1PTOB

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoB01
1BCPD 1B1ZA 1CHPD 1D5ZC 1SJED 1EFID 2G9HD 4DXGA 1LTTD 1PTOF 3TSSA 1KLGD 2R61A 3BVZA 1DJRD 1KTKA 1SE3A 1LTAD 1SXTA 1EEID 3DWPA 3BVMA 1RCVD 5D3IB 5ELDA 1EEFD 1BXTA 3EA6A 1XXGA 1BCPC 1V1PA 1LTSD 1PTOB 1UUPA 3CHBD 1LTRD 3R2TA 1LT6D 2WV6D 3GP7A 1PRTC 4RGMA 2J4XA 4O1NA 4L6TB 4RFBA 1CQVA 1HA5A 1PRTD 1FNUA 3R2IA 3EFXD 5TSSA 2Z8LA 1PTOC 1T5XD 1I4HA 1EU3A 1S5DD 2XNAC 3C0OA 4UDUC 2QILA 1I4RA 4K6LA 3MC0B 3W2DA 1F77A 4Z9CB 4RHSA 1STEA 1ESFA 4DXFA 1AW7A 1TS3A 1S5BD 1PZJD 4RGNA 2SEBD 1LO5D 1FGBD 4RH6A 2XN9C 3SEBA 1L0YB 1B44D 1PZID 1TS5A 2RDGA 4RGTA 3MFGA 4OHJA 5I4DA 1D6EC 2QEJC 2NTSA 3G4NA 1HQRD 1LT4D 4L63B 1SE2A 1PTOD 1FNVA 1TY2A 4RCOA 5ELBA 1ET6A 1PRTF 1RD9D 1FNWA 1QILA 3G4OA 1V1PB 1BCPF 5FK9C 5FKAC 1G8ZD 1S5ED 3C0MA 1D5XC 1M4VA 1V1OA 5ELCA 3URYA 3O13A 4RGOS 1I4PA 3DWQA 2NTTA 1D5MC 3V05A 1SBBB 1TY0A 1JQYD 1JR0D 1TS4A 1LT3D 3BYYB 3BYTB 5D3DA 5ELFA 4ZYSA 1L0XB 3BZDB 1BCPB 4RHRA 1JWMD 1KLUD 1PRTB 2TSSA 2IJ0A 1RDPD 2XRSD 4C56C 1SE4A 3C0NA 2CHBD 1EWCA 1CK1A 1PTOH 1EU4A 1SEBD 1ET9A 1RF2D 1S5CD 4BWGB 3R8BA 3OWEB 2RDHA 2AQ2B 1ENFA 1AN8A 1UNSA 1SJHD 3DWAA 1PREA 3BVGA 5ELEA 2O2LD 1MD2D 1CT1D 2IPKD 2XRQD 1JWSD 1LT5D 1LTBD 1S5FD 1Z52A 1LLRD 1PYWD 3KLSX 1FD7D 1HXYD 1XTCD 4TSSA 1LTID 1I4XA 1I4GA 2AQ3B 1PZKD 1GOZA 1TS2A 1DYQA 1JCKB 1HTLD 1JWUD 1LTGD 2ICIA 1CHQD 2AQ1B 1I4QA
chains in the Genus database with same CATH superfamily
3SK5A 5BN3A 2F3IA 2NZ1D 3ULLA 2O5IC 2G9HD 3SK4A 1Z6HA 2FFKB 3CCQA 4GLXA 1UE1A 2K01A 4CHTB 4KD4A 3K5OA 5IYBG 2KCNA 1EWIA 2YTVA 4LMQD 3HKZG 3MVVA 2R7ZH 2B2UC 2IX0A 3NENA 1LT6D 1CKNA 1J9OA 2JXMB 4C3JB 2AUKA 1L1OC 3AU7A 3K57A 5JEAH 1UE5A 1E22A 4A3BB 3QO2A 2EY5A 3HOYG 4MTKA 1EWHA 1ILQA 4DR5L 2VUMB 3CQZB 2K28A 4NXNL 1U4LA 2VW9A 2NUCA 4BXXG 4A3KG 2F0KA 4P2CB 1EIYB 1KDBA 2NB0A 1VQCA 1S5BD 2KA7A 3MWYW 3SR1A 1PVOA 4N8X1 2RCNA 4LF7L 2NVTH 4BA2I 1A3UA 1MI2A 2H5XA 4L5SA 1IYUA 1L0YB 3EQLC 1H95A 3IKJA 3VR5A 4CKBA 5GAHC 4CJ2C 5C3EG 1SE8A 1RTOA 2PPBC 5M3FB 4KKSA 1ET6A 4GZYC 2UUCL 3C0MA 1PH5A 4A3CG 1V1OA 4JK1C 2JEBI 4LFCQ 4IUQA 2ZTEA 4A3KB 4A3GH 1KRSA 5M5YB 3ZYYX 2HDLA 4JI1Q 2CW0D 1Y1WB 5IGCA 4K6DA 2HCCA 1G2SA 1EWCA 5JEAJ 1TVXA 1SN8A 4BY7B 1Y8PB 1ASZA 3H09A 1Q81C 4WJ3M 1I50H 5CV8A 3MHBA 4DFAA 2B2WA 2FMMA 3S1QH 3K81C 1ENFA 4KHPQ 1AN8A 3HOWB 4DR3L 1I3QH 1HTPA 4YWMA 3STBD 3U4VA 3J80E 4OO1G 3KOJA 5IGBA 2ZJPA 3BG3A 1ML0D 4TSSA 3AQQA 1WCMB 1OO9B 2F0JA 2F0TA 4DV2Q 2KBNA 4IJHA 3OHXC 1JMCA 1JWUD 1IKLA 3ONAB 5E3FA 4DNIA 2UUBL 3HOWH 4DR7Q 2MP1A 3TDQA 4EX5A 3VYUA 1STYA 3S2HH 3T56B 1SNDA 2B2UA 1ESRA 1B4OA 3FKIB 1WD0A 1EEID 1I94Q 3CAMA 1AH9A 5D3IB 4A3DG 4JYAQ 1XXGA 2F0HA 3RN5A 4J15A 4KKUA 3GTLH 3ICEA 1HQMC 4K5XA 2WB1G 3EROA 2B63B 2H1EA 4CKCA 2F0GA 4JI3L 4NDXA 4XYQA 3EFXD 1DONA 2DY8A 3UE0A 1RTNA 1TWGB 1C0AA 1I5FA 1F2YA 2VQEQ 1PYSB 2CH4W 2L0CA 5ELNA 3GTKH 4DUYL 4LFAL 2R92B 1DD2A 4HSPA 2MFIA 2N49A 4X3UA 4E6IA 3V2TA 2ZJQA 3SVMA 4FF3A 4A3DB 4RKBA 4RH6A 5FO7B 3FPPA 3I2ZA 4YCUA 5CGKA 4L63B 1B9MA 3PQIA 1TY2A 3T1YL 1YNXA 3RZOH 1STAA 2IX3A 2I0QA 1U5KA 2JYOA 1BCPF 3QOLA 1NAPA 1S5ED 4R1JA 4YHHQ 4A3EG 1Q12A 4P71A 2NZOA 1RJTA 3STBC 4CDFC 3S2DH 1LT3D 3RZDB 1SSOA 5JJLA 1HA6A 3PO3G 4IFDH 2HD3A 1O7LA 1SNCA 3QB3A 1GUNA 1SE4A 2ES2A 2B8GA 1Q46A 4DV4Q 3GTMH 3RN2A 4A3JG 1TT2A 3CCJA 1VQLA 4JCVE 1E2ZA 1Q3LA 2FINB 1KC8C 2R93B 5IT9E 3PIOA 1EYAA 2QDLA 2BE5C 3PO3H 4XT3B 4AH6A 2MPMA 1SNPA 3G7LA 2EY6A 5I6YA 5AJ3L 2PCFB 2Z9HA 1E1TA 5C0XI 1FD7D 1HXYD 2KUMA 5I2YA 2LXJA 2DY7A 1KXLA 1I4XA 1ONLA 5K36G 1QNKA 3I3CA 4KY5A 1M1KC 4C3IH 2ICIA 3PUVA 4QL5A 1YNJC 2IHFA 3KDFA 4G7OC 2JN4A 2Z6KC 2F52A 3GTPH 1YJWA 2E2HH 1VMCA 1Q8IA 3T51B 1VQBA 3S1RB 4KHPL 1O80A 4GNXB 2XSCA 5ELDA 1STGA 4OWXB 2VQFQ 4A3FH 4GN4B 4LF7Q 2K75A 2KEEA 4H7BA 3NTKA 1D1IA 5J3BA 3I72A 1N33Q 1HCZA 2Q8TA 4QQBX 3PUYA 1X56A 5FLMG 4WJ4A 5C4ZA 1WCMH 4L6TB 3K80C 2KHJA 5JPNC 1AZPA 4C3JH 1JOQA 1EQQA 4B3TQ 4K14A 4XT1B 5E1FA 3Q24A 1NUCA 3MC0B 1G51A 3CC4A 1F77A 1O7ZA 4DR4Q 2NYZD 3WDNA 4QY7A 1T5EA 4V0BA 1NR2A 2SNSA 1LO5D 3I56A 2EYFA 2MQHA 3D6WA 2DUDA 1SDFA 2KEDA 3HKSA 3JAML 3HP3A 3J81E 2QEJC 2X6GA 3HFZB 5FLMH 5C4HA 1E7ZA 5NUCA 5IYCG 2MNAA 3TS2A 4L5RC 1G8ZD 3K6OA 3KJOA 3M7GA 4FYDA 3O13A 4APVA 1I4PA 4JBJA 5GADC 1JQYD 1A6XA 4BBRH 1WYDA 3KJPA 4RHRA 4IFDI 2JSOA 1PA6A 3HKZB 1ENCA 1K28A 4IALA 2ICEC 5HGQA 1DOLA 4S3SA 2Z0SA 4Q0FA 5D65A 3ND9A 5HURA 4V190 4GOPB 4LNQA 4B3RQ 3A8KE 3P20A 4A3IH 5E4XA 1I94L 4DAMA 2K5DA 3HKZE 4F7XA 1S4ZA 1PREA 3E0EA 1PH9A 1MHWC 4QMGA 2QW7A 4R9WA 1LT5D 4G4KA 1QZHA 4IO9A 1N34Q 3LWUA 2NVYH 4NB3A 2OF1A 1Y8OB 1X3FA 2AWNA 4HEDA 3NSWA 2BA1A 1SMXA 1B3AA 2CWPA 2F0LA 1J8IA 2GN5A 5JJKA 4RG1A 1TXYA 3FMCA 4QB4A 1GUGA 2RF4A 3TSSA 1XNRL 1KLGD 3CXCA 5EPKA 3H0GG 3BDCA 5C0XJ 2YTYA 2JA6G 1K8OA 3TP7A 2D5DA 2F0FA 1UUPA 3SXHA 5AJ3Q 1X55A 3NPPA 2EY1A 1X3QA 3IAYA 3J80L 1TWAH 2V4DA 1WJJA 5M3MH 2EYJA 2WAQE 4ZRZA 3QWNA 1NMGA 1L1OA 3FKIG 1JE4A 2KOLA 3W3AA 3TREA 2JEAI 1B3QA 1C7YA 3CMEA 2G5DA 3ER0A 1TIID 4LF4L 5CYUA 4IFDG 1PH4A 5A2QE 1CQFA 2UUAL 2QCPX 4H13C 4PMWA 2RSOA 3CRLC 5LL6S 4HTHA 5IGFA 1EYDA 3NELA 4CGYB 4F87A 4JI8L 3CC7A 1KDCA 1KAAA 2SOBA 3S14B 4BS9A 1VF5C 1TWFB 2OTLA 3HG9A 4OWWB 4QF4A 4EQPA 4FXDA 1LM0A 2WIIB 1AZQA 2VS1A 3A54A 3DWQA 2NVQB 1D5MC 3V05A 3H3VI 3I4NH 5D3DA 1V1QA 4BY7G 5M5XB 2A19A 3OSOA 4DR2L 1CZGA 3T1HQ 4F8MA 2EJFC 1I6HH 1QVGA 4OELB 5IY0A 3NK9A 4Y52H 3CPFA 2Z6BA 4UP9A 2QGQA 3M85A 4DU9A 4JW0A 4X3KA 4ZKCB 4PQXA 4ABNA 5C3XA 2HDMA 1XPOA 1IL8A 4IUPA 3D3RA 2E2IH 2O2LD 2FXQA 2A68C 2LSSA 4CKEA 2P5ZX 1F9QA 2GVBA 2VL6A 2F0SA 2QF7A 3VA5A 5GQOA 3I4NG 4OO1I 1ZYRC 5M5XH 1W3SA 4NW2A 3RLFA 4BBRG 5C0XH 4KN7C 1YHQA 2IY5B 4JVZA 1DYQA 4A3GG 1N32L 3C3LA 4OIJA 4P75A 2MUYA 5M9OA 1EFWA 1X3GA 2F0VA 2Y0SB 1EFID 5HGTA 1E1OA 2Z4HA 4ZUIA 2MO0A 4ODGA 2NWGA 2XWBB 4MIUA 3X3NA 1L1OB 4ID6A 4EVOA 1S72A 1K0SA 4K8JA 3PUXA 2VUMG 2XTIA 2F1MA 1CA5A 1J6QA 2PNHA 3MXNB 3AMUA 1SYEA 1LUZA 1IBLQ 1QE6A 2Q2HA 3TMEA 2NBFA 1Q1EA 3NHHA 4NXML 3PIO3 5IYCH 2N8NA 2OQKA 4XQJA 1EZ6A 4KLKA 4DF7A 4FF4A 4DV2L 1X9NA 2Z4IA 4F88A 1XTDA 2I5MX 4A3BH 4A4IA 4OX9Q 1EY5A 3A74A 3W2DA 4KJOA 1MIUA 3LWEA 3E3XA 2KHSA 2LS01 1EIHA 3MXUA 3C46A 3F8TA 1D6EC 4TVAB 1JICA 1TQOA 2Z6KA 3SE0A 1JB3A 1OXXK 3J81j 1IHZA 3CQZH 2NVYB 1FNWA 2K6AA 2WACA 1E24A 3JAMc 1VCIA 4OL7A 5FLXE 1VQ7A 2WAQG 1FGUA 1KHIA 1K8MA 3S16B 3S2HB 2MJ8A 2PNRC 3BYTB 5C44H 2CWAA 5GROA 1PFMA 1BCPB 1Y1VB 2UU9L 3U4ZA 3OIQA 1I50B 2IJ0A 2WAQB 4KI0A 3A7AB 1PH6A 1XPUA 3T4AC 4C56C 1HRJA 3OTOQ 3Q23A 1CTMA 1ET9A 3I4OA 1Y1WH 4MNOA 4P74A 1YITA 4L8JA 1HFGA 3M7NA 3GTQH 4EGVA 3LGJA 2C9OA 2ZXOA 1R4QB 2GVAA 3NEMA 4QJFA 2JA7H 3S1QB 3CF5A 5LL6X 3VR6A 2A68D 4DK6C 2B3GA 5M5WB 1EL0A 5CV9A 1EY4A 2F0MA 2PYKA 2K14A 4ILWA 4JI7Q 1F9PA 1IW7D 3FVQA 2X6LA 4DXGA 1O78A 2CFMA 2N88A 4A3GB 1TKWB 3GTGH 5A2QL 5EBCA 1SLJA 5C6AA 1GHJA 1IBML 3DHQA 1YJ9A 5CC4A 1WTVA 3D4DA 1STBA 1BCPC 1E0BA 3S1NH 2O5JC 1GM5A 2XWJB 1WFQA 2IX1A 3HOUH 3F2BA 2EDGA 3CKIB 2VQFL 1DGSA 2HIVA 5IP9H 1YVCA 2L55A 3GTLB 1D8LA 1S5DD 3VA7A 1VQEA 2JA8H 2AMCB 4NKLA 4LF9L 4OXPA 2KHIA 1STEA 1Z7TA 4B3ML 4DXFA 1HH2P 2ZT9C 4QIWE 4LUVA 5K5PA 1FGBD 1MSGA 1EIGA 2F0PA 4DR1Q 4LF6Q 1B44D 1PZID 4OGQC 4C3HG 2VB2X 4OHJA 1SFOH 4LUZA 5DEHA 2NTSA 3RMHA 1SE2A 2PMZB 3HOZG 1IBKL 2R7FA 4RAUC 2K5NA 2I5LX 1Q82C 4WORA 4HSVA 3M4PA 5FKAC 2NN6H 5IYDG 3GTJB 3K0YA 1SMYC 3KF6B 4LF8Q 1HUNA 1TY0A 4JYAL 1Z9FA 1RIPA 2JK8A 3A8JE 4R4OA 2A69D 2NVXB 1F2MA 1JWMD 3CCLA 1C48A 3PF4A 2B2WC 2SDFA 4R8IA 3W5OA 3H94A 1NJIC 2ID0A 3A5ZB 1VQIA 1BVSA 2NN6I 2RA4A 2Q2TA 1M8AA 3G6EA 1N36L 2UXCQ 3DMUA 4FO2A 1GUWA 3K8AA 4WRDA 1KQSA 1UE7A 4DV6L 1HNWQ 2K33A 3OPOA 1F9RA 