCFA 4A3EB 1JJGA 4JG2A 3A5ZB 1K9MC 1CHPD 2A6EC 2JE6I 5EJWA 4B3TQ 4BXXG 4DR7Q 1MHWC 1TWCB 1OXVA 3L0OA 2QA4A 2VUMG 3HOYH 4J1MA 2QILA 3X3NA 4BBSH 1D5XC 2DJFC 4WFN3 4OX9Q 3N52A 4XTCS 3M3YH 1K8OA 3NQIA 1I4GA 4DAPA 1LTGD 3K7AB 3DLLA 1HZAA 3CCEA 1Z47A 1PTOC 1VQ9A 4V190 2JEAI 4FXDA 3S2DH 3ZJYC 1WTPA 1KLUD 3FPPA 2F0DA 1A0IA 3BG3A 4NB3A 2K50A 4RKLA 5IWAL 5AJ3L 4LAAA 1S3OA 2WB1E 2QDLA 3I91A 4KD4A 5M3MH 5I4DA 3E5SA 2A73B 2NVYH 2E2HH 2R7ZH 2CCZA 2XRQD 1FR3A 2VS1A 1GHJA 2C5CA 2UU9Q 2V4DA 1N32L 2L15A 4NW2A 3PIO3 1QNUA 2F0PA 4DV5Q 1NUCA 4A3FG 2E8GA 2F0SA 4HIOA 1DJRD 3M9BA 1F2ZA 3LX0A 1V1QA 1KQSA 1JJ2A 1TS4A 2UUAL 5LHY1 2ASBA 5CC4A 1WJJA 2X69A 4KHVA 5IYDG 4DV3L 1YIJA 2A19A 1S5ED 1S72A 2EY1A 1VQKA 1PHJA 4XQNA 1DCZA 4XT3B 2EXDA 2WV6D 2IT1A 3OMGA 4KKUA 1II3A 1I4XA 3KFUA 4XT1B 4DR4Q 4HJ8A 2Q2IA 1C48A 4JI3L 1E1TA 4GNXB 5HY6A 3W3AA 3Q0AA 4IUVA 3H3VH 2PMZB 3G71A 2BH8A 3TDQA 3S1QH 1MBYA 3L3OC 1UWVA 2X6LA 1V1PA 4C3IB 5C3EG 1H9SB 3E9HA 3NHHA 1IYVA 3F2DA 2B63H 5FJ8H 1F9QA 1G2SA 5FLXE 5A35A 4X65Q 4IURA
chains in the Genus database with same CATH topology
1CHQD 2K05A 5COYA 3R8BA 1XWEA 2F0OA 4A3KB 3D6WA 1Y8NB 1H9JA 3A54A 3OIPA 4RHSA 3TP8A 5M9OA 2EE1A 1G91A 5JAVA 3A8JE 1SNMA 4DXGA 4C1NI 3S15B 2PZWA 1GJXA 1O7LA 1ZYRD 4IFDG 3MC0B 5CORA 1AEXA 4KY6A 4G57A 4KV6A 5KRUA 1PTOB 1ZKOA 5J1ZA 3TN2A 4FXKC 1CK1A 1MSHA 2BE5C 5KYIA 1TVXA 1PYWD 3VYUA 1CA5A 4DFAA 1TWFB 2AQ3B 1LT3D 2YYZA 1CQFA 2XNAC 5EPLA 5CV6A 3HOYB 2M2LA 1EZ8A 1QCBD 3T56B 3MTSA 3BVGA 4CKBA 3K5LA 3GTOB 3OWFA 1EU3A 1QB5D 4EQNA 3VYRA 5ELCA 3K0YA 2PW5A 3GV3A 1S5FD 2K6AA 2F3VA 2DNCA 2EOTA 3C3LA 3A8KE 5G3LF 3R2TA 5IGGA 1Q8IA 2K33A 4L8JA 1JQYD 4XIGS 1FNWA 4QB4A 4RGTA 2E2HB 2PZTA 2JA7B 3PMFA 4RFBA 1T5EA 4Q5VA 1JWUD 3H6MA 5ELDA 1O78A 1B9MA 5D3DA 3RZDB 3R3OA 5ELEA 2F0UA 2XVSA 2G9DA 4A3GB 3I8ZA 1PRTD 4RGOS 5DNFA 4A3FB 1LLRD 3MFGA 3K5NA 5EKLA 4HTHA 1SJHD 1NAPA 1D5ZC 1YNJC 1I6VC 2AQ1B 5BN4A 1SMYD 1LT4D 1RTNA 2E75C 5KIXA 3VA7A 4K2LA 4X3KA 4OO1H 3V96A 5F2DA 3MWYW 5G3LD 2NVXB 1XYIA 2PQEA 2O2LD 1WTWA 2X6GA 1SYEA 4ODGA 5IIFA 2B2VA 4QUCA 3HG9A 1U4MA 4HR7B 1PTOF 5M5XB 1E2ZA 1Q3LA 5ISRA 2BDNA 2F1MA 1W6JA 4HSVA 3KLSX 2NUCA 1FNUA 2F0JA 1IYUA 3IL8A 1Y69U 1STBA 1NR2A 2G9HD 1KAAA 3T53B 1X3QA 3S1QB 1JR0D 4F87A 1RCVD 3DWPA 1LTAD 4HMIA 1S5DD 3S2HB 4DF7A 1EWHA 2JP1A 1VMPA 4J8QA 1SYGA 2ENBA 3PUVA 1RDPD 1MGSA 4PV1C 3NP8A 4O1NA 1PFMA 1V1OA 3TP7A 1X32A 3TZDA 4AYBB 2NN6G 5JPNC 1QILA 2Z4HA 3I70A 4BA1I 5KGUA 3JAML 1PZID 4IN3A 2SNSA 2B39A 2YU9B 1JICA 1O7ZA 3MXPA 1BNZA 3S2DB 2VB2X 2B2YC 4M8AA 4BBRB 1EEFD 5C4HA 3HS0C 4HAEA 3ONAB 4KJOA 3CRKC 3S16B 4DK1A 3IAYA 2A69D 2SDFA 5E1FA 5FO8B 3TSSA 2NVQB 2Z4IA 2IX1A 2AUJD 2CQAA 2IL8A 1IW7C 4IALA 2WKCA 3GTQB 2ID0A 3C1EA 1LT5D 3NQTA 4UAIA 1STAA 3KBGA 5KNDA 2SEBD 3KBXA 1WTOA 1GHKA 3Q24A 2SNMA 2IPKD 1A15A 3QO2A 1R9TB 3CQZB 3M7GA 3K5OA 1Q1BA 4TKOB 4ZKBB 1U4RA 5EQ0A 1PRTF 4QF4A 1KLGD 4K5VA 3V05A 2OF1A 4ABNA 5J22A 2LKVA 1H9MA 2K5QA 4RCOA 3G4NA 3PUWA 2LMCB 3N6RA 1ICWA 5KYLA 1HTPA 1CZGA 2R93B 1BO0A 3NWTA 1GUSA 1QE6A 4IUNA 3QB3A 2EJFC 1A3UA 1Z7TA 2BOSA 5NUCA 2RSOA 2B8GA 3OMCA 3LWEA 5D3IB 5EBDA 2LS01 1PZJD 5C5LA 4OO1I 4HEDA 5E4WC 3Q23A 4PMWA 3VYSA 2NVTB 2MJ8A 1CA6A 2OT2A 2DY7A 1PRTB 1PMRA 2XSCA 3A56A 1U4LA 2PYKA 4H13C 1BOSA 3EQLC 3EROA 2F0KA 1EQVA 4RHRA 1G2TA 1A3TA 1LT6D 3V2TA 4X3UA 4HN7A 1A2TA 4C3JG 3S1NB 2GA4B 2F4IA 1DOLA 3KF8A 3OIQA 2K1BA 5CV4A 3J7AF 1OXSC 2R3ZA 2H1EA 3QOJA 2N88A 4B9XA 3F2UA 2CW0C 2EJMA 2F0NA 1EY9A 1SE3A 2Q8RE 5FO7B 1EOTA 1B9NA 1XXGA 5D65A 2R6GA 1SE2A 4OIKA 1ILPA 2F0MA 3GTJB 1ET9A 3QIAA 3GP7A 2FFKB 2MPMA 2WINB 4C3JB 5DM63 3H91A 2D62A 3J7AV 4ZRZA 2J7ZA 1GUGA 3HOUB 3T4AC 4DA2A 4BA2I 1PTOH 4RA8A 3QJYA 2EDGA 1BCPB 4F7XA 2QCPX 4IUPA 2RA4A 1Z6HA 5AFWA 3M7NA 2AWOA 1GXDC 3K57A 3AMUA 4H44C 3DHQA 4C3IG 1EY8A 2IX3A 2L12A 4M1UB 1HXYD 4BY1B 2B2UA 1HTLD 2EY5A 1SXTA 3C1FA 5C5MA 3MXUA 2CVRA 4ZUJA 5C0XJ 4KKSA 2NWGA 2EYPA 1RODA 2KEEA 3D4WA 3GTLB 3X3MA 4I7ZC 5FOBB 1AW7A 3H3VC 5IGCA 1HHVA 4N9PA 4ILWA 3DMUA 3KLRA 2RBMA 2RDHA 2LFNA 1Y1VB 2ZT9C 1V8QA 5LL6X 1E2WA 5I6YA 4FNFA 3SE0A 4XYOA 1HFNA 1HA5A 3OW7A 2RKSA 5IGEA 3SVMA 3BVMA 1EY5A 3HP3A 3BDLA 3VR4A 5CV7A 2E76C 1L0XB 4FF3A 1BCPD 5C0XI 5EKKA 1SNCA 2EXZA 1HRJA 2RDFA 3DWQA 3TP6A 2B2YA 2I46A 5CMDA 1PFBA 3DXJC 3M85A 5IGBA 5EKIA 2KA7A 4A3MB 1KDCA 4FVMA 1BUVT 1HCZA 3D3RA 1JC7A 5M3FB 2JYOA 1HPCA 3IFTA 1KTKA 5C4XB 4A3JB 5T1GA 3ZYYX 1DM0B 1EY7A 4IUUA 2IJ0A 2PPBC 1O80A 2NYZD 2A6HD 4XXEA 1CT1D 3J80L 2I07B 1B53A 1MI2A 2F03A 5C3XA 3J81L 3P75A 2PO4A 2OEOA 4CBVA 3I4MB 3K5MA 1Q1EA 4BS9A 1LTID 1BQQT 2B8FA 1PXUA 2WP8J 3UI2A 3W2DA 5KEEA 3CHBD 4A3IB 4F88A 1G291 2BE5D 2F0IA 2VNUD 1EIHA 2RVLA 5FLXL 3MVVA 4RH6A 4GZYC 4FP5D 5I9OA 1EU4A 1S5BD 2Y0SB 1NSNS 5M3MB 4FF1A 3MFYA 1AN8A 2A68C 1ENFA 4TRDA 1EZ6A 3IKJA 2BCOA 1GUOA 4ME5A 1I4PA 2Z1CA 4CKCA 2EYFA 1H9SA 5CV5A 1VF7A 2H4OA 4O42A 2MP1A 4B9WA 3D31A 3EJIA 4K6LA 4DK0A 3D6CA 1IKMA 2WKDA 4HCEA 1IW7D 4PMBA 2JSOA 1VF5C 2FHTA 3NTKA 4KY5A 4CKEA 1RHPA 3IFDA 1ESFA 5C3WA 1AP0A 2NTSA 1Q12A 3NK9A 1C4QA 1MD2D 2OXPA 2ZXPA 4RGMA 4U68A 4K8JA 4IQZA 5JEAG 3GO5A 3BDCA 3SK4A 2EYMA 4KD3A 3MA2B 1EYDA 4G7ZC 3AU7A 2N55A 2NZ1D 5C6AA 4G7OC 3E6ZX 4HCSA 2SOBA 4G7HC 5JEAH 2XWJB 2B2TA 3RUZA 5FK9C 3NUCA 5CYUA 1OO9B 3I90A 4RGNA 3BS1A 4B08A 3PV0A 3G4OA 2M00A 4K8IA 1TWAB 4DGZA 2PNRC 4R9WA 3NWSA 1PTOD 1LTBD 1Y8PB 5C4ZA 1JOKA 4LMQD 4G4KA 1D1KA 2KUMA 2J4XA 3TMEA 1F9PA 2BA1A 2K32A 1SFOB 3SK5A 1R4QB 1V1PB 4ZYSA 3D4DA 1SDFA 1R4PB 2B2TC 2HDMA 3RZOB 1KNAA 2KEDA 1EYCA 3PUZA 5EBCA 3M4OB 3FVQA 4DAYA 3GTPB 1QWYA 1Z52A 1WD0A 1SMYC 2XWBB 5C0XH 1KABA 2FINB 2AWNA 3T16A 2CW0D 1PREA 4EVOA 3FEWX 1SNOA 2JXMB 5I2XA 2WIIB 4RAUC 4A93B 1EYAA 1PLFA 2PW7A 3WOEA 1ONLA 2DN8A 3KLSA 3VR2A 2QDBA 3M3YB 1I50B 5FKAC 1LV9A 2HQEA 3K6OA 3OHXC 3TBIB 4NKLA 4K6DA 4EQPA 2PZUA 1U4PA 1A3VA 1F2MA 3HOVB 5IT9L 1G6ZA 3CU7A 4WORA 1RKNA 1FGBD 2NBFA 3OPOA 5A2QL 3Q22A 2F0HA 2L9HA 4MN3A 2R7ZB 2E2JB 5CV8A 3T13A 2D9UA 2BA0A 1SNDA 1HA6A 1A2UA 2M9VA 3S17B 1LTRD 4C3HG 3P1HA 5JVH3 3G7LA 3DEPA 1RF2D 2EY6A 3BDOA 2K28A 4QMGA 3SEBA 1J9OA 3WOFA 1FYCA 3SXHA 1PRTC 2XIWA 3S9WA 5HURA 4NP5A 2A68D 1I6HB 3EFXD 1JORA 4S3SA 3NTHA 3RLFA 5A2QE 3HOWB 2VUMB 4KJNA 1JOOA 2K5DA 4R8NA 1RJTA 4OGQC 1HQRD 4U673 1PDQA 2QF7A 3BYYB 3P7JA 1DOMA 1T5XD 2B2VC 4CGYB 4YIJA 