3KF8B 3CCRA 2PZTA 1BO0A 1S5FD 1X3EA 3D8GA 2B63G 3NWSA 4NXMQ 4JPBW 1CZWA 2HIXA 4PNYA 1Q86C 1K9MC 1LTGD 2EJMA 2WKCA 2VUMH 2QA4A 3J7YW 3A56A 3A7LA 4DUZQ 1B50A 4TKOB 2NVQH 3BU2A 1SYDA 3JAME 1GO3E 1KAWA 1KTKA 3G48A 3R3OA 4B3RL 1A62A 5JEAG 1XMQQ 1DZ1A 4RMFA 5IGDA 3D4WA 3IL8A 5J1ZA 3QOJA 1GKHA 1GUOA 1XNRQ 4N9PA 4HR7B 3J7AF 2JA7B 4QGUA 4RGMA 5FO9B 3J80c 4LFAQ 4DUYQ 1A63A 3U9SA 3K7AB 3A0JA 1PYBA 2WFWA 1C4QA 4JOIA 1IYJB 3E5SA 1EU3A 5C5MA 3M3YB 1VQHA 5IWAQ 2YU9B 3TP5A 4X3TA 2PZUA 1B53A 2A6ED 3Q6SA 5C44B 4ZLTF 2K4KA 3CCUA 4PZ7A 2H4OA 2F03A 4RGTA 2R3ZA 3E0JA 3MFGA 4OEMB 5I4DA 3OTOL 1G6PA 4G57A 4IJLA 2IT1A 4A3CH 1C8CA 1CSPA 3ITPA 3I4MB 1PTOD 4A93G 4GN5A 1B8AA 1YNND 4IPCA 1D5XC 3D31A 4RA8A 3RLOA 3NP8A 4C3HB 3L3OC 2N55A 1SMYD 3K5MA 4JI5L 1U0LA 3GV3A 4K5WA 3KK7A 4YWKA 4DV7L 4LF4Q 1HNXL 4ZK9B 3U58A 5C4XB 1ILPA 4JI5Q 1S5CD 3EN2A 1BDOA 3TQYA 1UNSA 1B9NA 2JA5H 1IZ6A 2AUJD 4LJZC 4O42A 3G71A 4JI8Q 2IPKD 4K2LA 4OONA 3R93A 3HOVH 2EYOA 1LLRD 1II3A 3VYSA 2OQ0A 2ZTCA 5FOBB 1LYLA 5FLXL 4PMCA 2O4XA 1HTLD 4PZ6A 5EQ0A 3ULJA 1EY0A 5IGGA 2VXWA 1IBKQ 2EYMA 2OTJA 4C1NI 3J80i 1VQKA 5IT9L 2A74C 5D14A 4DNTB 4A93B 4DR3Q 3DWPA 2KCCA 3ERSX 4POGA 4DPGA 4DV1L 1NE3A 3I7FA 3K7UC 3GTQB 4KMUC 4IPGA 2EXZA 2MO1A 4XXEA 2Z8LA 1XMOL 1T5XD 2F0QA 1GXDC 4IN3A 1DOKA 2K1BA 1CKOA 4IUVA 4PV1C 3I4LA 3AYHB 5DLQE 1QWYA 4FF1A 1KNEA 5GAEC 3NBHB 1HHVA 1VQFA 3NE5B 3GO5A 5ISRA 4A3EH 3HOYB 3AFPA 1TWHH 1PXUA 4LWCA 5LMNL 4KV6A 1FNVA 5CBAE 4K0KQ 4K5VA 1PH8A 2ASBA 4K2KA 3GTMB 2QKIC 4LF5L 1UEBA 4DR6L 3URYA 3I70A 4LUOA 3PO3B 4R4CA 4QUFA 3PIP3 1KLUD 2G9DA 3GDEA 3G4SA 4KD3A 4KTAA 1VQPA 2Q8RE 4A3EB 3HOYH 3DUZA 4QCLA 1EOTA 2OT2A 5G3LD 2E8GA 2MGSA 2AKWB 5KYLA 4A93H 2WB1B 3S17H 5KYIA 3ERQA 4OX9L 4GNXC 3K5NA 3PO2G 1U4RA 3KF8A 1H9SB 3BVGA 2OWOA 5FJ8H 4KHVA 3W1BA 3UDGA 3L2PA 1MD2D 3F2DA 3GTPB 3TRZA 4GLAC 3IRBA 2LY7A 3FEWX 4GOPA 1MBYA 3M4OH 4HIKA 4CDCC 1PZKD 4JI3Q 1DOMA 2UXDL 1U4PA 3OMGA 2A69C 4ULLA 4H44C 3S1MH 1YHAA 5IGEA 2F3VA 1CA6A 1PTOF 4XDXA 4H02A 4MTNA 4A3MB 4U673 1LTAD 1LV9A 3BS1A 1FYCA 5EGTA 2XGTA 3EA6A 5JAVA 4FXKC 2Z1CA 5FJ8G 4JI0Q 3HOVG 2KJXA 4GKJQ 4PG3A 4R4TA 1HJPA 4CDDC 3L0OA 4GS3A 1STNA 4DAYA 2F0UA 2DN8A 2IW3A 4P72A 3R2IA 1PRTD 2WB1E 5KIXA 1A2UA 3CU7A 3HRZC 3HOXB 2L12A 1I4HA 2JQOA 2ZXPA 1EY8A 3PIPA 4OO1H 3J7A5 3ZJYC 1AW7A 5LHY1 3CCSA 3PSIA 1VQ8A 3M3YH 1Q1BA 4A76A 3LX0A 2QDBA 4ME5A 5LMNW 4R8NA 1H9RA 1FR3A 1CI3M 5H1SE 3HOWG 1N32Q 1P8LA 5CV7A 4POFA 5E7NA 1X3PA 1DXMA 1SROA 1FVIA 4XQQA 1VQDA 3HOXH 1H9MA 3I73A 3KF6A 2XVSA 3GV6A 3HS0C 3TP6A 4DR5Q 2QEXA 2K52A 2PO4A 3T53B 3DXJC 2R7ZG 2PI2A 4ZYSA 5KNDA 1JR0D 3JAMi 1K8AC 3OW7A 5IYBH 2EQSA 1L0XB 2PZWA 1GUTA 3DEOA 4JI7L 3SHLA 5IOCA 3HOXG 1PH7A 1QOHA 2A6HD 5FO8B 3C0NA 4I7ZC 1EU4A 1KL9A 4YWLA 4A3BG 3MXGA 4I7AA 4DR2Q 3OWEB 4IOCA 2AQ2B 2YYZA 2KENA 3FKIH 3HZXA 1A2TA 4X64Q 1E2WA 1MSHA 2HHHL 2F0DA 5JJIA 1EZ8A 4LF5Q 1SAPA 1HR0Q 4BY7H 2A8VA 1Y1VG 3S15B 1CUKA 3MXNA 5M5WH 1BCPD 2B8FA 4B3TL 4DR4L 3CD6A 5C3EH 1TWGH 3M4YA 1D5ZC 2K04A 3D4RA 3QR8A 3K0XA 1V8QA 1XX8A 1V9PA 3A5UA 1QVCA 4LFCL 3CCVA 3KFUA 3J81i 4FNFA 3HEJA 1SXTA 3HOUG 1AEXA 4DV6Q 4PMBA 5CORA 5IE8A 3RLNA 3SK8A 2PQEA 1BBUA 1JE5A 1X54A 4LFBL 4X62Q 4HJ8A 1NR4A 2F0NA 2J4XA 4O1NA 2NVXH 2D62A 4AYBB 3H0GB 1G291 1BOSA 4KY7A 1PFNA 1BQQT 2B2VC 3UDXA 5LMUL 5IODA 1PFSA 3TS0A 2IWHA 1HNWL 2UU9Q 1E2VA 2EYLA 1SFOB 2K5VA 1FL0A 3P7JA 5K36H 2AHOB 5JJZA 3W1GA 2CW0C 4HIOA 3I90A 5KNCA 4GOPC 4JI0L 1W6JA 4GKJL 2M2LA 5I6WA 4ZUJA 2R7DA 4C3IG 3SDZA 1UAPA 3GTOB 3KBGA 1AFPA 3P75A 3BDOA 1VQMA 1N34L 5ELCA 1M4VA 2B2VA 4AYBG 2JA6H 4C3IB 5LMUQ 3J7ZC 4DA2A 3RNUA 2KCTA 2EZVA 4LF9Q 1Y69U 4FXGC 3OMCA 4DR6Q 2DNCA 4JG2A 1VQJA 1T9HA 1EYCA 1O7YA 4ZQ3A 3CW2C 2JA8B 3QG1A 4DR1L 1W2BA 4BWGB 5DM73 2XIWA 1XMOQ 5G3LF 5IP9G 1ICFB 4OWTB 2RDHA 3TP8A 3T1YQ 1ZXTA 1B2TA 3UE1A 2BA0A 4HN7A 4O2DA 3UI2A 2D0OA 4AQYL 2JA9A 1CT1D 2XRQD 4A75A 1JWSD 2Y0SG 3OYYA 1LTBD 3U50C 3KLSX 1X32A 2EIFA 5EAYA 1VQ4A 3BJUA 2RVLA 1I3QB 3NXWA 5EKIA 5L37A 3CMAA 1JCKB 5BR8Q 1CM9A 4Q5VA 1WVLA 2FHTA 1SYFA 2Y0SE 3QIAA 1B1ZA 3C1EA 4Y7NH 1CHPD 1SNMA 2KQ3A 1NBWA 1XJVA 4BBSH 2LXKA 5C4JH 3MTSA 2AWOA 4IUUA 2A73B 3A8IE 1TU2B 1R4PB 1EY7A 5JPMC 3CHBD 4FF2A 3PO2H 2OEOA 1LTRD 4DAYB 1K0RA 2FJ2A 4M8AA 3VYRA 3GP7A 1OXTA 2MHVA 1IYVA 2J0TD 2A6EC 3H3VH 1PHJA 5DNFA 3S14H 1CQVA 3J81c 5JVH3 4JI4Q 1SYCA 2M9VA 5M3FH 4BBRB 4A3IG 4UDUC 5JOBA 2K05A 4JC0A 3MZ5A 5EPLA 1JJGA 4G7ZC 1UE6A 1K3BC 1X6OA 2I5HA 3E9HA 2VB3X 3P1HA 3PV0A 1HR0W 2X69A 3Q22A 3S1MB 5CMDA 4BBSB 3MEHA 3PGZA 4HJ9A 1HPCA 1N36Q 4RCOA 3I55A 3KLSA 1K3RA 5E4WC 1PMRA 3G4OA 2RHQB 3K5LA 3WWVA 4A3FG 3H91A 2VY3A 3V96A 1PV4A 2D0PA 2VNUD 5EPJA 1TS4A 2ALYB 4IQZA 3C2PA 1RKNA 3K7AH 1YNNC 3VYTA 4JBWA 1OXSC 1BR9A 1A3VA 1D1KA 4YCVA 3S1NB 1TWCB 1VDZA 4WFN3 2EYHA 2IHEA 2PQAA 4BY1B 5IP7G 2EYPA 3VR2A 4C2MH 1EQVA 3DWAA 3L9AX 1K8GA 2B63H 2HQLA 4HJ7A 3GD7A 4X62L 4XQNA 3OW2A 4A3LG 1BBXC 3U9OA 1YBYA 1TWCH 1I4GA 2AQ3B 2RDFA 3RD4A 1GD7A 1XYIA 2TMPA 2FMCA 3MEFA 3CRKC 1CHQD 1I4QA 1FJGL 3GQBA 4K0KL 1HR0L 1LABA 2PW7A 4C2MB 3TZUA 1YI2A 4DGZA 4RWSC 2R61A 1KIXA 3OWFA 2L4NA 2Q8IB 5ELOA 1G2TA 1QUQB 4DNRB 1IXRA 1WCMG 2CQOA 1V1PA 1L0WA 3SGIA 4IUTA 1QNUA 4HMIA 5HY6A 4HIMA 4AQYQ 3D6CA 4X65Q 5F2DA 4CJ1B 3KBXA 4G7HC 4NPSA 1WI5A 3RUZA 4KK7A 1HA5A 3EBEA 3KLWA 3PO2B 5BR8L 2JA5G 4C1NK 4JBMA 2K5HA 1EYGA 1I4RA 4I65A 5KNBA 2L1BA 4RHSA 1DCZA 1S40A 2NZHA 1HZBA 1TS3A 4YY3L 3K59A 4FDBA 2EXDA 1TS5A 4JI6Q 3FPUB 2CKZB 4N8FA 3TEHB 5GAGC 2F4VQ 2B2TC 1GVPA 2UUAQ 1PRTF 4DV0L 4GNXA 5M3FG 1YJNA 1PFBA 1QB5D 2DGYA 1CKMA 3T1HL 3S9WA 4DAPA 2WKDA 3Q8DA 1YEZA 2B39A 2RKSA 4ALPA 3BYYB 2HUGA 4Y7NB 3BZDB 4CJ0B 1QVFA 1PRTB 2TSSA 4B3MQ 4PZ8A 4DV3Q 2K32A 3S17B 2CHBD 2ZXRA 2HT1A 1E3PA 1VQGA 2BH8A 1CKNB 3BZCA 5CBEE 1MJCA 1X65A 4EQ5A 1VQNA 1SJHD 2R93G 2YTXA 5C0XG 4X6AH 4BY1H 1JORA 3S16H 2F0IA 1HZ9A 1IW7C 1SRUA 4DV3L 1JC7A 2R93H 1HNZL 4DN4M 4N9TA 2AQ1B 1VQOA 2OCEA 4DV0Q 4UPAA 1WTRA 2UXBL 1DJRD 4YHHL 1VQ5A 1IBLL 2JE6I 3BVMA 3DM3A 5C44G 1BXTA 2M00A 5DM63 1PDQA 5JVG3 1F2ZA 1HZAA 1BBWA 2WV6D 3NQTA 4FVMA 4B08A 3EVQA 1WTHA 5IWAL 1PH2A 3LNNA 3NBHA 3NTHA 2LKVA 2L9HA 2KVMA 4IURA 2F0OA 2KECA 2R92G 1U9RA 1STHA 4DK3C 2QILA 1GJXA 4K6LA 1YNJD 1FJGQ 2DNEA 1BNZA 4Z9CB 1SR3A 3PUZA 2JA7G 2HHHQ 3I91A 4B3SQ 2F4IA 2WP8J 2EY2A 5CR3A 2BOSA 1HZCA 3ULPA 2XN9C 1V43A 3MA2B 2PQAB 2L5TA 4HJAA 4JOIC 5COYA 3G4NA 4JBKA 1AE3A 1HQRD 1BUVT 3PMFA 3S1RH 3N6RA 4L5QA 3KYHC 1B7YB 1H9JA 3FP9A 4A3FB 4LK1C 2E5LL 4X3SA 5LMNQ 4RGOS 4ME3A 2NTTA 4MHEA 1WTPA 5ELFA 2E5LQ 3RZOB 2WINB 1ZYRD 2A5HA 3PCOB 4DUZL 2RBMA 2PMZE 4X65L 1Q8KA 2EOTA 1CK1A 1VS0A 1PTOH 2BH2A 2I46A 5C3WA 1QUQA 4DK0A 2B2YC 4GLVB 4YIJA 3JC66 2A6HC 1U4MA 4FP5D 5A35A 3S24A 4EQOA 1PYWD 2D2CC 4QIWB 4UHVA 3VDYA 5BN4A 1GOZA 2E2IB 3CCEA 2ATWA 1OXUA 3H6MA 2DJGC 3AFQA 3N52A 4WJWA 4JI1L 2F4VL 1LACA 1WOCA 4DV5L 1LTTD 4DV4L 2F3WA 2Q2IA 1SE3A 4RCNA 1RCVD 2LMCB 5IIFA 2JP1A 1LTSD 3WOFA 5T1IA 3S15H 2E2JB 3KDFB 2YU9H 3NTIA 3S2DB 4DAVA 4OIKA 1Y1WG 1D7QA 1CSQA 2JJQA 1KRTA 3GTKB 3QJYA 5KGUA 5J39A 1QG7A 1VQAA 2ZJRA 4KHZA 4HCEA 1JOKA 3E9IA 4LF6L 4HCSA 3NWTA 2ZM6L 1XNQL 4GKKQ 4HAEA 1HNXQ 2E2JH 2EE1A 1SYBA 2JA8G 3RZDH 4LAAA 3PF5A 5C3EB 1K73C 1G6ZA 1N8RC 1P16A 1LTLA 4J1MA 2UUCQ 1NMFA 5IT9c 1WTQA 4M1UB 5IP7H 1KDAA 4YY3Q 3MFYA 5ELBA 4B9XA 1QILA 4HMJA 4X64L 1WTXA 3F2CA 2R92H 4B9WA 1YZ6A 3A55A 3FHWA 3E6ZX 3GTOH 5C5LA 2VQEL 5EBDA 4IOAA 4XIGS 1Y14B 4A3DH 4U68A 4GN3B 5C4XG 1GUSA 1TWAB 2BE5D 2HQEA 4IFDJ 2E75C 1XPRA 4B3SL 1SYGA 2JA5B 3F2UA 3PUWA 4C3JG 2C35B 3M4OB 5CV4A 1ASYA 4DK1A 1Z47A 5EKLA 1XWEA 1XMQL 3RR5A 2JA6B 5CV6A 4DV1Q 1F2LA 1NTGA 5FLXc 1PH1A 1Z52A 3I4MG 1XTCD 1C9OA 3CPWA 1J5EL 1ENAA 1QZGA 