1B50A 1M4VA 1VMCA 2EYLA 3LWUA 3FDTA 2FMCA 2RQXA 4ZK9B 1SEBD 1JWMD 2D2CC 1WTRA 4HSPA 1DXMA 1E0BA 1OXTA 2BDOA 1ZEQX 1PFNA 5K36G 1TR5A 3D4RA 5IOCA 1B3AA 4CHTB 2EVBA 2AUKA 1TKWB 4H0LC 3EVQA 1UEAB 1D2BA 1CTMA 3NXWA 4RKBA 4OL7A 2F0QA 3DEOA 3BYTB 5C3EB 3TZUA 4EGVA 4FF4A 3LNNA 3M4YA 1WTXA 1YNJD 5JJZA 1CM9A 3GQBA 3A7AB 1B2TA 3CRLC 2JA6B 2EPBA 5E3FA 4ID6A 5IT9E 1QJOA 2F0WA 2WACA 4LK1C 1V43A 1GUWA 5HGTA 1ENAA 5DAUA 2L4NA 3HZXA 5K36H 1DD2A 3A55A 1EY6A 2A6HC 4K5XA 2WAQB 5CV9A 3OWEB 4FYDA 2ZXOA 3SHLA 1B1ZA 2XN9C 2NVYB 4KY7A 1UUPA 4QUFA 3GTKB 1KDBA 3I4NB 5I6WA 4QIWB 1K8MA 4L63B 4R8IA 1AZPA 4C3HB 2TMPA 2VB3X 5I9PA 1BDOA 3L7ZC 4KN7C 4IFDI 3DUZA 3WDNA 3NSWA 1SYFA 4OIJA 4JK1C 3QG1A 1SNPA 3S1RB 1EL0A 3GV6A 1WD1A 3CKIB 1LTTD 2MUYA 1STEA 1B44D 3C0OA 2K01A 3MHBA 1TU2B 2L11A 2EYJA 4XDXA 1H9KA 1QNKA 1WVLA 1C8CA 4A3BB 4HMJA 3EA6A 2IWHA 5TSSA 3VR6A 3AB9A 4CJ2C 2Z8LA 3C0NA 1HQMC 4MHEA 4LJZC 3K59A 3FMCA 2B2WA 2EYOA 2KCCA 2LY7A 3A7LA 1STNA 1NCVA 2K7VA 5JVG3 1WTQA 4PMCA 1Q90A 2B2UC 4Y7NB 4DN4M 3ND8A 3R2IA 4DU9A 2JA8B 3HGBA 2E2IB 1MSGA 4P2CB 3C2PA 1TQOA 2A69C 3FKIB 1EWCA 2K5WA 1GUNA 3I72A 4H7BA 3I73A 3TP5A 1BCPC 1F9SA 2D5DA 1XTCD 1SE4A 2DY8A 3BVZA 3FPUB 3U9SA 1EY4A 4RWSC 1SYDA 5IGDA 1O7YA 4BWGB 4DNTB 1WCMB 1CZWA 2JA5B 1SBBB 3QWNA 1F9RA 4XYQA 3RD4A 3GD7A 3PO2B 4OHJA 1TS2A 1ZXTA 5DM73 5IODA 4BY7B 4Q0FA 1TWHB 1B4OA 5E4XA 1LACA 1BBXC 4FF2A 4KK7A 1H9RA 3J7YW 1ET6A 3DM1A 1ENCA 3J80E 3ITPA 2KHSA 1TY2A 1ZYRC 1NR4A 2L1BA 1STGA 5CGKA 2MGSA 1JWSD 4DNRB 1IHZA 4KN4C 2NN6I 5EGTA 2C9OA 2F0GA 2KECA 4KTAA 1F2YA 3OOCA 2KOLA 2J0TD 1VDZA 2MHVA 2K04A 1RTOA 1SYBA 1UAPA 4ZLTF 4ZUIA 2O5JC 2QKIC 4K14A 2F0FA 2RDGA 2FMMA 2AQ2B 1XX8A 1X3PA 1G8ZD 1EY0A 1GOZA 2L5TA 4KI0A 2RSNA 5I2YA 1U9RA 3ND9A 2A5HA 5DEHA 3VA5A 1JE4A 4L6TB 4ULLA 4ZQ3A 4K2KA 3S14B 4TSSA 2O5IC 1DONA 1E2VA 1I4HA 3VR3A 1CFMA 4X3SA 2KQ3A 4KHZA 4MIUA 4PNYA 4CJ1B 1SAPA 4IZ8A 1SYCA 3QOLA 3NTIA 3SK6A 3D8GA 3HKZB 5CBEE 1CI3M 2WB1B 1STHA 3NPPA 1I4RA 1PZKD 2PCFB 1D1IA 1F77A 3C46A 3Q6SA 1DZ1A 1K83B 2NB0A 5BN3A 5J39A 3E0JA 1GUTA 3VYTA 2ICEC 2O4XA 3MEHA 2VXWA 4JBWA 5M5YB 2IX0A 1ILQA 1L0YB 1KNEA 5JOBA 3L9AX 1TWGB 2E74C 2A6ED 1YNNC 1AZQA 3PIP3 1TT2A 2K03A 3JAME 4OO1G 1UNSA 2IW3A 5C44B 4DAVA 4N9TA 1S4ZA 5KNBA 1BXTA 2EZVA 1QG7A 3T51B 1W6KA 2F0EA 3S1MB 4V0BA 4NDXA 1FD7D 3PUYA 3HOXB 3O13A 1LTSD 1TS3A 4C1NK 1HUNA 1I4QA 3R93A 5JPMC 3NE5B 1ML0D 5C0XG 1IL8A 5FO9B 4C2MB 4EQOA 1JB3A 1EIGA 4WRDA 2HDLA 3A8IE 3PUXA 1JCKB 4K5WA 2JEBI 1YNND 4XQJA 1QOHA 3OSOA 3SR1A 4NMZA 4C56C 1SJED 3MAQA 1RD9D 1S5CD 3I3CA 2EY2A 1SSOA 1LABA 1VCIA 1TY0A 1KDAA 4IUTA 4UDUC 3KUPA 2NTTA 3I4LA 3HRZC 2CHBD 3NBIA 2DNEA 2R61A 3G6JB 2Q8TA 4CJ0B 2NN6H 5D14A 3MZ5A 2FJ2A 1EQTA 1D5MC 2F0TA 2L0CA 2KJXA 3RMHA 1J8IA 4I65A 1BF4A 5M5WB 2B2WC 1FNVA 5EPJA 2XRSD 1D6EC 4RCNA 1OXUA 2F0LA 4TQUS 1ESRA 2L55A 1F2LA 5C4JB 3GTMB 1LO5D 3ERQA 4FXGC 4WJWA 4KKTA 1BR9A 3MXNA 3DWAA 1TIID 3BZDB 4FO2A 2QEJC 3VR5A 5K5PA 5ELFA 4Z9CB 4IFDH 4KMUC 1EFID 4J6HA 4XQQA 4PQXA 1SNQA 3KK7A 1TS5A 5LL6S 3U9OA 2A74C 4F8MA 5BN5A 2HUGA 2ICIA 1A6XA 4IFDJ 5KNCA 1OXXK 1EEID 3SK8A 4E6IA 3H94A 5CBAE 1IKLA 2TSSA 2ZXRA 3PO3B 2R92B 2Q8IB 3HOZB 1I3QB 1CQVA 3GTGB 2F3WA 4QCLA 5EPKA 3FRPB 4X3TA 3P20A 1AFPA 1HUMA 4DXFA 3J81E 1HFGA 1STYA 3URYA 5ELBA 2F0VA 2HCIA 5T1IA 5IGFA 5JEAJ 1WTVA 3C0MA 4ZKCB 1Y1WB 3SDZA 3MXGA 2KVMA 3H09A 1M8AA 3HEJA 1JOQA 3NBHA 1DOKA 2EYHA 1Y8OB 2HCCA 3H0GB 3K58A 4BBSB 1BCPF 4A3DB 2E2DC 2EJGC 4ZAIA 2B63B 2KCNA 1DYQA 4IUQA 5CR3A 4A3EB 1CHPD 2A6EC 2JE6I 5EJWA 1TWCB 1OXVA 4J1MA 2QILA 3X3NA 1D5XC 4WFN3 3N52A 4XTCS 1K8OA 3NQIA 4DAPA 1I4GA 1LTGD 3K7AB 1Z47A 1PTOC 4V190 2JEAI 4FXDA 1WTPA 1KLUD 3FPPA 2F0DA 3BG3A 4RKLA 4LAAA 3I91A 4KD4A 5I4DA 3E5SA 2A73B 2XRQD 1FR3A 1GHJA 2C5CA 2V4DA 4NW2A 3PIO3 1QNUA 2F0PA 1NUCA 2F0SA 1DJRD 1F2ZA 3LX0A 1TS4A 5LHY1 5CC4A 2X69A 4KHVA 1S5ED 2EY1A 4XQNA 1DCZA 4XT3B 2WV6D 2IT1A 3OMGA 4KKUA 1II3A 1I4XA 4XT1B 1C48A 3W3AA 3Q0AA 4IUVA 2PMZB 3TDQA 1MBYA 3L3OC 2X6LA 1V1PA 4C3IB 1H9SB 3NHHA 1IYVA 1F9QA 1G2SA 5FLXE 5A35A 4IURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LO5 D;  1CHQ D;  1JQY D;  2G9H D;  1GOZ A;  3OWE B;  1FNW A;  2IJ0 A;  1ESF A;  4RGT A;  2NTS A;  1CHP D;  1SE3 A;  3R2I A;  3R8B A;  1PRE A;  1CT1 D;  1XXG A;  1MD2 D;  2RDH A;  1B1Z A;  2XN9 C;  4RFB A;  3DWA A;  1SE2 A;  1PRT F;  1KLG D;  1JR0 D;  1EWC A;  3BZD B;  1JWU D;  1UUP A;  2QIL A;  4RGM A;  3V05 A;  1D5X C;  1HQR D;  1RCV D;  1FD7 D;  2QEJ C;  3DWP A;  5ELD A;  1LTA D;  4L6T B;  3O13 A;  1LTS D;  4RHS A;  4Z9C B;  1ET9 A;  1BCP C;  5ELF A;  1S5D D;  1TS3 A;  5D3D A;  3BYY B;  1XTC D;  1I4G A;  1HA5 A;  1EFI D;  1LTG D;  1SE4 A;  3BVZ A;  4TSS A;  5FKA C;  4RCO A;  1I4Q A;  3G4N A;  4L63 B;  3GP7 A;  1TS5 A;  1T5X D;  4DXG A;  1PTO C;  1RDP D;  5ELE A;  1I4H A;  3BVM A;  1KLU D;  4BWG B;  4O1N A;  2ICI A;  1PRT D;  1M4V A;  1V1O A;  4RGO S;  3MC0 B;  1JCK B;  1EEI D;  1SEB D;  1LLR D;  1JWM D;  1LTI D;  1SBB B;  1L0X B;  3MFG A;  1PTO H;  5FK9 C;  5I4D A;  1QIL A;  1SJH D;  2TSS A;  4OHJ A;  3W2D A;  1BCP D;  1D5Z C;  3CHB D;  1FGB D;  1TS2 A;  1BCP B;  1SJE D;  4C56 C;  2AQ1 B;  2XRQ D;  1RD9 D;  1LTT D;  1PZI D;  1S5C D;  1STE A;  4RGN A;  1LT4 D;  1B44 D;  4RH6 A;  1CQV A;  3C0O A;  1PTO B;  3DWQ A;  5D3I B;  3G4O A;  1EU4 A;  1S5B D;  1ET6 A;  1PZJ D;  1DJR D;  1I4R A;  1PTO D;  1PZK D;  1LTB D;  1CK1 A;  1F77 A;  2IPK D;  1TY0 A;  1TY2 A;  4UDU C;  4DXF A;  1PYW D;  1TS4 A;  2O2L D;  2NTT A;  2CHB D;  1EEF D;  2AQ3 B;  1AN8 A;  1LT3 D;  3URY A;  1ENF A;  5ELB A;  2R61 A;  3EA6 A;  1JWS D;  1HXY D;  1S5E D;  3BYT B;  5TSS A;  2J4X A;  2XNA C;  1PRT B;  1LTR D;  2WV6 D;  1PTO F;  1I4P A;  3C0M A;  1HTL D;  1D5M C;  1V1P B;  4ZYS A;  3BVG A;  1I4X A;  1RF2 D;  2Z8L A;  1SXT A;  4RHR A;  3TSS A;  3C0N A;  1EU3 A;  1L0Y B;  1LT6 D;  3SEB A;  3KLS X;  1FNV A;  1PRT C;  2XRS D;  4K6L A;  1D6E C;  5ELC A;  1V1P A;  2RDG A;  1BCP F;  1S5F D;  1FNU A;  3EFX D;  1KTK A;  1LT5 D;  1UNS A;  1Z52 A;  3R2T A;  1DYQ A;  2AQ2 B;  1AW7 A;  2SEB D;  1BXT A;  1G8Z D; 
#chains in the Genus database with same CATH topology