1A8VA 2K5WA 4TRDA 3MAQA 5I2XA 4ZCKA 2N3SA 3IFTA 4X66L 4K8IA 3WOEA 1YHBA 1SJED 2GA4B 2PW5A 5I9OA 1BF4A 3DLLA 5KRUA 1WD1A 1RHPA 4LW1A 3VR3A 1O7IA 4LF8L 4IPHA 2B29A 4UAIA 1H9SA 2BCOA 4X66Q 1I6HB 1PH3A 4HIDA 2NVTB 3R2TA 3T16A 4TQUS 1EQRA 1UEAB 1DM0B 1NCVA 1PLFA 4KJNA 4DV7Q 1J5EQ 3MXPA 3IFDA 4BY1G 5BN5A 1A3TA 3BDLA 3EJIA 3TBIB 2CQAA 1L2FA 2BDOA 3C0OA 3DM1A 4DV5Q 3HOUB 5DAUA 3H15A 3EIVA 4NP5A 3DEPA 2C5CA 1EY6A 4RGNA 2B2YA 4KKTA 3Q0AA 4A3KH 2RDGA 3K58A 2UXDQ 1EOVA 1LT4D 1RL2A 1CFMA 1JOOA 1B70B 2E2HB 2YV5A 4J8QA 2CVRA 1W6KA 2R7ZB 1WTWA 1GHKA 1RD9D 2E2DC 4BBSG 1BKBA 5T1GA 1NY4A 5FK9C 2Q2UA 4RKLA 4UP8A 1KNAA 4JI4L 3L7ZC 3M9BA 2B2TA 2EJGC 3G6JB 5J22A 3HOZH 4CBVA 2SNMA 5AFWA 1EIFA 4JV5L 4NMZA 4KY6A 1OTCA 1QJOA 2XRSD 5M3MG 4JI6L 2NN6G 5IYDH 1A15A 1EY9A 4A3IB 4IPDA 1ZEQX 3I8ZA 4L5TA 1RF2D 2EPBA 1JJCB 3B6YA 1JJ2A 1K83H 2HCIA 2I07B 1Y8NB 1IBMQ 4CDEC 2PI2E 3FRPB 2DJFC 1Y1VH 3UDIA 1N33L 1Q7YC 5M5YH 2OXPA 3KLRA 3HGBA 3HOZB 1VMPA 4UY8C 5C4XH 1TS2A 2F0WA 4JV5Q 2K50A 3OIPA 4IZ8A 1K83B 1MJEA 2R6GA 4NXNQ 2KCMA 4UP7A 2E74C 4H0LC 1A0IA 1Q90A 1VF7A 4XYOA 1JB7A 1SNOA 4A3MG 3BVZA 2ZTDA 4YCWA 3BZKA 2UXCL 2IL8A 5EJWA 3TZDA 1WTOA 1SNQA 4XTCS 3D0FA 1EEFD 1TWFH 4O0AA 1PTOB 1NSNS 3X3MA 3AB9A 3J7AV 3OOCA 3H0GH 2K7VA 3I4MH 2V1CC 5KEEA 5M3MB 3J81L 1PRTC 3I4NB 1VQ9A 2BDNA 4A3JB 3GTJH 1G91A 2RHSB 1OXVA 4AIMA 4EQNA 2ENBA 3NUCA 4RFBA 5I9PA 1HFNA 2F0EA 1JT8A 1FNUA 5TSSA 1N9WA 1PTOC 2E76C 4MZ9A 1IL2A 3NBIA 1TWHB 2XNAC 4DR7L 1EQTA 3CCMA 1HNZQ 2A1AA 3AEVA 3CP0A 1ZKOA 1EUJA 1ESFA 4ZAIA 4A3LH 2D9UA 3T13A 3UDFA 3C1FA 1PZJD 2SEBD 5EKKA 1TR5A 3SEBA 4QUCA 4R4IA 2ZM6Q 4A3JH 1XNQQ 1AE2A 4KN4C 2UUBQ 4GKKL 3GTGB 1UWVA 1IKMA 4BA1I 1NNXA 3SK6A 2UXBQ 2N78A 4JI2L 1V1PB 1AP0A 3HOVB 1R9TH 1F9SA 2CCZA 4P73A 1VQ6A 4MN3A 3CC2A 3TN2A 2L15A 1SBBB 3FDTA 4JI2Q 2K5QA 3NQIA 4BXXH 3VR4A 1M90C 4LFBQ 1RDPD 4A3MH 1YIJA 2CH4A 4J6HA 1SEBD 3ND8A 4IUNA 3R8BA 2L11A 2VZAA 1KABA 3KUPA 4DKAC 5C4JB 1MKHA 4R4QA 1HUMA 1RODA 5ELEA 1H9KA 1KD1C 1ICWA 1I6VC 4AYBE 1MGSA 2EVBA 2RSNA 3M4QA 4C3HH 2LFNA 4HJ5A 1LTID 1S3OA 2RCFA 4ZKBB 1D2BA 5CV5A 1R9TB 2K03A 3H3VC 3F1ZA 1QCBD 2J7ZA 2RQXA
chains in the Genus database with same CATH topology
3SK5A 5BN3A 2NZ1D 2O5IC 2G9HD 3SK4A 1Z6HA 2FFKB 2K01A 4CHTB 4KD4A 3K5OA 2KCNA 4LMQD 3MVVA 2B2UC 2IX0A 1LT6D 1J9OA 2JXMB 4C3JB 2AUKA 3AU7A 3K57A 5JEAH 4A3BB 3QO2A 2EY5A 1EWHA 1ILQA 2VUMB 3CQZB 2K28A 1U4LA 2NUCA 2F0KA 4P2CB 1KDBA 2NB0A 1S5BD 2KA7A 3MWYW 3SR1A 4BA2I 1A3UA 1MI2A 1IYUA 1L0YB 3EQLC 3IKJA 3VR5A 4CKBA 4CJ2C 1RTOA 2PPBC 5M3FB 4KKSA 1ET6A 4GZYC 3C0MA 1V1OA 4JK1C 2JEBI 4IUQA 4A3KB 5M5YB 3ZYYX 2HDLA 2CW0D 1Y1WB 5IGCA 4K6DA 2HCCA 1G2SA 1EWCA 5JEAJ 1TVXA 4BY7B 1Y8PB 3H09A 5CV8A 3MHBA 4DFAA 2B2WA 2FMMA 1ENFA 1AN8A 3HOWB 1HTPA 3J80E 4OO1G 5IGBA 3BG3A 1ML0D 4TSSA 1WCMB 1OO9B 2F0JA 2F0TA 3OHXC 1JWUD 1IKLA 3ONAB 5E3FA 2MP1A 3TDQA 3VYUA 1STYA 3T56B 1SNDA 2B2UA 1ESRA 1B4OA 3FKIB 1WD0A 1EEID 5D3IB 1XXGA 2F0HA 4KKUA 1HQMC 4K5XA 3EROA 2B63B 2H1EA 4CKCA 2F0GA 4NDXA 4XYQA 3EFXD 1DONA 2DY8A 1RTNA 1TWGB 1F2YA 2L0CA 2R92B 1DD2A 4HSPA 4X3UA 4E6IA 3V2TA 3SVMA 4FF3A 4A3DB 4RKBA 4RH6A 5FO7B 3FPPA 5CGKA 4L63B 1B9MA 1TY2A 1STAA 2IX3A 2JYOA 1BCPF 3QOLA 1NAPA 1S5ED 1Q12A 1RJTA 1LT3D 3RZDB 1SSOA 1HA6A 4IFDH 3QB3A 1O7LA 1SNCA 1GUNA 1SE4A 2B8GA 1TT2A 1E2ZA 1Q3LA 2FINB 2R93B 5IT9E 1EYAA 2BE5C 4XT3B 2MPMA 1SNPA 3G7LA 2EY6A 5I6YA 2PCFB 5C0XI 1FD7D 1HXYD 2KUMA 5I2YA 2DY7A 1I4XA 1ONLA 5K36G 1QNKA 3I3CA 4KY5A 2ICIA 3PUVA 1YNJC 4G7OC 1VMCA 1Q8IA 3T51B 3S1RB 1O80A 2XSCA 5ELDA 1STGA 2KEEA 4H7BA 3NTKA 1D1IA 3I72A 2Q8TA 1HCZA 3PUYA 5C4ZA 4L6TB 5JPNC 1AZPA 1JOQA 4K14A 4XT1B 5E1FA 3Q24A 1NUCA 3MC0B 1F77A 1O7ZA 2NYZD 3WDNA 1T5EA 4V0BA 1NR2A 2SNSA 1LO5D 2EYFA 3D6WA 1SDFA 2KEDA 3JAML 3HP3A 3J81E 2QEJC 2X6GA 5C4HA 5NUCA 1G8ZD 3K6OA 3M7GA 4FYDA 3O13A 1I4PA 1JQYD 1A6XA 4RHRA 4IFDI 2JSOA 3HKZB 1ENCA 4IALA 2ICEC 1DOLA 4S3SA 4Q0FA 5D65A 3ND9A 5HURA 4V190 3A8KE 3P20A 5E4XA 2K5DA 1PREA 4F7XA 1S4ZA 4QMGA 4R9WA 1LT5D 4G4KA 3LWUA 2OF1A 1Y8OB 2AWNA 4HEDA 3NSWA 2BA1A 1B3AA 2F0LA 1J8IA 3FMCA 4QB4A 1GUGA 3TSSA 1KLGD 5EPKA 3BDCA 5C0XJ 1K8OA 3TP7A 2D5DA 2F0FA 1UUPA 3SXHA 3NPPA 2EY1A 1X3QA 3IAYA 3J80L 2V4DA 2EYJA 4ZRZA 3QWNA 1JE4A 2KOLA 3W3AA 2JEAI 1TIID 5CYUA 4IFDG 5A2QE 1CQFA 2QCPX 4H13C 4PMWA 2RSOA 3CRLC 5LL6S 4HTHA 5IGFA 1EYDA 4CGYB 4F87A 1KDCA 1KAAA 2SOBA 3S14B 4BS9A 1VF5C 1TWFB 3HG9A 4QF4A 4EQPA 4FXDA 2WIIB 1AZQA 3A54A 3DWQA 2NVQB 1D5MC 3V05A 5D3DA 5M5XB 3OSOA 1CZGA 4F8MA 2EJFC 3NK9A 3M85A 4DU9A 4X3KA 4ZKCB 4PQXA 4ABNA 5C3XA 2HDMA 1IL8A 4IUPA 3D3RA 2O2LD 2A68C 4CKEA 1F9QA 2F0SA 2QF7A 3VA5A 4OO1I 1ZYRC 4NW2A 3RLFA 5C0XH 4KN7C 1DYQA 3C3LA 4OIJA 2MUYA 5M9OA 2F0VA 2Y0SB 1EFID 5HGTA 2Z4HA 4ZUIA 4ODGA 2NWGA 2XWBB 4MIUA 3X3NA 4ID6A 4EVOA 4K8JA 3PUXA 2F1MA 1CA5A 3AMUA 1SYEA 1QE6A 3TMEA 2NBFA 1Q1EA 3NHHA 3PIO3 4XQJA 1EZ6A 4DF7A 4FF4A 2Z4IA 4F88A 1EY5A 3W2DA 4KJOA 3LWEA 2KHSA 2LS01 1EIHA 3MXUA 3C46A 1D6EC 1JICA 1TQOA 3SE0A 1JB3A 1OXXK 1IHZA 2NVYB 1FNWA 2K6AA 2WACA 1VCIA 4OL7A 5FLXE 1K8MA 3S16B 3S2HB 2MJ8A 2PNRC 3BYTB 1PFMA 1BCPB 1Y1VB 3OIQA 1I50B 2IJ0A 2WAQB 4KI0A 3A7AB 3T4AC 4C56C 1HRJA 3Q23A 1CTMA 1ET9A 4L8JA 1HFGA 3M7NA 4EGVA 2C9OA 2ZXOA 1R4QB 3S1QB 5LL6X 3VR6A 2A68D 5M5WB 1EL0A 5CV9A 1EY4A 2F0MA 2PYKA 4ILWA 1F9PA 1IW7D 3FVQA 2X6LA 4DXGA 1O78A 4A3GB 2N88A 1TKWB 5A2QL 5EBCA 5C6AA 1GHJA 3DHQA 5CC4A 1WTVA 3D4DA 1STBA 1BCPC 1E0BA 2O5JC 2XWJB 2IX1A 2EDGA 3CKIB 2L55A 3GTLB 1S5DD 3VA7A 4NKLA 1STEA 1Z7TA 4DXFA 2ZT9C 5K5PA 1FGBD 1MSGA 1EIGA 2F0PA 1B44D 1PZID 4OGQC 4C3HG 2VB2X 4OHJA 5DEHA 2NTSA 3RMHA 1SE2A 2PMZB 4RAUC 4WORA 4HSVA 5FKAC 2NN6H 3GTJB 3K0YA 1SMYC 1HUNA 1TY0A 3A8JE 2A69D 2NVXB 1F2MA 1JWMD 1C48A 2B2WC 2SDFA 4R8IA 3H94A 2ID0A 2NN6I 2RA4A 1M8AA 3DMUA 4FO2A 1GUWA 4WRDA 2K33A 3OPOA 1F9RA 2PZTA 1BO0A 1S5FD 3D8GA 3NWSA 1CZWA 4PNYA 1LTGD 2EJMA 2WKCA 3J7YW 3A56A 3A7LA 1B50A 4TKOB 1SYDA 3JAME 1KTKA 3R3OA 5JEAG 1DZ1A 5IGDA 3D4WA 3IL8A 5J1ZA 3QOJA 1GUOA 4N9PA 4HR7B 3J7AF 2JA7B 4RGMA 5FO9B 3U9SA 3K7AB 1C4QA 5C5MA 3E5SA 1EU3A 3M3YB 2YU9B 3TP5A 4X3TA 2PZUA 1B53A 2A6ED 3Q6SA 5C44B 4ZLTF 2F03A 2H4OA 4RGTA 2R3ZA 3E0JA 3MFGA 5I4DA 4G57A 2IT1A 1C8CA 3ITPA 3I4MB 1PTOD 1YNND 1D5XC 3D31A 4RA8A 3NP8A 4C3HB 3L3OC 2N55A 1SMYD 3K5MA 3GV3A 4K5WA 3KK7A 4ZK9B 5C4XB 1ILPA 1S5CD 1BDOA 1UNSA 1B9NA 2AUJD 4LJZC 4O42A 2IPKD 4K2LA 3R93A 2EYOA 1LLRD 1II3A 3VYSA 5FOBB 5FLXL 4PMCA 2O4XA 1HTLD 5EQ0A 1EY0A 5IGGA 2VXWA 2EYMA 4C1NI 5IT9L 2A74C 5D14A 4DNTB 4A93B 3DWPA 2KCCA 3GTQB 4KMUC 2EXZA 4XXEA 2Z8LA 1T5XD 2F0QA 1GXDC 4IN3A 1DOKA 2K1BA 4IUVA 4PV1C 3I4LA 1QWYA 4FF1A 1KNEA 1HHVA 3NE5B 3GO5A 5ISRA 3HOYB 1PXUA 4KV6A 1FNVA 5CBAE 4K5VA 4K2KA 3GTMB 2QKIC 3URYA 3I70A 3PO3B 4QUFA 3PIP3 1KLUD 2G9DA 4KD3A 4KTAA 2Q8RE 4A3EB 3DUZA 4QCLA 1EOTA 2OT2A 5G3LD 2MGSA 5KYLA 2WB1B 5KYIA 3ERQA 3K5NA 1U4RA 3KF8A 1H9SB 3BVGA 4KHVA 1MD2D 3GTPB 2LY7A 3FEWX 1MBYA 1PZKD 1DOMA 1U4PA 3OMGA 2A69C 4ULLA 4H44C 5IGEA 2F3VA 1CA6A 1PTOF 4XDXA 4A3MB 4U673 1LTAD 1LV9A 3BS1A 1FYCA 5EGTA 3EA6A 5JAVA 4FXKC 2Z1CA 2KJXA 1STNA 4DAYA 2F0UA 2DN8A 2IW3A 3R2IA 1PRTD 5KIXA 1A2UA 3CU7A 3HRZC 3HOXB 2L12A 1I4HA 2ZXPA 1EY8A 4OO1H 5LHY1 1AW7A 1Q1BA 3LX0A 2QDBA 4ME5A 4R8NA 1H9RA 1FR3A 1CI3M 5CV7A 1X3PA 1DXMA 4XQQA 1H9MA 3I73A 2XVSA 3GV6A 3HS0C 3TP6A 2PO4A 3T53B 3DXJC 4ZYSA 5KNDA 1JR0D 3OW7A 1L0XB 2PZWA 1GUTA 3DEOA 3SHLA 5IOCA 1QOHA 2A6HD 5FO8B 3C0NA 4I7ZC 1EU4A 3MXGA 3OWEB 2AQ2B 2YYZA 3HZXA 1A2TA 1E2WA 1MSHA 2F0DA 1EZ8A 1SAPA 3S15B 3MXNA 1BCPD 2B8FA 3M4YA 1D5ZC 2K04A 3D4RA 1V8QA 1XX8A 4FNFA 3HEJA 1SXTA 1AEXA 4PMBA 5CORA 3SK8A 2PQEA 1NR4A 2F0NA 2J4XA 4O1NA 2D62A 4AYBB 3H0GB 1G291 