 1CHQ D;  5C4X H;  3K81 C;  2YTX A;  1VQB A;  2K05 A;  5COY A;  4I7A A;  4A3J G;  3GDE A;  3R8B A;  3S24 A;  1XWE A;  2F0O A;  4A3K B;  3D6W A;  1L0W A;  5FLM G;  1Y8N B;  4JI5 Q;  5LMN L;  1H9J A;  3A54 A;  3OIP A;  4RHS A;  3TP8 A;  5M9O A;  1XMQ L;  2EE1 A;  4DV1 L;  2A8V A;  1G91 A;  5JAV A;  4B3M L;  3A8J E;  1SNM A;  2GVA A;  1B7Y B;  4DXG A;  4C1N I;  3S15 B;  2PZW A;  1GJX A;  1MKH A;  1O7L A;  1ZYR D;  4GLV B;  4IFD G;  3MC0 B;  1YJ9 A;  1HJP A;  5COR A;  3BJU A;  3PCO B;  1AEX A;  1SRU A;  2NZH A;  1SRO A;  4KY6 A;  4G57 A;  2B63 G;  4X64 Q;  3CCV A;  4KV6 A;  5KRU A;  1NE3 A;  2JA5 H;  1PTO B;  4IJH A;  1ZKO A;  4HIM A;  4L5Q A;  5J1Z A;  1NMF A;  4PG3 A;  4FXK C;  3TN2 A;  1CK1 A;  1MSH A;  4YHH Q;  2BE5 C;  5KYI A;  4GOP B;  1XNQ Q;  1TVX A;  1PYW D;  3VYU A;  1CA5 A;  1SLJ A;  4DFA A;  1TWF B;  2AQ3 B;  1LT3 D;  4JI7 L;  2YYZ A;  1CQF A;  2XNA C;  4QJF A;  2P5Z X;  1IBL Q;  5EPL A;  5CV6 A;  3HOY B;  2M2L A;  1EZ8 A;  1QCB D;  4HIK A;  5C3E H;  3T56 B;  3MTS A;  3BVG A;  4CKB A;  5IY0 A;  3CD6 A;  3K5L A;  3GTO B;  3OWF A;  2UXC L;  1EU3 A;  1CKO A;  2HQL A;  4R4T A;  1S40 A;  1E22 A;  1QB5 D;  4P75 A;  2E5L L;  4EQN A;  3VYR A;  4LF4 L;  5ELC A;  3K0Y A;  2PW5 A;  3GV3 A;  1XPR A;  1AH9 A;  1FGU A;  1S5F D;  1AE3 A;  2K6A A;  2F3V A;  2DNC A;  4MTK A;  2EOT A;  3C3L A;  3A8K E;  5G3L F;  3R2T A;  5IGG A;  3H0G H;  1Q8I A;  1JJC B;  2K33 A;  4L8J A;  1JQY D;  4XIG S;  1VQ6 A;  1VQF A;  1FNW A;  4QB4 A;  4RGT A;  1PVO A;  2E2H B;  1LYL A;  2N3S A;  2PZT A;  2A1A A;  2JA7 B;  2R7F A;  3PMF A;  4RFB A;  4X62 L;  1T5E A;  4Q5V A;  1JWU D;  3H6M A;  3ULL A;  2LXK A;  5ELD A;  1O78 A;  1B9M A;  5D3D A;  3RZD B;  3R3O A;  1NY4 A;  5ELE A;  2F0U A;  1UE5 A;  3CCJ A;  1BVS A;  3I4M G;  4O2D A;  2XVS A;  2G9D A;  1EFW A;  4A3G B;  3I8Z A;  1PRT D;  4RGO S;  5DNF A;  4A3F B;  2ZTE A;  1LLR D;  3VDY A;  2D0O A;  1QZG A;  3MFG A;  3K5N A;  5EKL A;  4HTH A;  1SJH D;  1NAP A;  1D5Z C;  4A3L G;  2JA9 A;  1YNJ C;  1I6V C;  2AQ1 B;  5BN4 A;  1GVP A;  1SMY D;  1LT4 D;  1NNX A;  1RTN A;  2E75 C;  5KIX A;  3CCQ A;  3VA7 A;  5J3B A;  4K2L A;  1ICF B;  2CKZ B;  4X3K A;  1J5E L;  3PF4 A;  4OO1 H;  3M4O H;  5IE8 A;  3V96 A;  4JVZ A;  5F2D A;  4JI8 Q;  3MWY W;  5G3L D;  2NVX B;  1XYI A;  2ZM6 L;  2PQE A;  2O2L D;  5IP9 H;  3UDG A;  1WTW A;  2X6G A;  1SYE A;  4ODG A;  1SE8 A;  2LSS A;  5IIF A;  2B2V A;  4QUC A;  3HG9 A;  1U4M A;  1HNX Q;  4HR7 B;  1N32 Q;  1PTO F;  4YWL A;  4JI4 L;  5M5X B;  1E2Z A;  1Q3L A;  5ISR A;  2WAQ E;  2BDN A;  4HID A;  3T1H Q;  3RN5 A;  3GTK H;  2F1M A;  3NEL A;  1W6J A;  4HSV A;  3KLS X;  2NUC A;  2NVX H;  1FNU A;  1PYB A;  1I94 Q;  2F0J A;  5IWA Q;  5AJ3 Q;  1IYU A;  3IL8 A;  1KIX A;  1BBU A;  4JI1 L;  1Y69 U;  1STB A;  1NR2 A;  1L1O A;  4P74 A;  2G9H D;  1KAA A;  4P71 A;  1TWG H;  3T53 B;  1CKN A;  4JBJ A;  1X3Q A;  4JI3 Q;  2ALY B;  3S1Q B;  2AKW B;  1JR0 D;  4F87 A;  1RCV D;  3DWP A;  1LTA D;  1X3E A;  4HMI A;  2KCM A;  1S5D D;  5C4X G;  3S2H B;  4DF7 A;  3TRE A;  4EX5 A;  1EWH A;  2JP1 A;  4A3G H;  1VMP A;  4J8Q A;  1SYG A;  2ENB A;  2K5V A;  4LUV A;  2XTI A;  1RDP D;  3PUV A;  1VQ4 A;  1N36 L;  1MGS A;  1MJC A;  4PV1 C;  4CDE C;  5IYD H;  3NP8 A;  4O1N A;  1PFM A;  1V1O A;  3TP7 A;  1X32 A;  1YIT A;  3TZD A;  4A3E H;  4KLK A;  2NN6 G;  4AYB B;  5JPN C;  3W1G A;  1QIL A;  3GTG H;  2Z4H A;  3CP0 A;  3I70 A;  4BA1 I;  5KGU A;  2NZO A;  3JAM L;  1Y14 B;  3PO3 G;  1PZI D;  3BZK A;  3EN2 A;  4DV0 L;  4IN3 A;  2SNS A;  2B39 A;  2YU9 B;  1RL2 A;  1JIC A;  1O7Z A;  3MXP A;  3EIV A;  2IY5 B;  1VQC A;  1G6P A;  1BNZ A;  3S2D B;  2VB2 X;  2B2Y C;  2K14 A;  3ULJ A;  3PO2 H;  4M8A A;  4BBR B;  4UY8 C;  2I5H A;  4AQY Q;  1EEF D;  4O0A A;  5IP7 H;  1JMC A;  1EQR A;  4CDC C;  5C4H A;  3HS0 C;  4HAE A;  3ONA B;  4KJO A;  2Z6K A;  3OTO Q;  3CRK C;  4NXM L;  3S16 B;  1WI5 A;  4DK1 A;  3IAY A;  2A69 D;  3UE1 A;  2SDF A;  5E1F A;  5FO8 B;  2MO0 A;  3TSS A;  2JA8 G;  2NVQ B;  4WJ3 M;  4A4I A;  2Z4I A;  2IX1 A;  2AUJ D;  2CQA A;  2IL8 A;  4YCU A;  1IW7 C;  1FJG L;  1C7Y A;  4IAL A;  2WKC A;  3GTQ B;  3F2C A;  2ID0 A;  3C1E A;  2F3I A;  1LT5 D;  3NQT A;  4UAI A;  1Q81 C;  1STA A;  3KBG A;  5KND A;  2SEB D;  3KBX A;  1WTO A;  1GHK A;  3Q24 A;  5GAH C;  2SNM A;  2IPK D;  1A15 A;  2ZTD A;  3QO2 A;  1R9T B;  3CQZ B;  3M7G A;  3K5O A;  1Q1B A;  4TKO B;  1PH7 A;  2K4K A;  4ZKB B;  2UUB Q;  1U4R A;  4JI2 L;  5EQ0 A;  1PRT F;  1KLG D;  4QF4 A;  4K5V A;  3V05 A;  2OF1 A;  4JI5 L;  3S15 H;  4ABN A;  3G6E A;  5J22 A;  4B3S L;  3OW2 A;  2LKV A;  1H9M A;  2K5Q A;  4A3C H;  1EOV A;  4RCO A;  1X9N A;  3G4N A;  3PUW A;  2LMC B;  3N6R A;  3KLW A;  1ICW A;  1KHI A;  5KYL A;  1HTP A;  1CZG A;  2F4V L;  2R93 B;  1BO0 A;  1VQ7 A;  3NWT A;  1J6Q A;  1GUS A;  2YU9 H;  1QE6 A;  4HJ9 A;  3S14 H;  4IUN A;  3QB3 A;  1U0L A;  3KF6 A;  2EJF C;  1A3U A;  1Z7T A;  2BOS A;  5NUC A;  4H02 A;  3UDX A;  3AEV A;  2RSO A;  1LM0 A;  2B8G A;  4LUZ A;  3OMC A;  3LWE A;  1Q8K A;  5D3I B;  5EBD A;  4DV4 L;  2LS0 1;  1PZJ D;  2VQE L;  4R4O A;  4R4Q A;  5C5L A;  4OO1 I;  4HED A;  1QUQ B;  1OTC A;  1N36 Q;  4LFA L;  3CCL A;  5E4W C;  3Q23 A;  4AQY L;  5IP9 G;  4PMW A;  3VYS A;  2NVT B;  4JYA L;  2MJ8 A;  4LFB L;  1CA6 A;  4DR2 L;  2OT2 A;  2ZJQ A;  3S16 H;  1A63 A;  2CWA A;  2DY7 A;  3STB D;  1PRT B;  1PMR A;  2XSC A;  3A56 A;  3F8T A;  1U4L A;  2PYK A;  4H13 C;  2H5X A;  1BOS A;  3EQL C;  3ERO A;  2F0K A;  1EQV A;  4RHR A;  5FJ8 G;  1G2T A;  1VQH A;  1X3F A;  1A3T A;  1LT6 D;  3V2T A;  3CC2 A;  1XTD A;  4X3U A;  4HN7 A;  1A2T A;  4C3J G;  2QEX A;  3S1N B;  1V9P A;  2GA4 B;  2F4I A;  5LMN W;  1WYD A;  1DOL A;  3KF8 A;  3OIQ A;  2K1B A;  5CV4 A;  3J7A F;  1OXS C;  3GTM H;  2R3Z A;  2H1E A;  1IBM Q;  3QOJ A;  2N88 A;  4B9X A;  3F2U A;  2CW0 C;  2EJM A;  4R4I A;  2F0N A;  1EY9 A;  2JA6 G;  1SE3 A;  4IOA A;  5JJL A;  2Q8R E;  2YTY A;  5FO7 B;  1EOT A;  3OYY A;  1B9N A;  1XXG A;  5D65 A;  2R6G A;  1SE2 A;  4OIK A;  1ILP A;  4LFB Q;  4B3M Q;  3PIP A;  2F0M A;  4YCV A;  3GTJ B;  1ET9 A;  4X6A H;  1J5E Q;  3CF5 A;  4DR5 Q;  5LMN Q;  4PZ7 A;  3QIA A;  4N8X 1;  3GP7 A;  2FFK B;  2MPM A;  2WIN B;  3I7F A;  3G48 A;  1TWC H;  4C3J B;  4X66 L;  5DM6 3;  3H91 A;  2D62 A;  3J7A V;  3ERS X;  3E3X A;  4ZRZ A;  