1BOSA 4KY7A 1PFNA 1BQQT 2B2VC 5IODA 2IWHA 1E2VA 2EYLA 1SFOB 3P7JA 5K36H 5JJZA 2CW0C 3I90A 5KNCA 1W6JA 2M2LA 5I6WA 4ZUJA 4C3IG 3SDZA 1UAPA 3GTOB 3KBGA 1AFPA 3P75A 3BDOA 5ELCA 1M4VA 2B2VA 4C3IB 4DA2A 2EZVA 1Y69U 4FXGC 3OMCA 2DNCA 1EYCA 1O7YA 4ZQ3A 2JA8B 3QG1A 4BWGB 5DM73 2XIWA 5G3LF 2RDHA 3TP8A 1ZXTA 1B2TA 2BA0A 4HN7A 3UI2A 1CT1D 2XRQD 1JWSD 1LTBD 3KLSX 1X32A 2RVLA 1I3QB 3NXWA 5EKIA 1JCKB 1CM9A 4Q5VA 1WVLA 2FHTA 1SYFA 3QIAA 1B1ZA 3C1EA 1CHPD 1SNMA 2KQ3A 3MTSA 2AWOA 4IUUA 2A73B 3A8IE 1TU2B 1R4PB 1EY7A 5JPMC 3CHBD 4FF2A 2OEOA 1LTRD 2FJ2A 3VYRA 4M8AA 3GP7A 1OXTA 2MHVA 1IYVA 2J0TD 2A6EC 5DNFA 1CQVA 5JVH3 1SYCA 2M9VA 4BBRB 4UDUC 5JOBA 2K05A 3MZ5A 5EPLA 4G7ZC 2VB3X 3P1HA 3PV0A 2X69A 3Q22A 3S1MB 5CMDA 4BBSB 3MEHA 1HPCA 4RCOA 3KLSA 5E4WC 1PMRA 3G4OA 3K5LA 3H91A 3V96A 2VNUD 5EPJA 1TS4A 4IQZA 3C2PA 1RKNA 1YNNC 3VYTA 4JBWA 1OXSC 1BR9A 1A3VA 1D1KA 3S1NB 1TWCB 1VDZA 4WFN3 2EYHA 4BY1B 2EYPA 3VR2A 1EQVA 3DWAA 3L9AX 3GD7A 4XQNA 1BBXC 3U9OA 1I4GA 2AQ3B 2RDFA 3RD4A 1XYIA 2TMPA 2FMCA 3CRKC 1CHQD 1I4QA 3GQBA 1LABA 2PW7A 4C2MB 3TZUA 4DGZA 4RWSC 2R61A 3OWFA 2L4NA 2Q8IB 1G2TA 4DNRB 1V1PA 4IUTA 1QNUA 4HMIA 3D6CA 5F2DA 4CJ1B 3KBXA 4G7HC 3RUZA 4KK7A 1HA5A 3PO2B 4C1NK 1I4RA 4I65A 5KNBA 2L1BA 4RHSA 1DCZA 1TS3A 3K59A 1TS5A 3FPUB 2B2TC 1PRTF 1PFBA 1QB5D 3S9WA 4DAPA 2WKDA 2B39A 2RKSA 3BYYB 2HUGA 4Y7NB 3BZDB 4CJ0B 1PRTB 2TSSA 2K32A 3S17B 2CHBD 2ZXRA 5CBEE 1SJHD 5C0XG 1JORA 2F0IA 1IW7C 1JC7A 4DN4M 4N9TA 2AQ1B 1WTRA 1DJRD 2JE6I 3BVMA 1BXTA 2M00A 5DM63 1PDQA 5JVG3 1F2ZA 3NQTA 2WV6D 4FVMA 4B08A 3EVQA 3LNNA 3NBHA 3NTHA 2LKVA 2L9HA 2KVMA 4IURA 2F0OA 2KECA 1U9RA 1STHA 2QILA 1GJXA 4K6LA 1YNJD 2DNEA 1BNZA 4Z9CB 3PUZA 3I91A 2F4IA 2WP8J 2EY2A 5CR3A 2BOSA 2XN9C 1V43A 3MA2B 2L5TA 5COYA 3G4NA 1HQRD 1BUVT 3PMFA 3N6RA 1H9JA 4A3FB 4LK1C 4X3SA 4RGOS 2NTTA 4MHEA 1WTPA 5ELFA 3RZOB 2WINB 1ZYRD 2A5HA 2RBMA 2EOTA 1CK1A 1PTOH 2I46A 5C3WA 4DK0A 2B2YC 4YIJA 2A6HC 1U4MA 4FP5D 5A35A 4EQOA 1PYWD 2D2CC 4QIWB 5BN4A 1GOZA 2E2IB 1OXUA 3H6MA 3N52A 4WJWA 1LACA 1LTTD 2F3WA 1SE3A 4RCNA 1RCVD 2LMCB 5IIFA 2JP1A 1LTSD 3WOFA 5T1IA 2E2JB 3NTIA 3S2DB 4DAVA 4OIKA 3GTKB 3QJYA 5KGUA 5J39A 1QG7A 4KHZA 4HCEA 1JOKA 4HCSA 3NWTA 4HAEA 2EE1A 1SYBA 4LAAA 5C3EB 1G6ZA 4J1MA 1WTQA 4M1UB 1KDAA 3MFYA 5ELBA 4B9XA 1QILA 4HMJA 1WTXA 4B9WA 3A55A 3E6ZX 5C5LA 5EBDA 4XIGS 4U68A 1GUSA 1TWAB 2BE5D 2HQEA 4IFDJ 2E75C 1SYGA 2JA5B 3F2UA 3PUWA 4C3JG 3M4OB 5CV4A 4DK1A 1Z47A 5EKLA 1XWEA 2JA6B 5CV6A 1F2LA 1Z52A 1XTCD 1ENAA 2K5WA 4TRDA 3MAQA 5I2XA 3IFTA 4K8IA 3WOEA 1SJED 2GA4B 2PW5A 5I9OA 1BF4A 5KRUA 1WD1A 1RHPA 3VR3A 4UAIA 1H9SA 2BCOA 1I6HB 2NVTB 3R2TA 3T16A 4TQUS 1UEAB 1DM0B 1NCVA 1PLFA 4KJNA 3MXPA 3IFDA 5BN5A 1A3TA 3BDLA 3EJIA 3TBIB 2CQAA 2BDOA 3C0OA 3DM1A 3HOUB 5DAUA 4NP5A 3DEPA 2C5CA 1EY6A 4RGNA 2B2YA 4KKTA 3Q0AA 2RDGA 3K58A 1LT4D 1CFMA 1JOOA 2E2HB 4J8QA 2CVRA 1W6KA 2R7ZB 1WTWA 1GHKA 1RD9D 2E2DC 5T1GA 5FK9C 4RKLA 1KNAA 3L7ZC 2B2TA 2EJGC 3G6JB 5J22A 4CBVA 2SNMA 5AFWA 4NMZA 4KY6A 1QJOA 2XRSD 2NN6G 1A15A 1EY9A 4A3IB 1ZEQX 3I8ZA 1RF2D 2EPBA 2HCIA 2I07B 1Y8NB 3FRPB 2OXPA 3KLRA 3HGBA 3HOZB 1VMPA 1TS2A 2F0WA 4IZ8A 3OIPA 1K83B 2R6GA 2E74C 4H0LC 1Q90A 1VF7A 4XYOA 1SNOA 3BVZA 2IL8A 5EJWA 3TZDA 1WTOA 1SNQA 4XTCS 1EEFD 1PTOB 1NSNS 3X3MA 3AB9A 3J7AV 3OOCA 2K7VA 5KEEA 5M3MB 3J81L 1PRTC 3I4NB 2BDNA 4A3JB 1G91A 1OXVA 4EQNA 2ENBA 3NUCA 4RFBA 5I9PA 1HFNA 2F0EA 1FNUA 5TSSA 1PTOC 2E76C 3NBIA 1TWHB 2XNAC 1EQTA 1ZKOA 1ESFA 4ZAIA 2D9UA 3T13A 3C1FA 1PZJD 2SEBD 5EKKA 1TR5A 3SEBA 4QUCA 4KN4C 3GTGB 1IKMA 4BA1I 3SK6A 1V1PB 1AP0A 3HOVB 1F9SA 4MN3A 3TN2A 1SBBB 3FDTA 2K5QA 3NQIA 3VR4A 1RDPD 4J6HA 1SEBD 3ND8A 4IUNA 3R8BA 2L11A 1KABA 3KUPA 5C4JB 1HUMA 1RODA 5ELEA 1H9KA 1ICWA 1I6VC 1MGSA 2EVBA 2RSNA 2LFNA 1LTID 4ZKBB 1D2BA 5CV5A 1R9TB 2K03A 3H3VC 1QCBD 2J7ZA 2RQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCP D;  1B1Z A;  1CHP D;  1D5Z C;  1SJE D;  1EFI D;  2G9H D;  4DXG A;  1LTT D;  1PTO F;  3TSS A;  1KLG D;  2R61 A;  3BVZ A;  1DJR D;  1KTK A;  1SE3 A;  1LTA D;  1SXT A;  1EEI D;  3DWP A;  3BVM A;  1RCV D;  5D3I B;  5ELD A;  1EEF D;  1BXT A;  3EA6 A;  1XXG A;  1BCP C;  1V1P A;  1LTS D;  1PTO B;  1UUP A;  3CHB D;  1LTR D;  3R2T A;  1LT6 D;  2WV6 D;  3GP7 A;  1PRT C;  4RGM A;  2J4X A;  4O1N A;  4L6T B;  4RFB A;  1CQV A;  1HA5 A;  1PRT D;  1FNU A;  3R2I A;  3EFX D;  5TSS A;  2Z8L A;  1PTO C;  1T5X D;  1I4H A;  1EU3 A;  1S5D D;  2XNA C;  3C0O A;  4UDU C;  2QIL A;  1I4R A;  4K6L A;  3MC0 B;  3W2D A;  1F77 A;  4Z9C B;  4RHS A;  1STE A;  1ESF A;  4DXF A;  1AW7 A;  1TS3 A;  1S5B D;  1PZJ D;  4RGN A;  2SEB D;  1LO5 D;  1FGB D;  4RH6 A;  2XN9 C;  3SEB A;  1L0Y B;  1B44 D;  1PZI D;  1TS5 A;  2RDG A;  4RGT A;  3MFG A;  4OHJ A;  5I4D A;  1D6E C;  2QEJ C;  2NTS A;  3G4N A;  1HQR D;  1LT4 D;  4L63 B;  1SE2 A;  1PTO D;  1FNV A;  1TY2 A;  4RCO A;  5ELB A;  1ET6 A;  1PRT F;  1RD9 D;  1FNW A;  1QIL A;  3G4O A;  1V1P B;  1BCP F;  5FK9 C;  5FKA C;  1G8Z D;  1S5E D;  3C0M A;  1D5X C;  1M4V A;  1V1O A;  5ELC A;  3URY A;  3O13 A;  4RGO S;  1I4P A;  3DWQ A;  2NTT A;  1D5M C;  3V05 A;  1SBB B;  1TY0 A;  1JQY D;  1JR0 D;  1TS4 A;  1LT3 D;  3BYY B;  3BYT B;  5D3D A;  5ELF A;  4ZYS A;  1L0X B;  3BZD B;  1BCP B;  4RHR A;  1JWM D;  1KLU D;  1PRT B;  2TSS A;  2IJ0 A;  1RDP D;  2XRS D;  4C56 C;  1SE4 A;  3C0N A;  2CHB D;  1EWC A;  1CK1 A;  1PTO H;  1EU4 A;  1SEB D;  1ET9 A;  1RF2 D;  1S5C D;  4BWG B;  3R8B A;  3OWE B;  2RDH A;  2AQ2 B;  1ENF A;  1AN8 A;  1UNS A;  1SJH D;  3DWA A;  1PRE A;  3BVG A;  5ELE A;  2O2L D;  1MD2 D;  1CT1 D;  2IPK D;  2XRQ D;  1JWS D;  1LT5 D;  1LTB D;  1S5F D;  1Z52 A;  1LLR D;  1PYW D;  3KLS X;  1FD7 D;  1HXY D;  1XTC D;  4TSS A;  1LTI D;  1I4X A;  1I4G A;  2AQ3 B;  1PZK D;  1GOZ A;  1TS2 A;  1DYQ A;  1JCK B;  1HTL D;  1JWU D;  1LTG D;  2ICI A;  1CHQ D;  2AQ1 B;  1I4Q A; 
#chains in the Genus database with same CATH topology
 3SK5 A;  5BN3 A;  2F3I A;  2NZ1 D;  3ULL A;  2O5I C;  2G9H D;  3SK4 A;  1Z6H A;  2FFK B;  3CCQ A;  4GLX A;  1UE1 A;  2K01 A;  4CHT B;  4KD4 A;  3K5O A;  5IYB G;  2KCN A;  1EWI A;  2YTV A;  4LMQ D;  3HKZ G;  3MVV A;  2R7Z H;  2B2U C;  2IX0 A;  3NEN A;  1LT6 D;  1CKN A;  1J9O A;  2JXM B;  4C3J B;  2AUK A;  1L1O C;  3AU7 A;  3K57 A;  5JEA H;  1UE5 A;  1E22 A;  4A3B B;  3QO2 A;  2EY5 A;  3HOY G;  4MTK A;  1EWH A;  1ILQ A;  4DR5 L;  2VUM B;  3CQZ B;  2K28 A;  4NXN L;  1U4L A;  2VW9 A;  2NUC A;  4BXX G;  4A3K G;  2F0K A;  4P2C B;  1EIY B;  1KDB A;  2NB0 A;  1VQC A;  1S5B D;  2KA7 A;  3MWY W;  3SR1 A;  1PVO A;  4N8X 1;  2RCN A;  4LF7 L;  2NVT H;  4BA2 I;  1A3U A;  1MI2 A;  2H5X A;  4L5S A;  1IYU A;  1L0Y B;  3EQL C;  1H95 A;  3IKJ A;  3VR5 A;  4CKB A;  5GAH C;  4CJ2 C;  5C3E G;  1SE8 A;  1RTO A;  2PPB C;  5M3F B;  4KKS A;  1ET6 A;  4GZY C;  2UUC L;  3C0M A;  1PH5 A;  4A3C G;  1V1O A;  4JK1 C;  2JEB I;  4LFC Q;  4IUQ A;  2ZTE A;  4A3K B;  4A3G H;  1KRS A;  5M5Y B;  3ZYY X;  2HDL A;  4JI1 Q;  2CW0 D;  1Y1W B;  5IGC A;  4K6D A;  2HCC A;  1G2S A;  1EWC A;  5JEA J;  1TVX A;  1SN8 A;  4BY7 B;  1Y8P B;  1ASZ A;  3H09 A;  1Q81 C;  4WJ3 M;  1I50 H;  5CV8 A;  3MHB A;  4DFA A;  2B2W A;  2FMM A;  3S1Q H;  3K81 C;  1ENF A;  4KHP Q;  1AN8 A;  3HOW B;  4DR3 L;  1I3Q H;  1HTP A;  4YWM A;  3STB D;  3U4V A;  3J80 E;  4OO1 G;  3KOJ A;  5IGB A;  2ZJP A;  3BG3 A;  1ML0 D;  4TSS A;  3AQQ A;  1WCM B;  1OO9 B;  2F0J A;  2F0T A;  4DV2 Q;  2KBN A;  4IJH A;  3OHX C;  1JMC A;  1JWU D;  1IKL A;  3ONA B;  5E3F A;  4DNI A;  2UUB L;  3HOW H;  4DR7 Q;  2MP1 A;  3TDQ A;  4EX5 A;  3VYU A;  1STY A;  3S2H H;  3T56 B;  1SND A;  2B2U A;  1ESR A;  1B4O A;  3FKI B;  1WD0 A;  1EEI D;  1I94 Q;  3CAM A;  1AH9 A;  5D3I B;  4A3D G;  4JYA Q;  1XXG A;  2F0H A;  3RN5 A;  4J15 A;  4KKU A;  3GTL H;  3ICE A;  1HQM C;  4K5X A;  2WB1 G;  3ERO A;  2B63 B;  2H1E A;  4CKC A;  2F0G A;  4JI3 L;  4NDX A;  4XYQ A;  3EFX D;  1DON A;  2DY8 A;  3UE0 A;  1RTN A;  1TWG B;  1C0A A;  1I5F A;  1F2Y A;  2VQE Q;  1PYS B;  2CH4 W;  2L0C A;  5ELN A;  3GTK H;  4DUY L;  4LFA L;  2R92 B;  1DD2 A;  4HSP A;  2MFI A;  2N49 A;  4X3U A;  4E6I A;  3V2T A;  2ZJQ A;  3SVM A;  4FF3 A;  4A3D B;  4RKB A;  4RH6 A;  5FO7 B;  3FPP A;  3I2Z A;  4YCU A;  5CGK A;  4L63 B;  1B9M A;  3PQI A;  1TY2 A;  3T1Y L;  1YNX A;  3RZO H;  1STA A;  2IX3 A;  2I0Q A;  1U5K A;  2JYO A;  1BCP F;  3QOL A;  1NAP A;  1S5E D;  4R1J A;  4YHH Q;  4A3E G;  1Q12 A;  4P71 A;  2NZO A;  1RJT A;  3STB C;  4CDF C;  3S2D H;  1LT3 D;  3RZD B;  1SSO A;  5JJL A;  1HA6 A;  3PO3 G;  4IFD H;  2HD3 A;  1O7L A;  1SNC A;  3QB3 A;  1GUN A;  1SE4 A;  2ES2 A;  2B8G A;  1Q46 A;  4DV4 Q;  3GTM H;  3RN2 A;  4A3J G;  1TT2 A;  3CCJ A;  1VQL A;  4JCV E;  1E2Z A;  1Q3L A;  2FIN B;  1KC8 C;  2R93 B;  5IT9 E;  3PIO A;  1EYA A;  2QDL A;  2BE5 C;  3PO3 H;  4XT3 B;  4AH6 A;  2MPM A;  1SNP A;  3G7L A;  2EY6 A;  5I6Y A;  5AJ3 L;  2PCF B;  2Z9H A;  1E1T A;  5C0X I;  1FD7 D;  1HXY D;  2KUM A;  5I2Y A;  2LXJ A;  2DY7 A;  1KXL A;  1I4X A;  1ONL A;  5K36 G;  1QNK A;  3I3C A;  4KY5 A;  1M1K C;  4C3I H;  2ICI A;  3PUV A;  4QL5 A;  1YNJ C;  2IHF A;  3KDF A;  4G7O C;  2JN4 A;  2Z6K C;  2F52 A;  3GTP H;  1YJW A;  2E2H H;  1VMC A;  1Q8I A;  3T51 B;  1VQB A;  3S1R B;  4KHP L;  1O80 A;  4GNX B;  2XSC A;  5ELD A;  1STG A;  4OWX B;  2VQF Q;  4A3F H;  4GN4 B;  4LF7 Q;  2K75 A;  2KEE A;  4H7B A;  3NTK A;  1D1I A;  5J3B A;  3I72 A;  1N33 Q;  1HCZ A;  2Q8T A;  4QQB X;  3PUY A;  1X56 A;  5FLM G;  4WJ4 A;  5C4Z A;  1WCM H;  4L6T B;  3K80 C;  2KHJ A;  5JPN C;  1AZP A;  4C3J H;  1JOQ A;  1EQQ A;  4B3T Q;  4K14 A;  4XT1 B;  5E1F A;  3Q24 A;  1NUC A;  3MC0 B;  1G51 A;  3CC4 A;  1F77 A;  1O7Z A;  4DR4 Q;  2NYZ D;  3WDN A;  4QY7 A;  1T5E A;  4V0B A;  1NR2 A;  2SNS A;  1LO5 D;  3I56 A;  2EYF A;  2MQH A;  3D6W A;  2DUD A;  1SDF A;  2KED A;  3HKS A;  3JAM L;  3HP3 A;  3J81 E;  2QEJ C;  2X6G A;  3HFZ B;  5FLM H;  5C4H A;  1E7Z A;  5NUC A;  5IYC G;  2MNA A;  3TS2 A;  4L5R C;  1G8Z D;  3K6O A;  3KJO A;  3M7G A;  4FYD A;  3O13 A;  4APV A;  1I4P A;  4JBJ A;  5GAD C;  1JQY D;  1A6X A;  4BBR H;  1WYD A;  3KJP A;  4RHR A;  4IFD I;  2JSO A;  1PA6 A;  3HKZ B;  1ENC A;  1K28 A;  4IAL A;  2ICE C;  5HGQ A;  1DOL A;  4S3S A;  2Z0S A;  4Q0F A;  5D65 A;  3ND9 A;  5HUR A;  4V19 0;  4GOP B;  4LNQ A;  4B3R Q;  3A8K E;  3P20 A;  4A3I H;  5E4X A;  1I94 L;  4DAM A;  2K5D A;  3HKZ E;  4F7X A;  1S4Z A;  1PRE A;  3E0E A;  1PH9 A;  1MHW C;  4QMG A;  2QW7 A;  4R9W A;  1LT5 D;  4G4K A;  1QZH A;  4IO9 A;  1N34 Q;  3LWU A;  2NVY H;  4NB3 A;  2OF1 A;  1Y8O B;  1X3F A;  2AWN A;  4HED A;  3NSW A;  2BA1 A;  1SMX A;  1B3A A;  2CWP A;  2F0L A;  1J8I A;  2GN5 A;  5JJK A;  4RG1 A;  1TXY A;  3FMC A;  4QB4 A;  1GUG A;  2RF4 A;  3TSS A;  1XNR L;  1KLG D;  3CXC A;  5EPK A;  3H0G G;  3BDC A;  5C0X J;  2YTY A;  2JA6 G;  1K8O A;  3TP7 A;  2D5D A;  2F0F A;  1UUP A;  3SXH A;  5AJ3 Q;  1X55 A;  3NPP A;  2EY1 A;  1X3Q A;  3IAY A;  3J80 L;  1TWA H;  2V4D A;  1WJJ A;  5M3M H;  2EYJ A;  2WAQ E;  4ZRZ A;  3QWN A;  1NMG A;  1L1O A;  3FKI G;  1JE4 A;  2KOL A;  3W3A A;  3TRE A;  2JEA I;  1B3Q A;  1C7Y A;  3CME A;  2G5D A;  3ER0 A;  1TII D;  4LF4 L;  5CYU A;  4IFD G;  1PH4 A;  5A2Q E;  1CQF A;  2UUA L;  2QCP X;  4H13 C;  4PMW A;  2RSO A;  3CRL C;  5LL6 S;  4HTH A;  5IGF A;  1EYD A;  3NEL A;  4CGY B;  4F87 A;  4JI8 L;  3CC7 A;  1KDC A;  1KAA A;  2SOB A;  3S14 B;  4BS9 A;  1VF5 C;  1TWF B;  2OTL A;  3HG9 A;  4OWW B;  4QF4 A;  4EQP A;  4FXD A;  1LM0 A;  2WII B;  1AZQ A;  2VS1 A;  3A54 A;  3DWQ A;  2NVQ B;  1D5M C;  3V05 A;  3H3V I;  3I4N H;  5D3D A;  1V1Q A;  4BY7 G;  5M5X B;  2A19 A;  3OSO A;  4DR2 L;  1CZG A;  3T1H Q;  4F8M A;  2EJF C;  1I6H H;  1QVG A;  4OEL B;  5IY0 A;  3NK9 A;  4Y52 H;  3CPF A;  2Z6B A;  4UP9 A;  2QGQ A;  3M85 A;  4DU9 A;  4JW0 A;  4X3K A;  4ZKC B;  4PQX A;  4ABN A;  5C3X A;  2HDM A;  1XPO A;  1IL8 A;  4IUP A;  3D3R A;  2E2I H;  2O2L D;  2FXQ A;  2A68 C;  2LSS A;  4CKE A;  2P5Z X;  1F9Q A;  2GVB A;  2VL6 A;  2F0S A;  2QF7 A;  3VA5 A;  5GQO A;  3I4N G;  4OO1 I;  1ZYR C;  5M5X H;  1W3S A;  4NW2 A;  3RLF A;  4BBR G;  5C0X H;  4KN7 C;  1YHQ A;  2IY5 B;  4JVZ A;  1DYQ A;  4A3G G;  1N32 L;  3C3L A;  4OIJ A;  4P75 A;  2MUY A;  5M9O A;  1EFW A;  1X3G A;  2F0V A;  2Y0S B;  1EFI D;  5HGT A;  1E1O A;  2Z4H A;  4ZUI A;  2MO0 A;  4ODG A;  2NWG A;  2XWB B;  4MIU A;  3X3N A;  1L1O B;  4ID6 A;  4EVO A;  1S72 A;  1K0S A;  4K8J A;  3PUX A;  2VUM G;  2XTI A;  2F1M A;  1CA5 A;  1J6Q A;  2PNH A;  3MXN B;  3AMU A;  1SYE A;  1LUZ A;  1IBL Q;  1QE6 A;  2Q2H A;  3TME A;  2NBF A;  1Q1E A;  3NHH A;  4NXM L;  3PIO 3;  5IYC H;  2N8N A;  2OQK A;  4XQJ A;  1EZ6 A;  4KLK A;  4DF7 A;  4FF4 A;  4DV2 L;  1X9N A;  2Z4I A;  4F88 A;  1XTD A;  2I5M X;  4A3B H;  4A4I A;  4OX9 Q;  1EY5 A;  3A74 A;  3W2D A;  4KJO A;  1MIU A;  3LWE A;  3E3X A;  2KHS A;  2LS0 1;  1EIH A;  3MXU A;  3C46 A;  3F8T A;  1D6E C;  4TVA B;  1JIC A;  1TQO A;  2Z6K A;  3SE0 A;  1JB3 A;  1OXX K;  3J81 j;  1IHZ A;  3CQZ H;  2NVY B;  1FNW A;  2K6A A;  2WAC A;  1E24 A;  3JAM c;  1VCI A;  4OL7 A;  5FLX E;  1VQ7 A;  2WAQ G;  1FGU A;  1KHI A;  1K8M A;  3S16 B;  3S2H B;  2MJ8 A;  2PNR C;  3BYT B;  5C44 H;  2CWA A;  5GRO A;  1PFM A;  1BCP B;  1Y1V B;  2UU9 L;  3U4Z A;  3OIQ A;  1I50 B;  2IJ0 A;  2WAQ B;  4KI0 A;  3A7A B;  1PH6 A;  1XPU A;  3T4A C;  4C56 C;  1HRJ A;  3OTO Q;  3Q23 A;  1CTM A;  1ET9 A;  3I4O A;  1Y1W H;  4MNO A;  4P74 A;  1YIT A;  4L8J A;  1HFG A;  3M7N A;  3GTQ H;  4EGV A;  3LGJ A;  2C9O A;  2ZXO A;  1R4Q B;  2GVA A;  3NEM A;  4QJF A;  2JA7 H;  3S1Q B;  3CF5 A;  5LL6 X;  3VR6 A;  2A68 D;  4DK6 C;  2B3G A;  5M5W B;  1EL0 A;  5CV9 A;  1EY4 A;  2F0M A;  2PYK A;  2K14 A;  4ILW A;  4JI7 Q;  1F9P A;  1IW7 D;  3FVQ A;  2X6L A;  4DXG A;  1O78 A;  2CFM A;  2N88 A;  4A3G B;  1TKW B;  3GTG H;  5A2Q L;  5EBC A;  1SLJ A;  5C6A A;  1GHJ A;  1IBM L;  3DHQ A;  1YJ9 A;  5CC4 A;  1WTV A;  3D4D A;  1STB A;  1BCP C;  1E0B A;  3S1N H;  2O5J C;  1GM5 A;  2XWJ B;  1WFQ A;  2IX1 A;  3HOU H;  3F2B A;  2EDG A;  3CKI B;  2VQF L;  1DGS A;  2HIV A;  5IP9 H;  1YVC A;  2L55 A;  3GTL B;  1D8L A;  1S5D D;  3VA7 A;  1VQE A;  2JA8 H;  2AMC B;  4NKL A;  4LF9 L;  4OXP A;  2KHI A;  1STE A;  1Z7T A;  4B3M L;  4DXF A;  1HH2 P;  2ZT9 C;  4QIW E;  4LUV A;  5K5P A;  1FGB D;  1MSG A;  1EIG A;  2F0P A;  4DR1 Q;  4LF6 Q;  1B44 D;  1PZI D;  4OGQ C;  4C3H G;  2VB2 X;  4OHJ A;  1SFO H;  4LUZ A;  5DEH A;  2NTS A;  3RMH A;  1SE2 A;  2PMZ B;  3HOZ G;  1IBK L;  2R7F A;  4RAU C;  2K5N A;  2I5L X;  1Q82 C;  4WOR A;  4HSV A;  3M4P A;  5FKA C;  2NN6 H;  5IYD G;  3GTJ B;  3K0Y A;  1SMY C;  3KF6 B;  4LF8 Q;  1HUN A;  1TY0 A;  4JYA L;  1Z9F A;  1RIP A;  2JK8 A;  3A8J E;  4R4O A;  2A69 D;  2NVX B;  1F2M A;  1JWM D;  3CCL A;  1C48 A;  3PF4 A;  2B2W C;  2SDF A;  4R8I A;  3W5O A;  3H94 A;  1NJI C;  2ID0 A;  3A5Z B;  1VQI A;  1BVS A;  2NN6 I;  2RA4 A;  2Q2T A;  1M8A A;  3G6E A;  1N36 L;  2UXC Q;  3DMU A;  4FO2 A;  1GUW A;  3K8A A;  4WRD A;  1KQS A;  1UE7 A;  4DV6 L;  1HNW Q;  2K33 A;  3OPO A;  1F9R A;  3KF8 B;  3CCR A;  2PZT A;  1BO0 A;  1S5F D;  1X3E A;  3D8G A;  2B63 G;  3NWS A;  4NXM