2J7Z A;  1GUG A;  3HOU B;  3T4A C;  4DA2 A;  1DGS A;  4BA2 I;  2OWO A;  2VUM H;  1SR3 A;  2WB1 G;  1PTO H;  2HHH L;  4RA8 A;  1D8L A;  4BY7 H;  3QJY A;  1VQP A;  4DUZ Q;  1VQN A;  2EDG A;  1BCP B;  4F7X A;  2QCP X;  2HHH Q;  1XPO A;  1QUQ A;  4IUP A;  4LFC Q;  2N78 A;  2RA4 A;  1Z6H A;  5AFW A;  1PH1 A;  1YNX A;  3M7N A;  4P73 A;  2AWO A;  4Y52 H;  2YV5 A;  1GXD C;  3K57 A;  3AMU A;  3K80 C;  1I94 L;  4H44 C;  3DHQ A;  4C3I G;  3W1B A;  1EY8 A;  2UUA Q;  2ZTC A;  2IX3 A;  2L12 A;  1MIU A;  1KD1 C;  3BU2 A;  4M1U B;  1HXY D;  4GN4 B;  2PMZ E;  4BY1 B;  4A3B G;  2B2U A;  2WAQ G;  1IBK Q;  1HTL D;  3CW2 C;  2EY5 A;  1SXT A;  4A3K H;  3C1F A;  5C5M A;  3MXU A;  2CVR A;  4ZUJ A;  5C0X J;  4KKS A;  4A3B H;  3HOV G;  3HOW G;  2NWG A;  2EYP A;  1ROD A;  2KEE A;  1WFQ A;  4JI6 L;  4LFC L;  2MO1 A;  2R92 H;  3D4W A;  3GTL B;  3X3M A;  4I7Z C;  5FOB B;  1AW7 A;  4JI2 Q;  3H3V C;  5IGC A;  1HHV A;  4N9P A;  4ILW A;  1CKN B;  1I3Q H;  4YY3 L;  3HOW H;  3HOV H;  3DMU A;  4YHH L;  1HNZ L;  3KLR A;  2RBM A;  5GQO A;  2D0P A;  3H3V I;  2RDH A;  2LFN A;  3S1R H;  1Y1V B;  2ZT9 C;  1A8V A;  1V8Q A;  5LL6 X;  1E2W A;  3TRZ A;  5I6Y A;  4FNF A;  2MNA A;  3SE0 A;  4XYO A;  2ZJP A;  1HFN A;  4B3T L;  1HA5 A;  1BBW A;  3OW7 A;  2RKS A;  4UP7 A;  5IGE A;  2Y0S G;  3KDF B;  5M3F G;  3SVM A;  1E1O A;  3BVM A;  1G51 A;  1VQI A;  3NEM A;  1EY5 A;  3HP3 A;  1PH3 A;  3WWV A;  2VQE Q;  1HNW L;  3BDL A;  3U4Z A;  1H95 A;  1YZ6 A;  3VR4 A;  5CV7 A;  2E76 C;  1L0X B;  1PA6 A;  4FF3 A;  1BCP D;  5C0X I;  5EKK A;  5IP7 G;  1SNC A;  2EXZ A;  1SN8 A;  1HRJ A;  4DK3 C;  4QY7 A;  3PO2 G;  4JOI A;  3TS2 A;  1XMO Q;  2RDF A;  3DWQ A;  3TP6 A;  1IZ6 A;  2B2Y A;  4BY1 G;  4A76 A;  5IYC G;  1EUJ A;  2Z6B A;  4C3I H;  2I46 A;  4OXP A;  2Z6K C;  4YCW A;  5CMD A;  1CSQ A;  1GKH A;  4APV A;  1PFB A;  3DXJ C;  2IHF A;  3M85 A;  1GD7 A;  4MZ9 A;  1HR0 W;  5IGB A;  5EKI A;  2VQF Q;  2KA7 A;  4A3M B;  1KDC A;  4FVM A;  2EIF A;  1BUV T;  1HCZ A;  3D3R A;  1XNQ L;  4B3S Q;  2IHE A;  3I55 A;  1FL0 A;  3I4O A;  4Y7N H;  4JBK A;  1JC7 A;  2UUC Q;  3HOY G;  5M3F B;  2JYO A;  4JW0 A;  1HPC A;  3IFT A;  1KTK A;  4DV3 Q;  5C4X B;  4A3J B;  1JB7 A;  5T1G A;  3J80 c;  1VQ8 A;  3ZYY X;  1DM0 B;  1EY7 A;  4IUU A;  2IJ0 A;  1W2B A;  5L37 A;  4UHV A;  2PPB C;  1O80 A;  2NYZ D;  1D7Q A;  2A6H D;  4XXE A;  1CT1 D;  3J80 L;  1I5F A;  2I07 B;  1B53 A;  1MI2 A;  2F03 A;  5C3X A;  3J81 L;  4TVA B;  3P75 A;  2PO4 A;  4DR6 L;  1K73 C;  2OEO A;  4DNI A;  4BXX H;  4CBV A;  3I4M B;  2JA7 H;  3K5M A;  3K8A A;  1Q1E A;  4BS9 A;  4DV7 L;  1YBY A;  3D0F A;  1LTI D;  1CSP A;  1BQQ T;  2B8F A;  1UE7 A;  1PXU A;  2WP8 J;  3UI2 A;  3W2D A;  2JA7 G;  5KEE A;  2VL6 A;  3CHB D;  4A3I B;  5C44 H;  4F88 A;  2CH4 A;  4UPA A;  1G29 1;  4AYB E;  2BE5 D;  2F0I A;  2VNU D;  1EIH A;  2OQ0 A;  2RVL A;  5FLX L;  3MVV A;  1YVC A;  4RH6 A;  4GZY C;  4DK6 C;  4FP5 D;  1EU4 A;  1S5B D;  2Y0S B;  5I9O A;  1NSN S;  1K3R A;  4GNX C;  4GOP C;  4A3D H;  5M3M B;  3NEN A;  4FF1 A;  1W3S A;  3MFY A;  4A93 G;  4LFA Q;  1XNR Q;  1P16 A;  1AN8 A;  2A68 C;  1ENF A;  4TRD A;  1WCM H;  1K3B C;  1EZ6 A;  3IKJ A;  2BCO A;  1GUO A;  4ME5 A;  3I4N H;  1I4P A;  2Z1C A;  4CKC A;  2EYF A;  1H9S A;  5CV5 A;  3CC7 A;  4IOC A;  4JI1 Q;  1VF7 A;  2H4O A;  3OTO L;  4O42 A;  3HOU G;  2MP1 A;  4B9W A;  4LF6 L;  3D31 A;  3EJI A;  4K6L A;  4DK0 A;  2B3G A;  3D6C A;  1IKM A;  2WKD A;  4HCE A;  1IW7 D;  1JE5 A;  4EQ5 A;  4PMB A;  2JSO A;  1VF5 C;  2FHT A;  2K52 A;  3NTK A;  4X62 Q;  4KY5 A;  4CKE A;  4LF4 Q;  3QR8 A;  3ULP A;  1RHP A;  3IFD A;  1ESF A;  3W5O A;  5C3W A;  1AP0 A;  2NTS A;  1Q12 A;  1K0R A;  3NK9 A;  1C4Q A;  1MD2 D;  4JPB W;  2OXP A;  2ZXP A;  3CPW A;  1X65 A;  3I4M H;  4RGM A;  4U68 A;  3H0G G;  1Q82 C;  4K8J A;  2N8N A;  4IQZ A;  5JEA G;  4OON A;  1GM5 A;  4DV7 Q;  3GO5 A;  3BDC A;  3SK4 A;  2EYM A;  1Y1W G;  1I50 H;  4KD3 A;  3MA2 B;  3I56 A;  4DR2 Q;  3E0E A;  1EYD A;  1CKM A;  4G7Z C;  3AU7 A;  2N55 A;  2NZ1 D;  3RN2 A;  5C6A A;  3KF6 B;  4G7O C;  3E6Z X;  4HCS A;  3HOX G;  2SOB A;  2XWJ B;  5JEA H;  4G7H C;  1IBL L;  2B2T A;  3HOZ H;  3KF8 B;  4GN5 A;  3RUZ A;  1K83 H;  5FK9 C;  1YHB A;  1X55 A;  1A62 A;  3NUC A;  5CYU A;  3PO3 H;  1OO9 B;  5M3F H;  3I90 A;  4RGN A;  4UP8 A;  1YJW A;  3BS1 A;  4B08 A;  4A3M G;  1N34 Q;  3HOZ G;  3PV0 A;  4DPG A;  3G4O A;  2M00 A;  1B70 B;  1TWA B;  2GVB A;  4K8I A;  2F52 A;  1HR0 Q;  5C4J H;  4DGZ A;  2PNR C;  4R9W A;  3NWS A;  1PTO D;  2Q2U A;  1LTB D;  1Y8P B;  4OEL B;  5C4Z A;  1Q7Y C;  1JOK A;  4LMQ D;  4G4K A;  4GN3 B;  1Y1W H;  3HOU H;  1K0S A;  1D1K A;  1VQM A;  2KUM A;  4OWX B;  1RIP A;  2J4X A;  3TME A;  1F9P A;  4OEM B;  5M5X H;  2BA1 A;  2K32 A;  1SFO B;  3SK5 A;  4BBS G;  1R4Q B;  2CWP A;  3MEF A;  1NTG A;  1V1P B;  4ZYS A;  5EAY A;  3RNU A;  3D4D A;  1PH4 A;  1SDF A;  1NBW A;  1K8A C;  1R4P B;  2B2T C;  2HDM A;  3BZC A;  3RZO B;  1KNA A;  2KED A;  1EYC A;  3ER0 A;  3HKS A;  3PUZ A;  5EBC A;  3M4O B;  3FVQ A;  4DAY A;  3GTP B;  1QWY A;  1Z52 A;  1WD0 A;  1I6H H;  1HR0 L;  1SMY C;  2XWB B;  1K28 A;  4LF5 L;  4ME3 A;  4P72 A;  2Q2T A;  5C0X H;  3F2B A;  1KAB A;  2FIN B;  1TWH H;  4A3J H;  2AWN A;  3T16 A;  2CW0 D;  3PGZ A;  1PRE A;  4EVO A;  3FEW X;  3KDF A;  3HKZ E;  2PQA A;  1SNO A;  2JXM B;  5I2X A;  2WII B;  4RAU C;  4A93 B;  1EYA A;  1C9O A;  1PLF A;  2PW7 A;  3WOE A;  4IJL A;  1ONL A;  2ES2 A;  2DN8 A;  3KLS A;  3KOJ A;  3VR2 A;  2QDB A;  3M3Y B;  4UP9 A;  1I50 B;  5FKA C;  4A3C G;  1LV9 A;  4ZCK A;  2HQE A;  3K6O A;  4DV2 Q;  3OHX C;  3TBI B;  4NKL A;  5IYB H;  4K6D A;  4EQP A;  2PZU A;  2NVT H;  1U4P A;  3RR5 A;  2AHO B;  1A3V A;  4DV2 L;  1QVF A;  4NXN Q;  1F2M A;  4DAY B;  3JC6 6;  3U4V A;  3HOV B;  1U5K A;  5IT9 L;  1M90 C;  4POG A;  1G6Z A;  3CU7 A;  4WOR A;  1RKN A;  3KJP A;  5LMU Q;  1FGB D;  4A75 A;  1E24 A;  3A74 A;  3AFP A;  2NBF A;  3OPO A;  5A2Q L;  3Q22 A;  2F0H A;  1VQG A;  2L9H A;  4MN3 A;  2R7Z B;  2E2J B;  1VQE A;  1EWI A;  4IPH A;  1EQQ A;  4JI4 Q;  2R93 H;  5CV8 A;  2PI2 A;  1Q46 A;  3H15 A;  3T13 A;  3CCS A;  2D9U A;  2BA0 A;  1SND A;  1HA6 A;  1A2U A;  4C2M H;  2M9V A;  3S17 B;  1LTR D;  1HNX L;  4C3H G;  3P1H A;  5JVH 3;  3G7L A;  3DEP A;  4K0K Q;  1RF2 D;  2EY6 A;  3BDO A;  2K28 A;  1R9T H;  3ICE A;  4QMG A;  2QW7 A;  3SEB A;  1J9O A;  3STB C;  3WOF A;  4KHP Q;  1FYC A;  3SXH A;  1PRT C;  2XIW A;  4N8F A;  3S9W A;  4DUZ L;  4JV5 L;  3RLN A;  5HUR A;  4NP5 A;  4GLX A;  2A68 D;  3CQZ H;  1I6H B;  3EFX D;  4HJ7 A;  1HZC A;  4A3I G;  1JOR A;  3U50 C;  4S3S A;  4QL5 A;  2JA8 H;  2XGT A;  1XJV A;  3NTH A;  1P8L A;  3RLF A;  5A2Q E;  1HNZ Q;  4B3R Q;  3HOW B;  2VUM B;  2K75 A;  4KJN A;  1JOO A;  1CUK A;  1FVI A;  2K5D A;  4LW1 A;  4L5S A;  4R8N A;  1RJT A;  4OGQ C;  4A3E G;  1HQR D;  4A3F H;  4U67 3;  1PDQ A;  4LF9 Q;  2QF7 A;  4C3H H;  1KC8 C;  3BYY B;  3PIO A;  1X6O A;  2HT1 A;  3P7J A;  1DOM A;  1T5X D;  1XPU A;  2B2V C;  4CGY B;  4YIJ A;  1B50 A;  4DR1 L;  1M4V A;  2N49 A;  3JAM c;  1VMC A;  2EYL A;  3LWU A;  3FDT A;  2FMC A;  2RQX A;  4ZK9 B;  1SEB D;  2KCT A;  1JWM D;  2D2C C;  2HIX A;  1WTR A;  4HSP A;  1DXM A;  1E0B A;  1OXT A;  4DV5 L;  2BDO A;  1NJI C;  1ZEQ X;  2E2J H;  2RCN A;  1PFN A;  5K36 G;  1TR5 A;  5ELO A;  5IT9 c;  3D4R A;  2DJG C;  5IOC A;  4PZ8 A;  1B3A A;  4JI8 L;  4CHT B;  2EVB A;  2PQA B;  4MNO A;  2AUK A;  1TKW B;  4H0L C;  3EVQ A;  1UEA B;  1D2B A;  1CTM A;  1UEB A;  1Y1V G;  4YWM A;  5C44 G;  3NXW A;  4RKB A;  4J15 A;  4OL7 A;  2F0Q A;  1UE6 A;  3BYT B;  3DEO A;  1WOC A;  5C3E B;  3KYH C;  3TZU A;  4EGV A;  1WTX A;  3LNN A;  3M4Y A;  4FF4 A;  1YNJ D;  5JJZ A;  1CM9 A;  3GQB A;  3PF5 A;  3UDF A;  3A7A B;  1B2T A;  4X64 L;  3CRL C;  2JA6 B;  2EPB A;  2PI2 E;  5E3F A;  4JV5 Q;  4ID6 A;  3PSI A;  5IT9 E;  1QJO A;  2F0W A;  5IYB G;  4LF5 Q;  2WAC A;  4LK1 C;  1V43 A;  1PH9 A;  1GUW A;  4JYA Q;  5HGT A;  3T1Y L;  1ENA A;  1C0A A;  5DAU A;  2L4N A;  3HZX A;  5K36 H;  1DD2 A;  4OWT B;  3A55 A;  1YJN A;  1EY6 A;  2A6H C;  4K5X A;  2WAQ B;  5CV9 A;  3OWE B;  4FYD A;  3E9I A;  4LWC A;  2ZXO A;  4LF7 Q;  3SHL A;  2UXB L;  1B1Z A;  2XN9 C;  2NVY B;  4L5T A;  4KY7 A;  3RZO H;  1UUP A;  4DV6 Q;  4LF9 L;  2GN5 A;  4QUF A;  3GTK B;  1KDB A;  2EQS A;  3I4N B;  2KEN A;  1IYJ B;  5I6W A;  4QIW B;  3FP9 A;  2JQO A;  1K8M A;  4L63 B;  4R8I A;  2OQK A;  1AZP A;  2Z0S A;  4C3H B;  2UUB L;  2TMP A;  2VB3 X;  2Y0S E;  5I9P A;  1XMQ Q;  1BDO A;  1EYG A;  3L7Z C;  3TS0 A;  2CQO A;  1KRS A;  5LMU L;  4KN7 C;  4IFD I;  3DUZ A;  3WDN A;  3NSW A;  2JJQ A;  4QIW E;  1SYF A;  4OIJ A;  4JK1 C;  3QG1 A;  1SNP A;  2CH4 W;  3S1R B;  1EL0 A;  3GV6 A;  1WD1 A;  1KXL A;  4A3G G;  3CKI B;  1N33 Q;  4A3I H;  1LTT D;  2MUY A;  1STE A;  1B44 D;  3C0O A;  2K01 A;  3MHB A;  1HZB A;  1TU2 B;  2L11 A;  1PFS A;  2EYJ A;  2UXD L;  1MJE A;  4XDX A;  2R93 G;  1H9K A;  1QNK A;  1WVL A;  1C8C A;  3TQY A;  4A3B B;  4MTN A;  4FDB A;  4K0K L;  4HMJ A;  3EA6 A;  1IXR A;  2IWH A;  4GOP A;  2UUC L;  5TSS A;  5DLQ E;  3VR6 A;  1YI2 A;  3AB9 A;  2E2I H;  2K5H A;  4CJ2 C;  2Z8L A;  3C0N A;  1HQM C;  3HOX H;  4MHE A;  1LUZ A;  4LJZ C;  3K59 A;  2ZJR A;  4DR3 L;  3FHW A;  3S1M H;  4LUO A;  1KRT A;  3FMC A;  2B2W A;  2EYO A;  2KCC A;  2LY7 A;  3A7L A;  1STN A;  1SMX A;  1NCV A;  2VY3 A;  2K7V A;  5JVG 3;  1AE2 A;  4YWK A;  1WTQ A;  3CME A;  4PMC A;  1Q90 A;  2B2U C;  3GTO H;  3LGJ A;  2UXD Q;  4Y7N B;  4DN4 M;  3ND8 A;  3R2I A;  4DU9 A;  2JA8 B;  3HGB A;  1TXY A;  2E2I B;  1MSG A;  4P2C B;  3C2P A;  1PH6 A;  1TQO A;  3GTQ H;  2A69 C;  3FKI B;  3A5U A;  1EWC A;  2K5W A;  2AMC B;  1GUN A;  2JN4 A;  3I72 A;  4NXN L;  5IYC H;  4BY1 H;  2HIV A;  4H7B A;  3I73 A;  2R92 G;  3TP5 A;  1BCP C;  1F9S A;  2D5D A;  1XTC D;  1SE4 A;  2DY8 A;  3BVZ A;  3FPU B;  5M5Y H;  2OTL A;  3U9S A;  1O7I A;  1EY4 A;  3HFZ B;  3S2H H;  3MXN B;  4RWS C;  1SYD A;  1VQL A;  4JCV E;  5IGD A;  1O7Y A;  2JA5 G;  4BWG B;  4DNT B;  1WCM B;  2KHJ A;  1TWF H;  3Q8D A;  1CZW A;  2JA5 B;  1SBB B;  3AQQ A;  3QWN A;  1F9R A;  4XYQ A;  1X54 A;  3F1Z A;  3GD7 A;  3RD4 A;  3PO2 B;  2I5L X;  4OHJ A;  4GKJ Q;  1TS2 A;  1ZXT A;  5DM7 3;  5IOD A;  4BY7 B;  4Q0F A;  1TWH B;  1B4O A;  5E4X A;  1LAC A;  4DV6 L;  1BBX C;  1T9H A;  4AYB G;  4FF2 A;  3S1N H;  4KK7 A;  1H9R A;  1ET6 A;  3DM1 A;  3B6Y A;  3J7Y W;  1ENC A;  3K7U C;  2C35 B;  3J80 E;  3ITP A;  2KHS A;  1TY2 A;  4AH6 A;  1B3Q A;  1ZYR C;  1NR4 A;  2L1B A;  1STG A;  3UE0 A;  5CGK A;  1PH2 A;  2MGS A;  4QQB X;  1JWS D;  4IPD A;  4DNR B;  1IHZ A;  4KN4 C;  2NN6 I;  5EGT A;  4DUY L;  2Z9H A;  2C9O A;  2F0G A;  4KTA A;  1F2Y A;  2KEC A;  2ZM6 Q;  3OOC A;  3A0J A;  4GKK Q;  2KOL A;  3SGI A;  4JOI C;  2J0T D;  1VDZ A;  1KL9 A;  2MHV A;  2K04 A;  1RTO A;  4JI7 Q;  1SYB A;  1UAP A;  4ZLT F;  4LF6 Q;  4ZUI A;  2O5J C;  2QKI C;  4K14 A;  2DUD A;  2F0F A;  2RDG A;  2FMM A;  5HGQ A;  3GTL H;  1VQA A;  2R7Z G;  2AQ2 B;  1XX8 A;  1X3P A;  1G8Z D;  1QZH A;  5GAE C;  1EY0 A;  1GOZ A;  1NMG A;  2L5T A;  4PZ6 A;  3M4Q A;  3J81 j;  4KI0 A;  3PQI A;  2RSN A;  1K8G A;  4DR7 L;  5I2Y A;  1U9R A;  3J7Z C;  1FJG Q;  3ND9 A;  4ALP A;  2A5H A;  3J81 i;  1HH2 P;  4POF A;  5DEH A;  1YHQ A;  3K0X A;  3VA5 A;  1JE4 A;  4L6T B;  4ULL A;  4ZQ3 A;  4K2K A;  1YEZ A;  3CCU A;  1PH5 A;  3S14 B;  4TSS A;  2O5I C;  1DON A;  1E2V A;  3DM3 A;  2CFM A;  1I4H A;  4A3M H;  3VR3 A;  1CFM A;  4X3S A;  2KQ3 A;  1E7Z A;  4KHZ A;  2UXB Q;  4JBM A;  4MIU A;  4PNY A;  4CJ1 B;  1SAP A;  3J7A 5;  4IZ8 A;  1SYC A;  3QOL A;  5GAD C;  1BKB A;  3NTI A;  3SK6 A;  3D8G A;  3HKZ B;  5CBE E;  2Q2H A;  1CI3 M;  2WB1 B;  3GTP H;  1STH A;  1EIY B;  3NPP A;  2OTJ A;  1I4R A;  1PZK D;  2B29 A;  2PCF B;  1D1I A;  1F77 A;  3C46 A;  3Q6S A;  1DZ1 A;  4DV0 Q;  1K83 B;  2NB0 A;  2JA6 H;  5BN3 A;  2JK8 A;  5J39 A;  1VQJ A;  3E0J A;  1GUT A;  3AYH B;  3VYT A;  1L1O B;  2KBN A;  2ICE C;  2G5D A;  2O4X A;  4BBR G;  4CDF C;  5BR8 L;  4DV4 Q;  1XNR L;  3KJO A;  2HD3 A;  2OCE A;  4KHP L;  3MEH A;  4A93 H;  2VXW A;  5H1S E;  4JBW A;  5M5Y B;  4A3D G;  2IX0 A;  1ILQ A;  1L0Y B;  1KNE A;  2QGQ A;  5JOB A;  3CXC A;  1Y1V H;  3L9A X;  5GAG C;  4R4C A;  4BBR H;  4GNX A;  4NXM Q;  1TWG B;  2E74 C;  1QVG A;  5FLM H;  4B3R L;  2VQF L;  2V1C C;  2A6E D;  1L1O C;  2DGY A;  1YNN C;  1AZQ A;  3PIP 3;  1TT2 A;  2K03 A;  