Q;  4JPB W;  1CZW A;  2HIX A;  4PNY A;  1Q86 C;  1K9M C;  1LTG D;  2EJM A;  2WKC A;  2VUM H;  2QA4 A;  3J7Y W;  3A56 A;  3A7L A;  4DUZ Q;  1B50 A;  4TKO B;  2NVQ H;  3BU2 A;  1SYD A;  3JAM E;  1GO3 E;  1KAW A;  1KTK A;  3G48 A;  3R3O A;  4B3R L;  1A62 A;  5JEA G;  1XMQ Q;  1DZ1 A;  4RMF A;  5IGD A;  3D4W A;  3IL8 A;  5J1Z A;  3QOJ A;  1GKH A;  1GUO A;  1XNR Q;  4N9P A;  4HR7 B;  3J7A F;  2JA7 B;  4QGU A;  4RGM A;  5FO9 B;  3J80 c;  4LFA Q;  4DUY Q;  1A63 A;  3U9S A;  3K7A B;  3A0J A;  1PYB A;  2WFW A;  1C4Q A;  4JOI A;  1IYJ B;  3E5S A;  1EU3 A;  5C5M A;  3M3Y B;  1VQH A;  5IWA Q;  2YU9 B;  3TP5 A;  4X3T A;  2PZU A;  1B53 A;  2A6E D;  3Q6S A;  5C44 B;  4ZLT F;  2K4K A;  3CCU A;  4PZ7 A;  2H4O A;  2F03 A;  4RGT A;  2R3Z A;  3E0J A;  3MFG A;  4OEM B;  5I4D A;  3OTO L;  1G6P A;  4G57 A;  4IJL A;  2IT1 A;  4A3C H;  1C8C A;  1CSP A;  3ITP A;  3I4M B;  1PTO D;  4A93 G;  4GN5 A;  1B8A A;  1YNN D;  4IPC A;  1D5X C;  3D31 A;  4RA8 A;  3RLO A;  3NP8 A;  4C3H B;  3L3O C;  2N55 A;  1SMY D;  3K5M A;  4JI5 L;  1U0L A;  3GV3 A;  4K5W A;  3KK7 A;  4YWK A;  4DV7 L;  4LF4 Q;  1HNX L;  4ZK9 B;  3U58 A;  5C4X B;  1ILP A;  4JI5 Q;  1S5C D;  3EN2 A;  1BDO A;  3TQY A;  1UNS A;  1B9N A;  2JA5 H;  1IZ6 A;  2AUJ D;  4LJZ C;  4O42 A;  3G71 A;  4JI8 Q;  2IPK D;  4K2L A;  4OON A;  3R93 A;  3HOV H;  2EYO A;  1LLR D;  1II3 A;  3VYS A;  2OQ0 A;  2ZTC A;  5FOB B;  1LYL A;  5FLX L;  4PMC A;  2O4X A;  1HTL D;  4PZ6 A;  5EQ0 A;  3ULJ A;  1EY0 A;  5IGG A;  2VXW A;  1IBK Q;  2EYM A;  2OTJ A;  4C1N I;  3J80 i;  1VQK A;  5IT9 L;  2A74 C;  5D14 A;  4DNT B;  4A93 B;  4DR3 Q;  3DWP A;  2KCC A;  3ERS X;  4POG A;  4DPG A;  4DV1 L;  1NE3 A;  3I7F A;  3K7U C;  3GTQ B;  4KMU C;  4IPG A;  2EXZ A;  2MO1 A;  4XXE A;  2Z8L A;  1XMO L;  1T5X D;  2F0Q A;  1GXD C;  4IN3 A;  1DOK A;  2K1B A;  1CKO A;  4IUV A;  4PV1 C;  3I4L A;  3AYH B;  5DLQ E;  1QWY A;  4FF1 A;  1KNE A;  5GAE C;  3NBH B;  1HHV A;  1VQF A;  3NE5 B;  3GO5 A;  5ISR A;  4A3E H;  3HOY B;  3AFP A;  1TWH H;  1PXU A;  4LWC A;  5LMN L;  4KV6 A;  1FNV A;  5CBA E;  4K0K Q;  4K5V A;  1PH8 A;  2ASB A;  4K2K A;  3GTM B;  2QKI C;  4LF5 L;  1UEB A;  4DR6 L;  3URY A;  3I70 A;  4LUO A;  3PO3 B;  4R4C A;  4QUF A;  3PIP 3;  1KLU D;  2G9D A;  3GDE A;  3G4S A;  4KD3 A;  4KTA A;  1VQP A;  2Q8R E;  4A3E B;  3HOY H;  3DUZ A;  4QCL A;  1EOT A;  2OT2 A;  5G3L D;  2E8G A;  2MGS A;  2AKW B;  5KYL A;  4A93 H;  2WB1 B;  3S17 H;  5KYI A;  3ERQ A;  4OX9 L;  4GNX C;  3K5N A;  3PO2 G;  1U4R A;  3KF8 A;  1H9S B;  3BVG A;  2OWO A;  5FJ8 H;  4KHV A;  3W1B A;  3UDG A;  3L2P A;  1MD2 D;  3F2D A;  3GTP B;  3TRZ A;  4GLA C;  3IRB A;  2LY7 A;  3FEW X;  4GOP A;  1MBY A;  3M4O H;  4HIK A;  4CDC C;  1PZK D;  4JI3 Q;  1DOM A;  2UXD L;  1U4P A;  3OMG A;  2A69 C;  4ULL A;  4H44 C;  3S1M H;  1YHA A;  5IGE A;  2F3V A;  1CA6 A;  1PTO F;  4XDX A;  4H02 A;  4MTN A;  4A3M B;  4U67 3;  1LTA D;  1LV9 A;  3BS1 A;  1FYC A;  5EGT A;  2XGT A;  3EA6 A;  5JAV A;  4FXK C;  2Z1C A;  5FJ8 G;  4JI0 Q;  3HOV G;  2KJX A;  4GKJ Q;  4PG3 A;  4R4T A;  1HJP A;  4CDD C;  3L0O A;  4GS3 A;  1STN A;  4DAY A;  2F0U A;  2DN8 A;  2IW3 A;  4P72 A;  3R2I A;  1PRT D;  2WB1 E;  5KIX A;  1A2U A;  3CU7 A;  3HRZ C;  3HOX B;  2L12 A;  1I4H A;  2JQO A;  2ZXP A;  1EY8 A;  3PIP A;  4OO1 H;  3J7A 5;  3ZJY C;  1AW7 A;  5LHY 1;  3CCS A;  3PSI A;  1VQ8 A;  3M3Y H;  1Q1B A;  4A76 A;  3LX0 A;  2QDB A;  4ME5 A;  5LMN W;  4R8N A;  1H9R A;  1FR3 A;  1CI3 M;  5H1S E;  3HOW G;  1N32 Q;  1P8L A;  5CV7 A;  4POF A;  5E7N A;  1X3P A;  1DXM A;  1SRO A;  1FVI A;  4XQQ A;  1VQD A;  3HOX H;  1H9M A;  3I73 A;  3KF6 A;  2XVS A;  3GV6 A;  3HS0 C;  3TP6 A;  4DR5 Q;  2QEX A;  2K52 A;  2PO4 A;  3T53 B;  3DXJ C;  2R7Z G;  2PI2 A;  4ZYS A;  5KND A;  1JR0 D;  3JAM i;  1K8A C;  3OW7 A;  5IYB H;  2EQS A;  1L0X B;  2PZW A;  1GUT A;  3DEO A;  4JI7 L;  3SHL A;  5IOC A;  3HOX G;  1PH7 A;  1QOH A;  2A6H D;  5FO8 B;  3C0N A;  4I7Z C;  1EU4 A;  1KL9 A;  4YWL A;  4A3B G;  3MXG A;  4I7A A;  4DR2 Q;  3OWE B;  4IOC A;  2AQ2 B;  2YYZ A;  2KEN A;  3FKI H;  3HZX A;  1A2T A;  4X64 Q;  1E2W A;  1MSH A;  2HHH L;  2F0D A;  5JJI A;  1EZ8 A;  4LF5 Q;  1SAP A;  1HR0 Q;  4BY7 H;  2A8V A;  1Y1V G;  3S15 B;  1CUK A;  3MXN A;  5M5W H;  1BCP D;  2B8F A;  4B3T L;  4DR4 L;  3CD6 A;  5C3E H;  1TWG H;  3M4Y A;  1D5Z C;  2K04 A;  3D4R A;  3QR8 A;  3K0X A;  1V8Q A;  1XX8 A;  1V9P A;  3A5U A;  1QVC A;  4LFC L;  3CCV A;  3KFU A;  3J81 i;  4FNF A;  3HEJ A;  1SXT A;  3HOU G;  1AEX A;  4DV6 Q;  4PMB A;  5COR A;  5IE8 A;  3RLN A;  3SK8 A;  2PQE A;  1BBU A;  1JE5 A;  1X54 A;  4LFB L;  4X62 Q;  4HJ8 A;  1NR4 A;  2F0N A;  2J4X A;  4O1N A;  2NVX H;  2D62 A;  4AYB B;  3H0G B;  1G29 1;  1BOS A;  4KY7 A;  1PFN A;  1BQQ T;  2B2V C;  3UDX A;  5LMU L;  5IOD A;  1PFS A;  3TS0 A;  2IWH A;  1HNW L;  2UU9 Q;  1E2V A;  2EYL A;  1SFO B;  2K5V A;  1FL0 A;  3P7J A;  5K36 H;  2AHO B;  5JJZ A;  3W1G A;  2CW0 C;  4HIO A;  3I90 A;  5KNC A;  4GOP C;  4JI0 L;  1W6J A;  4GKJ L;  2M2L A;  5I6W A;  4ZUJ A;  2R7D A;  4C3I G;  3SDZ A;  1UAP A;  3GTO B;  3KBG A;  1AFP A;  3P75 A;  3BDO A;  1VQM A;  1N34 L;  5ELC A;  1M4V A;  2B2V A;  4AYB G;  2JA6 H;  4C3I B;  5LMU Q;  3J7Z C;  4DA2 A;  3RNU A;  2KCT A;  2EZV A;  4LF9 Q;  1Y69 U;  4FXG C;  3OMC A;  4DR6 Q;  2DNC A;  4JG2 A;  1VQJ A;  1T9H A;  1EYC A;  1O7Y A;  4ZQ3 A;  3CW2 C;  2JA8 B;  3QG1 A;  4DR1 L;  1W2B A;  4BWG B;  5DM7 3;  2XIW A;  1XMO Q;  5G3L F;  5IP9 G;  1ICF B;  4OWT B;  2RDH A;  3TP8 A;  3T1Y Q;  1ZXT A;  1B2T A;  3UE1 A;  2BA0 A;  4HN7 A;  4O2D A;  3UI2 A;  2D0O A;  4AQY L;  2JA9 A;  1CT1 D;  2XRQ D;  4A75 A;  1JWS D;  2Y0S G;  3OYY A;  1LTB D;  3U50 C;  3KLS X;  1X32 A;  2EIF A;  5EAY A;  1VQ4 A;  3BJU A;  2RVL A;  1I3Q B;  3NXW A;  5EKI A;  5L37 A;  3CMA A;  1JCK B;  5BR8 Q;  1CM9 A;  4Q5V A;  1WVL A;  2FHT A;  1SYF A;  2Y0S E;  3QIA A;  1B1Z A;  3C1E A;  4Y7N H;  1CHP D;  1SNM A;  2KQ3 A;  1NBW A;  1XJV A;  4BBS H;  2LXK A;  5C4J H;  3MTS A;  2AWO A;  4IUU A;  2A73 B;  3A8I E;  1TU2 B;  1R4P B;  1EY7 A;  5JPM C;  3CHB D;  4FF2 A;  3PO2 H;  2OEO A;  1LTR D;  4DAY B;  1K0R A;  2FJ2 A;  4M8A A;  3VYR A;  3GP7 A;  1OXT A;  2MHV A;  1IYV A;  2J0T D;  2A6E C;  3H3V H;  1PHJ A;  5DNF A;  3S14 H;  1CQV A;  3J81 c;  5JVH 3;  4JI4 Q;  1SYC A;  2M9V A;  5M3F H;  4BBR B;  4A3I G;  4UDU C;  5JOB A;  2K05 A;  4JC0 A;  3MZ5 A;  5EPL A;  1JJG A;  4G7Z C;  1UE6 A;  1K3B C;  1X6O A;  2I5H A;  3E9H A;  2VB3 X;  3P1H A;  3PV0 A;  1HR0 W;  2X69 A;  3Q22 A;  3S1M B;  5CMD A;  4BBS B;  3MEH A;  3PGZ A;  4HJ9 A;  1HPC A;  1N36 Q;  4RCO A;  3I55 A;  3KLS A;  1K3R A;  5E4W C;  1PMR A;  3G4O A;  2RHQ B;  3K5L A;  3WWV A;  4A3F G;  3H91 A;  2VY3 A;  3V96 A;  1PV4 A;  2D0P A;  2VNU D;  5EPJ A;  1TS4 A;  2ALY B;  4IQZ A;  3C2P A;  1RKN A;  3K7A H;  1YNN C;  3VYT A;  4JBW A;  1OXS C;  1BR9 A;  1A3V A;  1D1K A;  4YCV A;  3S1N B;  1TWC B;  1VDZ A;  4WFN 3;  2EYH A;  2IHE A;  2PQA A;  4BY1 B;  5IP7 G;  2EYP A;  3VR2 A;  4C2M H;  1EQV A;  3DWA A;  3L9A X;  1K8G A;  2B63 H;  2HQL A;  4HJ7 A;  3GD7 A;  4X62 L;  4XQN A;  3OW2 A;  4A3L G;  1BBX C;  3U9O A;  1YBY A;  1TWC H;  1I4G A;  2AQ3 B;  2RDF A;  3RD4 A;  1GD7 A;  1XYI A;  2TMP A;  2FMC A;  3MEF A;  3CRK C;  1CHQ D;  1I4Q A;  1FJG L;  3GQB A;  4K0K L;  1HR0 L;  1LAB A;  2PW7 A;  4C2M B;  3TZU A;  1YI2 A;  4DGZ A;  4RWS C;  2R61 A;  1KIX A;  3OWF A;  2L4N A;  2Q8I B;  5ELO A;  1G2T A;  1QUQ B;  4DNR B;  1IXR A;  1WCM G;  2CQO A;  1V1P A;  1L0W A;  3SGI A;  