3JAM E;  4OO1 G;  1UNS A;  2RHQ B;  2VW9 A;  2IW3 A;  5C44 B;  4DAV A;  4IO9 A;  3T1H L;  4N9T A;  1S4Z A;  5KNB A;  1BXT A;  2EZV A;  4IPG A;  1QG7 A;  3FKI G;  4DR3 Q;  1ASZ A;  1B8A A;  4L5R C;  3T51 B;  1W6K A;  3UDI A;  1E3P A;  4GS3 A;  2F0E A;  3S1M B;  5M5W H;  2I0Q A;  1IL2 A;  4JI0 Q;  4V0B A;  4NDX A;  4GKK L;  1FD7 D;  3PUY A;  3HOX B;  3HKZ G;  3O13 A;  1LTS D;  4JI0 L;  1TS3 A;  4C1N K;  1HUN A;  1I4Q A;  3R93 A;  1IBK L;  2FXQ A;  1PV4 A;  5JPM C;  3NE5 B;  1ML0 D;  5C0X G;  1IL8 A;  3IRB A;  5FO9 B;  1HZ9 A;  1M1K C;  4C2M B;  4EQO A;  1JB3 A;  1EIG A;  4WRD A;  2HDL A;  4GKJ L;  4JC0 A;  4LF8 L;  3A8I E;  3PUX A;  1JCK B;  1X56 A;  4K5W A;  2JEB I;  5E7N A;  4X65 L;  1YNN D;  3J81 c;  1N33 L;  4XQJ A;  1QOH A;  1TWA H;  3OSO A;  3SR1 A;  1N34 L;  1YHA A;  3TEH B;  1N9W A;  4NMZ A;  3U58 A;  4C56 C;  1SJE D;  4A3L H;  3MAQ A;  1RD9 D;  3CAM A;  2K5N A;  3NBH B;  1S5C D;  3I3C A;  4OWW B;  5ELN A;  4DR4 L;  2EY2 A;  2RHS B;  1SSO A;  1LAB A;  1VCI A;  4IPC A;  3G4S A;  4DR5 L;  1TY0 A;  1UE1 A;  1KDA A;  4IUT A;  4UDU C;  3KUP A;  5FLX c;  2NTT A;  3I4L A;  2NVQ H;  3HRZ C;  2CHB D;  3NBI A;  2YTV A;  2DNE A;  4AIM A;  2R61 A;  1PH8 A;  3GTJ H;  4WJ4 A;  1LTL A;  3G6J B;  2Q8T A;  4C3J H;  5BR8 Q;  4CJ0 B;  2NN6 H;  3MZ5 A;  5D14 A;  2FJ2 A;  1EQT A;  1D5M C;  2F0T A;  2L0C A;  2KJX A;  3RMH A;  1J8I A;  4I65 A;  1BF4 A;  1X3G A;  5M5W B;  2B2W C;  3T1Y Q;  1FNV A;  5EPJ A;  2XRS D;  2F4V Q;  1D6E C;  4RCN A;  5M3M G;  1OXU A;  4DV1 Q;  2F0L A;  4RG1 A;  4TQU S;  1ESR A;  2L55 A;  3I4N G;  1F2L A;  1PYS B;  1VQO A;  5C4J B;  3JAM i;  3GTM B;  1L2F A;  1LO5 D;  3ERQ A;  4FXG C;  4HJA A;  4WJW A;  4KKT A;  4QGU A;  1BR9 A;  3MXN A;  3CCR A;  2MQH A;  3DWA A;  1TII D;  1SFO H;  3BZD B;  4DAM A;  4FO2 A;  2QEJ C;  3VR5 A;  3CPF A;  4HJ5 A;  4OX9 L;  5K5P A;  3K7A H;  5ELF A;  4Z9C B;  4IFD H;  4KMU C;  4LNQ A;  1ASY A;  1EFI D;  2MFI A;  4J6H A;  3RLO A;  4XQQ A;  3CC4 A;  4PQX A;  1SNQ A;  3KK7 A;  1TS5 A;  4RMF A;  2KHI A;  5LL6 S;  4CDD C;  3U9O A;  2A74 C;  1HNW Q;  4F8M A;  5BN5 A;  3L2P A;  1KAW A;  2HUG A;  2ICI A;  1WCM G;  3RZD H;  1A6X A;  4GLA C;  1WTH A;  3EBE A;  5KNC A;  4IFD J;  2WFW A;  1OXX K;  1EEI D;  3SK8 A;  4E6I A;  1JT8 A;  4X66 Q;  3H94 A;  3I2Z A;  5CBA E;  4YY3 Q;  1IKL A;  2R7D A;  2TSS A;  1Z9F A;  2ZXR A;  3FKI H;  4R1J A;  3PO3 B;  2R92 B;  2Q8I B;  4DKA C;  3HOZ B;  1I3Q B;  1CQV A;  4DR1 Q;  3GTG B;  4DUY Q;  2F3W A;  4LF8 Q;  5EPK A;  4QCL A;  3FRP B;  4X3T A;  2PNH A;  1VQ5 A;  2BH2 A;  3P20 A;  1AFP A;  1HUM A;  3M4P A;  2RF4 A;  2VZA A;  2LXJ A;  4DXF A;  4DR6 Q;  3S17 H;  1IBM L;  3J81 E;  1HFG A;  1STY A;  2UU9 L;  4A3K G;  4JI6 Q;  3URY A;  5ELB A;  2F0V A;  5JJK A;  1GO3 E;  2HCI A;  1VQD A;  3AFQ A;  2I5M X;  1EIF A;  5T1I A;  5IGF A;  5JEA J;  1WTV A;  3C0M A;  2E5L Q;  4ZKC B;  4BY7 G;  1Y1W B;  3SDZ A;  3MXG A;  1QVC A;  2KVM A;  3H09 A;  1M8A A;  3HEJ A;  1Q86 C;  1JOQ A;  3NBH A;  1DOK A;  5GRO A;  2EYH A;  1Y8O B;  2ATW A;  1XMO L;  3J80 i;  2HCC A;  3H0G B;  3K58 A;  4BBS B;  4LF7 L;  1BCP F;  1N8R C;  5JJI A;  2UXC Q;  4A3D B;  2E2D C;  2EJG C;  4ZAI A;  2B63 B;  2KCN A;  3CCM A;  1DYQ A;  3CMA A;  1VS0 A;  4IUQ A;  5CR3 A;  4NPS A;  2RCF A;  4A3E B;  1JJG A;  4JG2 A;  3A5Z B;  1K9M C;  1CHP D;  2A6E C;  2JE6 I;  5EJW A;  4B3T Q;  4BXX G;  4DR7 Q;  1MHW C;  1TWC B;  1OXV A;  3L0O A;  2QA4 A;  2VUM G;  3HOY H;  4J1M A;  2QIL A;  3X3N A;  4BBS H;  1D5X C;  2DJF C;  4WFN 3;  4OX9 Q;  3N52 A;  4XTC S;  3M3Y H;  1K8O A;  3NQI A;  1I4G A;  4DAP A;  1LTG D;  3K7A B;  3DLL A;  1HZA A;  3CCE A;  1Z47 A;  1PTO C;  1VQ9 A;  4V19 0;  2JEA I;  4FXD A;  3S2D H;  3ZJY C;  1WTP A;  1KLU D;  3FPP A;  2F0D A;  1A0I A;  3BG3 A;  4NB3 A;  2K50 A;  4RKL A;  5IWA L;  5AJ3 L;  4LAA A;  1S3O A;  2WB1 E;  2QDL A;  3I91 A;  4KD4 A;  5M3M H;  5I4D A;  3E5S A;  2A73 B;  2NVY H;  2E2H H;  2R7Z H;  2CCZ A;  2XRQ D;  1FR3 A;  2VS1 A;  1GHJ A;  2C5C A;  2UU9 Q;  2V4D A;  1N32 L;  2L15 A;  4NW2 A;  3PIO 3;  1QNU A;  2F0P A;  4DV5 Q;  1NUC A;  4A3F G;  2E8G A;  2F0S A;  4HIO A;  1DJR D;  3M9B A;  1F2Z A;  3LX0 A;  1V1Q A;  1KQS A;  1JJ2 A;  1TS4 A;  2UUA L;  5LHY 1;  2ASB A;  5CC4 A;  1WJJ A;  2X69 A;  4KHV A;  5IYD G;  4DV3 L;  1YIJ A;  2A19 A;  1S5E D;  1S72 A;  2EY1 A;  1VQK A;  1PHJ A;  4XQN A;  1DCZ A;  4XT3 B;  2EXD A;  2WV6 D;  2IT1 A;  3OMG A;  4KKU A;  1II3 A;  1I4X A;  3KFU A;  4XT1 B;  4DR4 Q;  4HJ8 A;  2Q2I A;  1C48 A;  4JI3 L;  1E1T A;  4GNX B;  5HY6 A;  3W3A A;  3Q0A A;  4IUV A;  3H3V H;  2PMZ B;  3G71 A;  2BH8 A;  3TDQ A;  3S1Q H;  1MBY A;  3L3O C;  1UWV A;  2X6L A;  1V1P A;  4C3I B;  5C3E G;  1H9S B;  3E9H A;  3NHH A;  1IYV A;  3F2D A;  2B63 H;  5FJ8 H;  1F9Q A;  1G2S A;  5FLX E;  5A35 A;  4X65 Q;  4IUR A; 
#chains in the Genus database with same CATH homology
 1CHQ D;  2K05 A;  5COY A;  3R8B A;  1XWE A;  2F0O A;  4A3K B;  3D6W A;  1Y8N B;  1H9J A;  3A54 A;  3OIP A;  4RHS A;  3TP8 A;  5M9O A;  2EE1 A;  1G91 A;  5JAV A;  3A8J E;  1SNM A;  4DXG A;  4C1N I;  3S15 B;  2PZW A;  1GJX A;  1O7L A;  1ZYR D;  4IFD G;  3MC0 B;  5COR A;  1AEX A;  4KY6 A;  4G57 A;  4KV6 A;  5KRU A;  1PTO B;  1ZKO A;  5J1Z A;  3TN2 A;  4FXK C;  1CK1 A;  1MSH A;  2BE5 C;  5KYI A;  1TVX A;  1PYW D;  3VYU A;  1CA5 A;  4DFA A;  1TWF B;  2AQ3 B;  1LT3 D;  2YYZ A;  1CQF A;  2XNA C;  5EPL A;  5CV6 A;  3HOY B;  2M2L A;  1EZ8 A;  1QCB D;  3T56 B;  3MTS A;  3BVG A;  4CKB A;  3K5L A;  3GTO B;  3OWF A;  1EU3 A;  1QB5 D;  4EQN A;  3VYR A;  5ELC A;  3K0Y A;  2PW5 A;  3GV3 A;  1S5F D;  2K6A A;  2F3V A;  2DNC A;  2EOT A;  3C3L A;  3A8K E;  5G3L F;  3R2T A;  5IGG A;  1Q8I A;  2K33 A;  4L8J A;  1JQY D;  4XIG S;  1FNW A;  4QB4 A;  4RGT A;  2E2H B;  2PZT A;  2JA7 B;  3PMF A;  4RFB A;  1T5E A;  4Q5V A;  1JWU D;  3H6M A;  5ELD A;  1O78 A;  1B9M A;  5D3D A;  3RZD B;  3R3O A;  5ELE A;  2F0U A;  2XVS A;  2G9D A;  4A3G B;  3I8Z A;  1PRT D;  4RGO S;  5DNF A;  4A3F B;  1LLR D;  3MFG A;  3K5N A;  5EKL A;  4HTH A;  1SJH D;  1NAP A;  1D5Z C;  1YNJ C;  1I6V C;  2AQ1 B;  5BN4 A;  1SMY D;  1LT4 D;  1RTN A;  2E75 C;  5KIX A;  3VA7 A;  4K2L A;  4X3K