4IUT A;  1QNU A;  4HMI A;  5HY6 A;  4HIM A;  4AQY Q;  3D6C A;  4X65 Q;  5F2D A;  4CJ1 B;  3KBX A;  4G7H C;  4NPS A;  1WI5 A;  3RUZ A;  4KK7 A;  1HA5 A;  3EBE A;  3KLW A;  3PO2 B;  5BR8 L;  2JA5 G;  4C1N K;  4JBM A;  2K5H A;  1EYG A;  1I4R A;  4I65 A;  5KNB A;  2L1B A;  4RHS A;  1DCZ A;  1S40 A;  2NZH A;  1HZB A;  1TS3 A;  4YY3 L;  3K59 A;  4FDB A;  2EXD A;  1TS5 A;  4JI6 Q;  3FPU B;  2CKZ B;  4N8F A;  3TEH B;  5GAG C;  2F4V Q;  2B2T C;  1GVP A;  2UUA Q;  1PRT F;  4DV0 L;  4GNX A;  5M3F G;  1YJN A;  1PFB A;  1QB5 D;  2DGY A;  1CKM A;  3T1H L;  3S9W A;  4DAP A;  2WKD A;  3Q8D A;  1YEZ A;  2B39 A;  2RKS A;  4ALP A;  3BYY B;  2HUG A;  4Y7N B;  3BZD B;  4CJ0 B;  1QVF A;  1PRT B;  2TSS A;  4B3M Q;  4PZ8 A;  4DV3 Q;  2K32 A;  3S17 B;  2CHB D;  2ZXR A;  2HT1 A;  1E3P A;  1VQG A;  2BH8 A;  1CKN B;  3BZC A;  5CBE E;  1MJC A;  1X65 A;  4EQ5 A;  1VQN A;  1SJH D;  2R93 G;  2YTX A;  5C0X G;  4X6A H;  4BY1 H;  1JOR A;  3S16 H;  2F0I A;  1HZ9 A;  1IW7 C;  1SRU A;  4DV3 L;  1JC7 A;  2R93 H;  1HNZ L;  4DN4 M;  4N9T A;  2AQ1 B;  1VQO A;  2OCE A;  4DV0 Q;  4UPA A;  1WTR A;  2UXB L;  1DJR D;  4YHH L;  1VQ5 A;  1IBL L;  2JE6 I;  3BVM A;  3DM3 A;  5C44 G;  1BXT A;  2M00 A;  5DM6 3;  1PDQ A;  5JVG 3;  1F2Z A;  1HZA A;  1BBW A;  2WV6 D;  3NQT A;  4FVM A;  4B08 A;  3EVQ A;  1WTH A;  5IWA L;  1PH2 A;  3LNN A;  3NBH A;  3NTH A;  2LKV A;  2L9H A;  2KVM A;  4IUR A;  2F0O A;  2KEC A;  2R92 G;  1U9R A;  1STH A;  4DK3 C;  2QIL A;  1GJX A;  4K6L A;  1YNJ D;  1FJG Q;  2DNE A;  1BNZ A;  4Z9C B;  1SR3 A;  3PUZ A;  2JA7 G;  2HHH Q;  3I91 A;  4B3S Q;  2F4I A;  2WP8 J;  2EY2 A;  5CR3 A;  2BOS A;  1HZC A;  3ULP A;  2XN9 C;  1V43 A;  3MA2 B;  2PQA B;  2L5T A;  4HJA A;  4JOI C;  5COY A;  3G4N A;  4JBK A;  1AE3 A;  1HQR D;  1BUV T;  3PMF A;  3S1R H;  3N6R A;  4L5Q A;  3KYH C;  1B7Y B;  1H9J A;  3FP9 A;  4A3F B;  4LK1 C;  2E5L L;  4X3S A;  5LMN Q;  4RGO S;  4ME3 A;  2NTT A;  4MHE A;  1WTP A;  5ELF A;  2E5L Q;  3RZO B;  2WIN B;  1ZYR D;  2A5H A;  3PCO B;  4DUZ L;  2RBM A;  2PMZ E;  4X65 L;  1Q8K A;  2EOT A;  1CK1 A;  1VS0 A;  1PTO H;  2BH2 A;  2I46 A;  5C3W A;  1QUQ A;  4DK0 A;  2B2Y C;  4GLV B;  4YIJ A;  3JC6 6;  2A6H C;  1U4M A;  4FP5 D;  5A35 A;  3S24 A;  4EQO A;  1PYW D;  2D2C C;  4QIW B;  4UHV A;  3VDY A;  5BN4 A;  1GOZ A;  2E2I B;  3CCE A;  2ATW A;  1OXU A;  3H6M A;  2DJG C;  3AFQ A;  3N52 A;  4WJW A;  4JI1 L;  2F4V L;  1LAC A;  1WOC A;  4DV5 L;  1LTT D;  4DV4 L;  2F3W A;  2Q2I A;  1SE3 A;  4RCN A;  1RCV D;  2LMC B;  5IIF A;  2JP1 A;  1LTS D;  3WOF A;  5T1I A;  3S15 H;  2E2J B;  3KDF B;  2YU9 H;  3NTI A;  3S2D B;  4DAV A;  4OIK A;  1Y1W G;  1D7Q A;  1CSQ A;  2JJQ A;  1KRT A;  3GTK B;  3QJY A;  5KGU A;  5J39 A;  1QG7 A;  1VQA A;  2ZJR A;  4KHZ A;  4HCE A;  1JOK A;  3E9I A;  4LF6 L;  4HCS A;  3NWT A;  2ZM6 L;  1XNQ L;  4GKK Q;  4HAE A;  1HNX Q;  2E2J H;  2EE1 A;  1SYB A;  2JA8 G;  3RZD H;  4LAA A;  3PF5 A;  5C3E B;  1K73 C;  1G6Z A;  1N8R C;  1P16 A;  1LTL A;  4J1M A;  2UUC Q;  1NMF A;  5IT9 c;  1WTQ A;  4M1U B;  5IP7 H;  1KDA A;  4YY3 Q;  3MFY A;  5ELB A;  4B9X A;  1QIL A;  4HMJ A;  4X64 L;  1WTX A;  3F2C A;  2R92 H;  4B9W A;  1YZ6 A;  3A55 A;  3FHW A;  3E6Z X;  3GTO H;  5C5L A;  2VQE L;  5EBD A;  4IOA A;  4XIG S;  1Y14 B;  4A3D H;  4U68 A;  4GN3 B;  5C4X G;  1GUS A;  1TWA B;  2BE5 D;  2HQE A;  4IFD J;  2E75 C;  1XPR A;  4B3S L;  1SYG A;  2JA5 B;  3F2U A;  3PUW A;  4C3J G;  2C35 B;  3M4O B;  5CV4 A;  1ASY A;  4DK1 A;  1Z47 A;  5EKL A;  1XWE A;  1XMQ L;  3RR5 A;  2JA6 B;  5CV6 A;  4DV1 Q;  1F2L A;  1NTG A;  5FLX c;  1PH1 A;  1Z52 A;  3I4M G;  1XTC D;  1C9O A;  3CPW A;  1J5E L;  1ENA A;  1QZG A;  1A8V A;  2K5W A;  4TRD A;  3MAQ A;  5I2X A;  4ZCK A;  2N3S A;  3IFT A;  4X66 L;  4K8I A;  3WOE A;  1YHB A;  1SJE D;  2GA4 B;  2PW5 A;  5I9O A;  1BF4 A;  3DLL A;  5KRU A;  1WD1 A;  1RHP A;  4LW1 A;  3VR3 A;  1O7I A;  4LF8 L;  4IPH A;  2B29 A;  4UAI A;  1H9S A;  2BCO A;  4X66 Q;  1I6H B;  1PH3 A;  4HID A;  2NVT B;  3R2T A;  3T16 A;  4TQU S;  1EQR A;  1UEA B;  1DM0 B;  1NCV A;  1PLF A;  4KJN A;  4DV7 Q;  1J5E Q;  3MXP A;  3IFD A;  4BY1 G;  5BN5 A;  1A3T A;  3BDL A;  3EJI A;  3TBI B;  2CQA A;  1L2F A;  2BDO A;  3C0O A;  3DM1 A;  4DV5 Q;  3HOU B;  5DAU A;  3H15 A;  3EIV A;  4NP5 A;  3DEP A;  2C5C A;  1EY6 A;  4RGN A;  2B2Y A;  4KKT A;  3Q0A A;  4A3K H;  2RDG A;  3K58 A;  2UXD Q;  1EOV A;  1LT4 D;  1RL2 A;  1CFM A;  1JOO A;  1B70 B;  2E2H B;  2YV5 A;  4J8Q A;  2CVR A;  1W6K A;  2R7Z B;  1WTW A;  1GHK A;  1RD9 D;  2E2D C;  4BBS G;  1BKB A;  5T1G A;  1NY4 A;  5FK9 C;  2Q2U A;  4RKL A;  4UP8 A;  1KNA A;  4JI4 L;  3L7Z C;  3M9B A;  2B2T A;  2EJG C;  3G6J B;  5J22 A;  3HOZ H;  4CBV A;  2SNM A;  5AFW A;  1EIF A;  4JV5 L;  4NMZ A;  4KY6 A;  1OTC A;  1QJO A;  2XRS D;  5M3M G;  4JI6 L;  2NN6 G;  5IYD H;  1A15 A;  1EY9 A;  4A3I B;  4IPD A;  1ZEQ X;  3I8Z A;  4L5T A;  1RF2 D;  2EPB A;  1JJC B;  3B6Y A;  1JJ2 A;  1K83 H;  2HCI A;  2I07 B;  1Y8N B;  1IBM Q;  4CDE C;  2PI2 E;  3FRP B;  2DJF C;  1Y1V H;  3UDI A;  1N33 L;  1Q7Y C;  5M5Y H;  2OXP A;  3KLR A;  3HGB A;  3HOZ B;  1VMP A;  4UY8 C;  5C4X H;  1TS2 A;  2F0W A;  4JV5 Q;  2K50 A;  3OIP A;  4IZ8 A;  1K83 B;  1MJE A;  2R6G A;  4NXN Q;  2KCM A;  4UP7 A;  2E74 C;  4H0L C;  1A0I A;  1Q90 A;  1VF7 A;  4XYO A;  1JB7 A;  1SNO A;  4A3M G;  3BVZ A;  2ZTD A;  4YCW A;  3BZK A;  2UXC L;  2IL8 A;  5EJW A;  3TZD A;  1WTO A;  1SNQ A;  4XTC S;  3D0F A;  1EEF D;  1TWF H;  4O0A A;  1PTO B;  1NSN S;  3X3M A;  3AB9 A;  3J7A V;  3OOC A;  3H0G H;  2K7V A;  3I4M H;  2V1C C;  5KEE A;  5M3M B;  3J81 L;  1PRT C;  3I4N B;  1VQ9 A;  2BDN A;  4A3J B;  3GTJ H;  1G91 A;  2RHS B;  1OXV A;  4AIM A;  4EQN A;  2ENB A;  3NUC A;  4RFB A;  5I9P A;  1HFN A;  2F0E A;  1JT8 A;  1FNU A;  5TSS A;  1N9W A;  1PTO C;  2E76 C;  4MZ9 A;  1IL2 A;  3NBI A;  1TWH B;  2XNA C;  4DR7 L;  1EQT A;  3CCM A;  1HNZ Q;  2A1A A;  3AEV A;  3CP0 A;  1ZKO A;  1EUJ A;  1ESF A;  4ZAI A;  4A3L H;  2D9U A;  3T13 A;  3UDF A;  3C1F A;  1PZJ D;  2SEB D;  5EKK A;  1TR5 A;  3SEB A;  4QUC A;  4R4I A;  2ZM6 Q;  4A3J H;  1XNQ Q;  1AE2 A;  4KN4 C;  2UUB Q;  4GKK L;  3GTG B;  1UWV A;  1IKM A;  4BA1 I;  1NNX A;  3SK6 A;  2UXB Q;  2N78 A;  4JI2 L;  1V1P B;  1AP0 A;  3HOV B;  1R9T H;  1F9S A;  2CCZ A;  4P73 A;  1VQ6 A;  4MN3 A;  3CC2 A;  3TN2 A;  2L15 A;  1SBB B;  3FDT A;  4JI2 Q;  2K5Q A;  3NQI A;  4BXX H;  3VR4 A;  1M90 C;  4LFB Q;  1RDP D;  4A3M H;  1YIJ A;  2CH4 A;  4J6H A;  1SEB D;  3ND8 A;  4IUN A;  3R8B A;  2L11 A;  2VZA A;  1KAB A;  3KUP A;  4DKA C;  5C4J B;  1MKH A;  4R4Q A;  1HUM A;  1ROD A;  5ELE A;  1H9K A;  1KD1 C;  1ICW A;  1I6V C;  4AYB E;  1MGS A;  2EVB A;  2RSN A;  3M4Q A;  4C3H H;  2LFN A;  4HJ5 A;  1LTI D;  1S3O A;  2RCF A;  4ZKB B;  1D2B A;  5CV5 A;  1R9T B;  2K03 A;  3H3V C;  3F1Z A;  1QCB D;  2J7Z A;  2RQX A; 
#chains in the Genus database with same CATH homology