A;  4OO1 H;  3V96 A;  5F2D A;  3MWY W;  5G3L D;  2NVX B;  1XYI A;  2PQE A;  2O2L D;  1WTW A;  2X6G A;  1SYE A;  4ODG A;  5IIF A;  2B2V A;  4QUC A;  3HG9 A;  1U4M A;  4HR7 B;  1PTO F;  5M5X B;  1E2Z A;  1Q3L A;  5ISR A;  2BDN A;  2F1M A;  1W6J A;  4HSV A;  3KLS X;  2NUC A;  1FNU A;  2F0J A;  1IYU A;  3IL8 A;  1Y69 U;  1STB A;  1NR2 A;  2G9H D;  1KAA A;  3T53 B;  1X3Q A;  3S1Q B;  1JR0 D;  4F87 A;  1RCV D;  3DWP A;  1LTA D;  4HMI A;  1S5D D;  3S2H B;  4DF7 A;  1EWH A;  2JP1 A;  1VMP A;  4J8Q A;  1SYG A;  2ENB A;  3PUV A;  1RDP D;  1MGS A;  4PV1 C;  3NP8 A;  4O1N A;  1PFM A;  1V1O A;  3TP7 A;  1X32 A;  3TZD A;  4AYB B;  2NN6 G;  5JPN C;  1QIL A;  2Z4H A;  3I70 A;  4BA1 I;  5KGU A;  3JAM L;  1PZI D;  4IN3 A;  2SNS A;  2B39 A;  2YU9 B;  1JIC A;  1O7Z A;  3MXP A;  1BNZ A;  3S2D B;  2VB2 X;  2B2Y C;  4M8A A;  4BBR B;  1EEF D;  5C4H A;  3HS0 C;  4HAE A;  3ONA B;  4KJO A;  3CRK C;  3S16 B;  4DK1 A;  3IAY A;  2A69 D;  2SDF A;  5E1F A;  5FO8 B;  3TSS A;  2NVQ B;  2Z4I A;  2IX1 A;  2AUJ D;  2CQA A;  2IL8 A;  1IW7 C;  4IAL A;  2WKC A;  3GTQ B;  2ID0 A;  3C1E A;  1LT5 D;  3NQT A;  4UAI A;  1STA A;  3KBG A;  5KND A;  2SEB D;  3KBX A;  1WTO A;  1GHK A;  3Q24 A;  2SNM A;  2IPK D;  1A15 A;  3QO2 A;  1R9T B;  3CQZ B;  3M7G A;  3K5O A;  1Q1B A;  4TKO B;  4ZKB B;  1U4R A;  5EQ0 A;  1PRT F;  4QF4 A;  1KLG D;  4K5V A;  3V05 A;  2OF1 A;  4ABN A;  5J22 A;  2LKV A;  1H9M A;  2K5Q A;  4RCO A;  3G4N A;  3PUW A;  2LMC B;  3N6R A;  1ICW A;  5KYL A;  1HTP A;  1CZG A;  2R93 B;  1BO0 A;  3NWT A;  1GUS A;  1QE6 A;  4IUN A;  3QB3 A;  2EJF C;  1A3U A;  1Z7T A;  2BOS A;  5NUC A;  2RSO A;  2B8G A;  3OMC A;  3LWE A;  5D3I B;  5EBD A;  2LS0 1;  1PZJ D;  5C5L A;  4OO1 I;  4HED A;  5E4W C;  3Q23 A;  4PMW A;  3VYS A;  2NVT B;  2MJ8 A;  1CA6 A;  2OT2 A;  2DY7 A;  1PRT B;  1PMR A;  2XSC A;  3A56 A;  1U4L A;  2PYK A;  4H13 C;  1BOS A;  3EQL C;  3ERO A;  2F0K A;  1EQV A;  4RHR A;  1G2T A;  1A3T A;  1LT6 D;  3V2T A;  4X3U A;  4HN7 A;  1A2T A;  4C3J G;  3S1N B;  2GA4 B;  2F4I A;  1DOL A;  3KF8 A;  3OIQ A;  2K1B A;  5CV4 A;  3J7A F;  1OXS C;  2R3Z A;  2H1E A;  3QOJ A;  2N88 A;  4B9X A;  3F2U A;  2CW0 C;  2EJM A;  2F0N A;  1EY9 A;  1SE3 A;  2Q8R E;  5FO7 B;  1EOT A;  1B9N A;  1XXG A;  5D65 A;  2R6G A;  1SE2 A;  4OIK A;  1ILP A;  2F0M A;  3GTJ B;  1ET9 A;  3QIA A;  3GP7 A;  2FFK B;  2MPM A;  2WIN B;  4C3J B;  5DM6 3;  3H91 A;  2D62 A;  3J7A V;  4ZRZ A;  2J7Z A;  1GUG A;  3HOU B;  3T4A C;  4DA2 A;  4BA2 I;  1PTO H;  4RA8 A;  3QJY A;  2EDG A;  1BCP B;  4F7X A;  2QCP X;  4IUP A;  2RA4 A;  1Z6H A;  5AFW A;  3M7N A;  2AWO A;  1GXD C;  3K57 A;  3AMU A;  4H44 C;  3DHQ A;  4C3I G;  1EY8 A;  2IX3 A;  2L12 A;  4M1U B;  1HXY D;  4BY1 B;  2B2U A;  1HTL D;  2EY5 A;  1SXT A;  3C1F A;  5C5M A;  3MXU A;  2CVR A;  4ZUJ A;  5C0X J;  4KKS A;  2NWG A;  2EYP A;  1ROD A;  2KEE A;  3D4W A;  3GTL B;  3X3M A;  4I7Z C;  5FOB B;  1AW7 A;  3H3V C;  5IGC A;  1HHV A;  4N9P A;  4ILW A;  3DMU A;  3KLR A;  2RBM A;  2RDH A;  2LFN A;  1Y1V B;  2ZT9 C;  1V8Q A;  5LL6 X;  1E2W A;  5I6Y A;  4FNF A;  3SE0 A;  4XYO A;  1HFN A;  1HA5 A;  3OW7 A;  2RKS A;  5IGE A;  3SVM A;  3BVM A;  1EY5 A;  3HP3 A;  3BDL A;  3VR4 A;  5CV7 A;  2E76 C;  1L0X B;  4FF3 A;  1BCP D;  5C0X I;  5EKK A;  1SNC A;  2EXZ A;  1HRJ A;  2RDF A;  3DWQ A;  3TP6 A;  2B2Y A;  2I46 A;  5CMD A;  1PFB A;  3DXJ C;  3M85 A;  5IGB A;  5EKI A;  2KA7 A;  4A3M B;  1KDC A;  4FVM A;  1BUV T;  1HCZ A;  3D3R A;  1JC7 A;  5M3F B;  2JYO A;  1HPC A;  3IFT A;  1KTK A;  5C4X B;  4A3J B;  5T1G A;  3ZYY X;  1DM0 B;  1EY7 A;  4IUU A;  2IJ0 A;  2PPB C;  1O80 A;  2NYZ D;  2A6H D;  4XXE A;  1CT1 D;  3J80 L;  2I07 B;  1B53 A;  1MI2 A;  2F03 A;  5C3X A;  3J81 L;  3P75 A;  2PO4 A;  2OEO A;  4CBV A;  3I4M B;  3K5M A;  1Q1E A;  4BS9 A;  1LTI D;  1BQQ T;  2B8F A;  1PXU A;  2WP8 J;  3UI2 A;  3W2D A;  5KEE A;  3CHB D;  4A3I B;  4F88 A;  1G29 1;  2BE5 D;  2F0I A;  2VNU D;  1EIH A;  2RVL A;  5FLX L;  3MVV A;  4RH6 A;  4GZY C;  4FP5 D;  5I9O A;  1EU4 A;  1S5B D;  2Y0S B;  1NSN S;  5M3M B;  4FF1 A;  3MFY A;  1AN8 A;  2A68 C;  1ENF A;  4TRD A;  1EZ6 A;  3IKJ A;  2BCO A;  1GUO A;  4ME5 A;  1I4P A;  2Z1C A;  4CKC A;  2EYF A;  1H9S A;  5CV5 A;  1VF7 A;  2H4O A;  4O42 A;  2MP1 A;  4B9W A;  3D31 A;  3EJI A;  4K6L A;  4DK0 A;  3D6C A;  1IKM A;  2WKD A;  4HCE A;  1IW7 D;  4PMB A;  2JSO A;  1VF5 C;  2FHT A;  3NTK A;  4KY5 A;  4CKE A;  1RHP A;  3IFD A;  1ESF A;  5C3W A;  1AP0 A;  2NTS A;  1Q12 A;  3NK9 A;  1C4Q A;  1MD2 D;  2OXP A;  2ZXP A;  4RGM A;  4U68 A;  4K8J A;  4IQZ A;  5JEA G;  3GO5 A;  3BDC A;  3SK4 A;  2EYM A;  4KD3 A;  3MA2 B;  1EYD A;  4G7Z C;  3AU7 A;  2N55 A;  2NZ1 D;  5C6A A;  4G7O C;  3E6Z X;  4HCS A;  2SOB A;  4G7H C;  5JEA H;  2XWJ B;  2B2T A;  3RUZ A;  5FK9 C;  3NUC A;  5CYU A;  1OO9 B;  3I90 A;  4RGN A;  3BS1 A;  4B08 A;  3PV0 A;  3G4O A;  2M00 A;  4K8I A;  1TWA B;  4DGZ A;  2PNR C;  4R9W A;  3NWS A;  1PTO D;  1LTB D;  1Y8P B;  5C4Z A;  1JOK A;  4LMQ D;  4G4K A;  1D1K A;  2KUM A;  2J4X A;  3TME A;  1F9P A;  2BA1 A;  2K32 A;  1SFO B;  3SK5 A;  1R4Q B;  1V1P B;  4ZYS A;  3D4D A;  1SDF A;  1R4P B;  2B2T C;  2HDM A;  3RZO B;  1KNA A;  2KED A;  1EYC A;  3PUZ A;  5EBC A;  3M4O B;  3FVQ A;  4DAY A;  3GTP B;  1QWY A;  1Z52 A;  1WD0 A;  1SMY C;  2XWB B;  5C0X H;  1KAB A;  2FIN B;  2AWN A;  3T16 A;  2CW0 D;  1PRE A;  4EVO A;  3FEW X;  1SNO A;  2JXM B;  5I2X A;  2WII B;  4RAU C;  4A93 B;  1EYA A;  1PLF A;  2PW7 A;  3WOE A;  1ONL A;  2DN8 A;  3KLS A;  3VR2 A;  2QDB A;  3M3Y B;  1I50 B;  5FKA C;  1LV9 A;  2HQE A;  3K6O A;  3OHX C;  3TBI B;  4NKL A;  4K6D A;  4EQP A;  2PZU A;  1U4P A;  1A3V A;  1F2M A;  3HOV B;  5IT9 L;  1G6Z A;  3CU7 A;  4WOR A;  1RKN A;  1FGB D;  2NBF A;  3OPO A;  5A2Q L;  3Q22 A;  2F0H A;  2L9H A;  4MN3 A;  2R7Z B;  2E2J B;  5CV8 A;  3T13 A;  2D9U A;  2BA0 A;  1SND A;  1HA6 A;  1A2U A;  2M9V A;  3S17 B;  1LTR D;  4C3H G;  3P1H A;  5JVH 3;  3G7L A;  3DEP A;  1RF2 D;  2EY6 A;  3BDO A;  2K28 A;  4QMG A;  3SEB A;  1J9O A;  3WOF A;  1FYC A;  3SXH A;  1PRT C;  2XIW A;  3S9W A;  5HUR A;  4NP5 A;  2A68 D;  1I6H B;  3EFX D;  1JOR A;  4S3S A;  3NTH A;  3RLF A;  5A2Q E;  3HOW B;  2VUM B;  4KJN A;  1JOO A;  2K5D A;  4R8N A;  1RJT A;  4OGQ C;  1HQR D;  4U67 3;  1PDQ A;  2QF7 A;  3BYY B;  3P7J A;  1DOM A;  1T5X D;  2B2V C;  4CGY B;  4YIJ A;  1B50 A;  1M4V A;  1VMC A;  2EYL A;  3LWU A;  3FDT A;  2FMC A;  2RQX A;  4ZK9 B;  1SEB D;  1JWM D;  2D2C C;  1WTR A;  4HSP A;  1DXM A;  1E0B A;  1OXT A;  2BDO A;  1ZEQ X;  1PFN A;  5K36 G;  1TR5 A;  3D4R A;  5IOC A;  1B3A A;  4CHT B;  2EVB A;  2AUK A;  1TKW B;  4H0L C;  3EVQ A;  1UEA B;  1D2B A;  1CTM A;  3NXW A;  4RKB A;  4OL7 A;  2F0Q A;  3DEO A;  3BYT B;  5C3E B;  3TZU A;  4EGV A;  4FF4 A;  3LNN A;  3M4Y A;  1WTX A;  1YNJ D;  5JJZ A;  1CM9 A;  3GQB A;  3A7A B;  1B2T A;  3CRL C;  2JA6 B;  2EPB A;  5E3F A;  4ID6 A;  5IT9 E;  1QJO A;  2F0W A;  2WAC A;  4LK1 C;  1V43 A;  1GUW A;  5HGT A;  1ENA A;  5DAU A;  2L4N A;  3HZX A;  5K36 H;  1DD2 A;  3A55 A;  1EY6 A;  2A6H C;  4K5X A;  2WAQ B;  5CV9 A;  3OWE B;  4FYD A;  2ZXO A;  3SHL A;  1B1Z A;  2XN9 C;  2NVY B;  4KY7 A;  1UUP A;  4QUF A;  3GTK B;  1KDB A;  3I4N B;  5I6W A;  4QIW B;  1K8M A;  4L63 B;  4R8I A;  1AZP A;  4C3H B;  2TMP A;  2VB3 X;  5I9P A;  1BDO A;  3L7Z C;  4KN7 C;  4IFD I;  3DUZ A;  3WDN A;  3NSW A;  1SYF A;  4OIJ A;  4JK1 C;  3QG1 A;  1SNP A;  3S1R B;  1EL0 A;  3GV6 A;  1WD1 A;  3CKI B;  1LTT D;  2MUY A;  1STE A;  1B44 D;  3C0O A;  2K01 A;  3MHB A;  1TU2 B;  2L11 A;  2EYJ A;  4XDX A;  1H9K A;  1QNK A;  1WVL A;  1C8C A;  4A3B B;  4HMJ A;  3EA6 A;  2IWH A;  5TSS A;  3VR6 A;  3AB9 A;  4CJ2 C;  2Z8L A;  3C0N A;  1HQM C;  4MHE A;  4LJZ C;  3K59 A;  3FMC A;  2B2W A;  2EYO A;  2KCC A;  2LY7 A;  3A7L A;  1STN A;  1NCV A;  2K7V A;  5JVG 3;  1WTQ A;  4PMC A;  1Q90 A;  2B2U C;  4Y7N B;  4DN4 M;  3ND8 A;  3R2I A;  4DU9 A;  2JA8 B;  3HGB A;  2E2I B;  1MSG A;  4P2C B;  3C2P A;  1TQO A;  2A69 C;  3FKI B;  1EWC A;  2K5W A;  1GUN A;  3I72 A;  4H7B A;  3I73 A;  3TP5 A;  1BCP C;  1F9S A;  2D5D A;  1XTC D;  1SE4 A;  2DY8 A;  3BVZ A;  3FPU B;  3U9S A;  1EY4 A;  4RWS C;  1SYD A;  5IGD A;  1O7Y A;  4BWG B;  4DNT B;  1WCM B;  1CZW A;  2JA5 B;  1SBB B;  3QWN A;  1F9R A;  4XYQ A;  3RD4 A;  3GD7 A;  3PO2 B;  4OHJ A;  1TS2 A;  1ZXT A;  5DM7 3;  5IOD A;  4BY7 B;  4Q0F A;  1TWH B;  1B4O A;  5E4X A;  1LAC A;  1BBX C;  4FF2 A;  4KK7 A;  1H9R A;  3J7Y W;  1ET6 A;  3DM1 A;  1ENC A;  3J80 E;  3ITP A;  2KHS A;  1TY2 A;  1ZYR C;  1NR4 A;  2L1B A;  1STG A;  5CGK A;  2MGS A;  1JWS D;  4DNR B;  1IHZ A;  4KN4 C;  2NN6 I;  5EGT A;  2C9O A;  2F0G A;  2KEC A;  4KTA A;  1F2Y A;  3OOC A;  2KOL A;  2J0T D;  1VDZ A;  2MHV A;  2K04 A;  1RTO A;  1SYB A;  1UAP A;  4ZLT F;  4ZUI A;  2O5J C;  2QKI C;  4K14 A;  2F0F A;  2RDG A;  2FMM A;  2AQ2 B;  1XX8 A;  1X3P A;  1G8Z D;  1EY0 A;  1GOZ A;  2L5T A;  4KI0 A;  2RSN A;  5I2Y A;  1U9R A;  3ND9 A;  2A5H A;  5DEH A;  3VA5 A;  1JE4 A;  4L6T B;  4ULL A;  4ZQ3 A;  4K2K A;  3S14 B;  4TSS A;  2O5I C;  1DON A;  1E2V A;  1I4H A;  3VR3 A;  1CFM A;  4X3S A;  2KQ3 A;  4KHZ A;  4MIU A;  4PNY A;  4CJ1 B;  1SAP A;  4IZ8 A;  1SYC A;  3QOL A;  3NTI A;  3SK6 A;  3D8G A;  3HKZ B;  5CBE E;  1CI3 M;  2WB1 B;  1STH A;  3NPP A;  1I4R A;  1PZK D;  2PCF B;  1D1I A;  1F77 A;  3C46 A;  3Q6S A;  1DZ1 A;  1K83 B;  2NB0 A;  5BN3 A;  5J39 A;  3E0J A;  1GUT A;  3VYT A;  2ICE C;  2O4X A;  3MEH A;  2VXW A;  4JBW A;  5M5Y B;  2IX0 A;  1ILQ A;  1L0Y B;  1KNE A;  5JOB A;  3L9A X;  1TWG B;  2E74 C;  2A6E D;  1YNN C;  1AZQ A;  3PIP 3;  1TT2 A;  2K03 A;  3JAM E;  4OO1 G;  1UNS A;  2IW3 A;  5C44 B;  4DAV A;  4N9T A;  1S4Z A;  5KNB A;  1BXT A;  2EZV A;  1QG7 A;  3T51 B;  1W6K A;  2F0E A;  3S1M B;  4V0B A;  4NDX A;  1FD7 D;  3PUY A;  3HOX B;  3O13 A;  1LTS D;  1TS3 A;  4C1N K;  1HUN A;  1I4Q A;  3R93 A;  5JPM C;  3NE5 B;  1ML0 D;  5C0X G;  1IL8 A;  5FO9 B;  4C2M B;  4EQO A;  1JB3 A;  1EIG A;  4WRD A;  2HDL A;  3A8I E;  3PUX A;  1JCK B;  4K5W A;  2JEB I;  1YNN D;  4XQJ A;  1QOH A;  3OSO A;  3SR1 A;  4NMZ A;  4C56 C;  1SJE D;  3MAQ A;  1RD9 D;  1S5C D;  3I3C A;  2EY2 A;  1SSO A;  1LAB A;  1VCI A;  1TY0 A;  1KDA A;  4IUT A;  4UDU C;  3KUP A;  2NTT A;  3I4L A;  3HRZ C;  2CHB D;  3NBI A;  2DNE A;  2R61 A;  3G6J B;  2Q8T A;  4CJ0 B;  2NN6 H;  5D14 A;  3MZ5 A;  2FJ2 A;  1EQT A;  1D5M C;  2F0T A;  2L0C A;  2KJX A;  3RMH A;  1J8I A;  4I65 A;  1BF4 A;  5M5W B;  2B2W C;  1FNV A;  5EPJ A;  2XRS D;  1D6E C;  4RCN A;  1OXU A;  2F0L A;  4TQU S;  1ESR A;  2L55 A;  1F2L A;  5C4J B;  3GTM B;  1LO5 D;  3ERQ A;  4FXG C;  4WJW A;  4KKT A;  1BR9 A;  3MXN A;  3DWA A;  1TII D;  3BZD B;  4FO2 A;  2QEJ C;  3VR5 A;  5K5P A;  5ELF A;  4Z9C B;  4IFD H;  4KMU C;  1EFI D;  4J6H A;  4XQQ A;  4PQX A;  1SNQ A;  3KK7 A;  1TS5 A;  5LL6 S;  3U9O A;  2A74 C;  4F8M A;  5BN5 A;  2HUG A;  2ICI A;  1A6X A;  4IFD J;  5KNC A;  1OXX K;  1EEI D;  3SK8 A;  4E6I A;  3H94 A;  5CBA E;  1IKL A;  2TSS A;  2ZXR A;  3PO3 B;  2R92 B;  2Q8I B;  3HOZ B;  1I3Q B;  1CQV A;  3GTG B;  2F3W A;  4QCL A;  5EPK A;  3FRP B;  4X3T A;  3P20 A;  1AFP A;  1HUM A;  4DXF A;  3J81 E;  1HFG A;  1STY A;  3URY A;  5ELB A;  2F0V A;  2HCI A;  5T1I A;  5IGF A;  5JEA J;  1WTV A;  3C0M A;  4ZKC B;  1Y1W B;  3SDZ A;  3MXG A;  2KVM A;  3H09 A;  1M8A A;  3HEJ A;  1JOQ A;  3NBH A;  1DOK A;  2EYH A;  1Y8O B;  2HCC A;  3H0G B;  3K58 A;  4BBS B;  1BCP F;  4A3D B;  2E2D C;  2EJG C;  4ZAI A;  2B63 B;  2KCN A;  1DYQ A;  4IUQ A;  5CR3 A;  4A3E B;  1CHP D;  2A6E C;  2JE6 I;  5EJW A;  1TWC B;  1OXV A;  4J1M A;  2QIL A;  3X3N A;  1D5X C;  4WFN 3;  3N52 A;  4XTC S;  1K8O A;  3NQI A;  4DAP A;  1I4G A;  1LTG D;  3K7A B;  1Z47 A;  1PTO C;  4V19 0;  2JEA I;  4FXD A;  1WTP A;  1KLU D;  3FPP A;  2F0D A;  3BG3 A;  4RKL A;  4LAA A;  3I91 A;  4KD4 A;  5I4D A;  3E5S A;  2A73 B;  2XRQ D;  1FR3 A;  1GHJ A;  2C5C A;  2V4D A;  4NW2 A;  3PIO 3;  1QNU A;  2F0P A;  1NUC A;  2F0S A;  1DJR D;  1F2Z A;  3LX0 A;  1TS4 A;  5LHY 1;  5CC4 A;  2X69 A;  4KHV A;  1S5E D;  2EY1 A;  4XQN A;  1DCZ A;  4XT3 B;  2WV6 D;  2IT1 A;  3OMG A;  4KKU A;  1II3 A;  1I4X A;  4XT1 B;  1C48 A;  3W3A A;  3Q0A A;  4IUV A;  2PMZ B;  3TDQ A;  1MBY A;  3L3O C;  2X6L A;  1V1P A;  4C3I B;  1H9S B;  3NHH A;  1IYV A;  1F9Q A;  1G2S A;  5FLX E;  5A35 A;  4IUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...