 3SK5 A;  5BN3 A;  2NZ1 D;  2O5I C;  2G9H D;  3SK4 A;  1Z6H A;  2FFK B;  2K01 A;  4CHT B;  4KD4 A;  3K5O A;  2KCN A;  4LMQ D;  3MVV A;  2B2U C;  2IX0 A;  1LT6 D;  1J9O A;  2JXM B;  4C3J B;  2AUK A;  3AU7 A;  3K57 A;  5JEA H;  4A3B B;  3QO2 A;  2EY5 A;  1EWH A;  1ILQ A;  2VUM B;  3CQZ B;  2K28 A;  1U4L A;  2NUC A;  2F0K A;  4P2C B;  1KDB A;  2NB0 A;  1S5B D;  2KA7 A;  3MWY W;  3SR1 A;  4BA2 I;  1A3U A;  1MI2 A;  1IYU A;  1L0Y B;  3EQL C;  3IKJ A;  3VR5 A;  4CKB A;  4CJ2 C;  1RTO A;  2PPB C;  5M3F B;  4KKS A;  1ET6 A;  4GZY C;  3C0M A;  1V1O A;  4JK1 C;  2JEB I;  4IUQ A;  4A3K B;  5M5Y B;  3ZYY X;  2HDL A;  2CW0 D;  1Y1W B;  5IGC A;  4K6D A;  2HCC A;  1G2S A;  1EWC A;  5JEA J;  1TVX A;  4BY7 B;  1Y8P B;  3H09 A;  5CV8 A;  3MHB A;  4DFA A;  2B2W A;  2FMM A;  1ENF A;  1AN8 A;  3HOW B;  1HTP A;  3J80 E;  4OO1 G;  5IGB A;  3BG3 A;  1ML0 D;  4TSS A;  1WCM B;  1OO9 B;  2F0J A;  2F0T A;  3OHX C;  1JWU D;  1IKL A;  3ONA B;  5E3F A;  2MP1 A;  3TDQ A;  3VYU A;  1STY A;  3T56 B;  1SND A;  2B2U A;  1ESR A;  1B4O A;  3FKI B;  1WD0 A;  1EEI D;  5D3I B;  1XXG A;  2F0H A;  4KKU A;  1HQM C;  4K5X A;  3ERO A;  2B63 B;  2H1E A;  4CKC A;  2F0G A;  4NDX A;  4XYQ A;  3EFX D;  1DON A;  2DY8 A;  1RTN A;  1TWG B;  1F2Y A;  2L0C A;  2R92 B;  1DD2 A;  4HSP A;  4X3U A;  4E6I A;  3V2T A;  3SVM A;  4FF3 A;  4A3D B;  4RKB A;  4RH6 A;  5FO7 B;  3FPP A;  5CGK A;  4L63 B;  1B9M A;  1TY2 A;  1STA A;  2IX3 A;  2JYO A;  1BCP F;  3QOL A;  1NAP A;  1S5E D;  1Q12 A;  1RJT A;  1LT3 D;  3RZD B;  1SSO A;  1HA6 A;  4IFD H;  3QB3 A;  1O7L A;  1SNC A;  1GUN A;  1SE4 A;  2B8G A;  1TT2 A;  1E2Z A;  1Q3L A;  2FIN B;  2R93 B;  5IT9 E;  1EYA A;  2BE5 C;  4XT3 B;  2MPM A;  1SNP A;  3G7L A;  2EY6 A;  5I6Y A;  2PCF B;  5C0X I;  1FD7 D;  1HXY D;  2KUM A;  5I2Y A;  2DY7 A;  1I4X A;  1ONL A;  5K36 G;  1QNK A;  3I3C A;  4KY5 A;  2ICI A;  3PUV A;  1YNJ C;  4G7O C;  1VMC A;  1Q8I A;  3T51 B;  3S1R B;  1O80 A;  2XSC A;  5ELD A;  1STG A;  2KEE A;  4H7B A;  3NTK A;  1D1I A;  3I72 A;  2Q8T A;  1HCZ A;  3PUY A;  5C4Z A;  4L6T B;  5JPN C;  1AZP A;  1JOQ A;  4K14 A;  4XT1 B;  5E1F A;  3Q24 A;  1NUC A;  3MC0 B;  1F77 A;  1O7Z A;  2NYZ D;  3WDN A;  1T5E A;  4V0B A;  1NR2 A;  2SNS A;  1LO5 D;  2EYF A;  3D6W A;  1SDF A;  2KED A;  3JAM L;  3HP3 A;  3J81 E;  2QEJ C;  2X6G A;  5C4H A;  5NUC A;  1G8Z D;  3K6O A;  3M7G A;  4FYD A;  3O13 A;  1I4P A;  1JQY D;  1A6X A;  4RHR A;  4IFD I;  2JSO A;  3HKZ B;  1ENC A;  4IAL A;  2ICE C;  1DOL A;  4S3S A;  4Q0F A;  5D65 A;  3ND9 A;  5HUR A;  4V19 0;  3A8K E;  3P20 A;  5E4X A;  2K5D A;  1PRE A;  4F7X A;  1S4Z A;  4QMG A;  4R9W A;  1LT5 D;  4G4K A;  3LWU A;  2OF1 A;  1Y8O B;  2AWN A;  4HED A;  3NSW A;  2BA1 A;  1B3A A;  2F0L A;  1J8I A;  3FMC A;  4QB4 A;  1GUG A;  3TSS A;  1KLG D;  5EPK A;  3BDC A;  5C0X J;  1K8O A;  3TP7 A;  2D5D A;  2F0F A;  1UUP A;  3SXH A;  3NPP A;  2EY1 A;  1X3Q A;  3IAY A;  3J80 L;  2V4D A;  2EYJ A;  4ZRZ A;  3QWN A;  1JE4 A;  2KOL A;  3W3A A;  2JEA I;  1TII D;  5CYU A;  4IFD G;  5A2Q E;  1CQF A;  2QCP X;  4H13 C;  4PMW A;  2RSO A;  3CRL C;  5LL6 S;  4HTH A;  5IGF A;  1EYD A;  4CGY B;  4F87 A;  1KDC A;  1KAA A;  2SOB A;  3S14 B;  4BS9 A;  1VF5 C;  1TWF B;  3HG9 A;  4QF4 A;  4EQP A;  4FXD A;  2WII B;  1AZQ A;  3A54 A;  3DWQ A;  2NVQ B;  1D5M C;  3V05 A;  5D3D A;  5M5X B;  3OSO A;  1CZG A;  4F8M A;  2EJF C;  3NK9 A;  3M85 A;  4DU9 A;  4X3K A;  4ZKC B;  4PQX A;  4ABN A;  5C3X A;  2HDM A;  1IL8 A;  4IUP A;  3D3R A;  2O2L D;  2A68 C;  4CKE A;  1F9Q A;  2F0S A;  2QF7 A;  3VA5 A;  4OO1 I;  1ZYR C;  4NW2 A;  3RLF A;  5C0X H;  4KN7 C;  1DYQ A;  3C3L A;  4OIJ A;  2MUY A;  5M9O A;  2F0V A;  2Y0S B;  1EFI D;  5HGT A;  2Z4H A;  4ZUI A;  4ODG A;  2NWG A;  2XWB B;  4MIU A;  3X3N A;  4ID6 A;  4EVO A;  4K8J A;  3PUX A;  2F1M A;  1CA5 A;  3AMU A;  1SYE A;  1QE6 A;  3TME A;  2NBF A;  1Q1E A;  3NHH A;  3PIO 3;  4XQJ A;  1EZ6 A;  4DF7 A;  4FF4 A;  2Z4I A;  4F88 A;  1EY5 A;  3W2D A;  4KJO A;  3LWE A;  2KHS A;  2LS0 1;  1EIH A;  3MXU A;  3C46 A;  1D6E C;  1JIC A;  1TQO A;  3SE0 A;  1JB3 A;  1OXX K;  1IHZ A;  2NVY B;  1FNW A;  2K6A A;  2WAC A;  1VCI A;  4OL7 A;  5FLX E;  1K8M A;  3S16 B;  3S2H B;  2MJ8 A;  2PNR C;  3BYT B;  1PFM A;  1BCP B;  1Y1V B;  3OIQ A;  1I50 B;  2IJ0 A;  2WAQ B;  4KI0 A;  3A7A B;  3T4A C;  4C56 C;  1HRJ A;  3Q23 A;  1CTM A;  1ET9 A;  4L8J A;  1HFG A;  3M7N A;  4EGV A;  2C9O A;  2ZXO A;  1R4Q B;  3S1Q B;  5LL6 X;  3VR6 A;  2A68 D;  5M5W B;  1EL0 A;  5CV9 A;  1EY4 A;  2F0M A;  2PYK A;  4ILW A;  1F9P A;  1IW7 D;  3FVQ A;  2X6L A;  4DXG A;  1O78 A;  4A3G B;  2N88 A;  1TKW B;  5A2Q L;  5EBC A;  5C6A A;  1GHJ A;  3DHQ A;  5CC4 A;  1WTV A;  3D4D A;  1STB A;  1BCP C;  1E0B A;  2O5J C;  2XWJ B;  2IX1 A;  2EDG A;  3CKI B;  2L55 A;  3GTL B;  1S5D D;  3VA7 A;  4NKL A;  1STE A;  1Z7T A;  4DXF A;  2ZT9 C;  5K5P A;  1FGB D;  1MSG A;  1EIG A;  2F0P A;  1B44 D;  1PZI D;  4OGQ C;  4C3H G;  2VB2 X;  4OHJ A;  5DEH A;  2NTS A;  3RMH A;  1SE2 A;  2PMZ B;  4RAU C;  4WOR A;  4HSV A;  5FKA C;  2NN6 H;  3GTJ B;  3K0Y A;  1SMY C;  1HUN A;  1TY0 A;  3A8J E;  2A69 D;  2NVX B;  1F2M A;  1JWM D;  1C48 A;  2B2W C;  2SDF A;  4R8I A;  3H94 A;  2ID0 A;  2NN6 I;  2RA4 A;  1M8A A;  3DMU A;  4FO2 A;  1GUW A;  4WRD A;  2K33 A;  3OPO A;  1F9R A;  2PZT A;  1BO0 A;  1S5F D;  3D8G A;  3NWS A;  1CZW A;  4PNY A;  1LTG D;  2EJM A;  2WKC A;  3J7Y W;  3A56 A;  3A7L A;  1B50 A;  4TKO B;  1SYD A;  3JAM E;  1KTK A;  3R3O A;  5JEA G;  1DZ1 A;  5IGD A;  3D4W A;  3IL8 A;  5J1Z A;  3QOJ A;  1GUO A;  4N9P A;  4HR7 B;  3J7A F;  2JA7 B;  4RGM A;  5FO9 B;  3U9S A;  3K7A B;  1C4Q A;  5C5M A;  3E5S A;  1EU3 A;  3M3Y B;  2YU9 B;  3TP5 A;  4X3T A;  2PZU A;  1B53 A;  2A6E D;  3Q6S A;  5C44 B;  4ZLT F;  2F03 A;  2H4O A;  4RGT A;  2R3Z A;  3E0J A;  3MFG A;  5I4D A;  4G57 A;  2IT1 A;  1C8C A;  3ITP A;  3I4M B;  1PTO D;  1YNN D;  1D5X C;  3D31 A;  4RA8 A;  3NP8 A;  4C3H B;  3L3O C;  2N55 A;  1SMY D;  3K5M A;  3GV3 A;  4K5W A;  3KK7 A;  4ZK9 B;  5C4X B;  1ILP A;  1S5C D;  1BDO A;  1UNS A;  1B9N A;  2AUJ D;  4LJZ C;  4O42 A;  2IPK D;  4K2L A;  3R93 A;  2EYO A;  1LLR D;  1II3 A;  3VYS A;  5FOB B;  5FLX L;  4PMC A;  2O4X A;  1HTL D;  5EQ0 A;  1EY0 A;  5IGG A;  2VXW A;  2EYM A;  4C1N I;  5IT9 L;  2A74 C;  5D14 A;  4DNT B;  4A93 B;  3DWP A;  2KCC A;  3GTQ B;  4KMU C;  2EXZ A;  4XXE A;  2Z8L A;  1T5X D;  2F0Q A;  1GXD C;  4IN3 A;  1DOK A;  2K1B A;  4IUV A;  4PV1 C;  3I4L A;  1QWY A;  4FF1 A;  1KNE A;  1HHV A;  3NE5 B;  3GO5 A;  5ISR A;  3HOY B;  1PXU A;  4KV6 A;  1FNV A;  5CBA E;  4K5V A;  4K2K A;  3GTM B;  2QKI C;  3URY A;  3I70 A;  3PO3 B;  4QUF A;  3PIP 3;  1KLU D;  2G9D A;  4KD3 A;  4KTA A;  2Q8R E;  4A3E B;  3DUZ A;  4QCL A;  1EOT A;  2OT2 A;  5G3L D;  2MGS A;  5KYL A;  2WB1 B;  5KYI A;  3ERQ A;  3K5N A;  1U4R A;  3KF8 A;  1H9S B;  3BVG A;  4KHV A;  1MD2 D;  3GTP B;  2LY7 A;  3FEW X;  1MBY A;  1PZK D;  1DOM A;  1U4P A;  3OMG A;  2A69 C;  4ULL A;  4H44 C;  5IGE A;  2F3V A;  1CA6 A;  1PTO F;  4XDX A;  4A3M B;  4U67 3;  1LTA D;  1LV9 A;  3BS1 A;  1FYC A;  5EGT A;  3EA6 A;  5JAV A;  4FXK C;  2Z1C A;  2KJX A;  1STN A;  4DAY A;  2F0U A;  2DN8 A;  2IW3 A;  3R2I A;  1PRT D;  5KIX A;  1A2U A;  3CU7 A;  3HRZ C;  3HOX B;  2L12 A;  1I4H A;  2ZXP A;  1EY8 A;  4OO1 H;  5LHY 1;  1AW7 A;  1Q1B A;  3LX0 A;  2QDB A;  4ME5 A;  4R8N A;  1H9R A;  1FR3 A;  1CI3 M;  5CV7 A;  1X3P A;  1DXM A;  4XQQ A;  1H9M A;  3I73 A;  2XVS A;  3GV6 A;  3HS0 C;  3TP6 A;  2PO4 A;  3T53 B;  3DXJ C;  4ZYS A;  5KND A;  1JR0 D;  3OW7 A;  1L0X B;  2PZW A;  1GUT A;  3DEO A;  3SHL A;  5IOC A;  1QOH A;  2A6H D;  5FO8 B;  3C0N A;  4I7Z C;  1EU4 A;  3MXG A;  3OWE B;  2AQ2 B;  2YYZ A;  3HZX A;  1A2T A;  1E2W A;  1MSH A;  2F0D A;  1EZ8 A;  1SAP A;  3S15 B;  3MXN A;  1BCP D;  2B8F A;  3M4Y A;  1D5Z C;  2K04 A;  3D4R A;  1V8Q A;  1XX8 A;  4FNF A;  3HEJ A;  1SXT A;  1AEX A;  4PMB A;  5COR A;  3SK8 A;  2PQE A;  1NR4 A;  2F0N A;  2J4X A;  4O1N A;  2D62 A;  4AYB B;  3H0G B;  1G29 1;  1BOS A;  4KY7 A;  1PFN A;  1BQQ T;  2B2V C;  5IOD A;  2IWH A;  1E2V A;  2EYL A;  1SFO B;  3P7J A;  5K36 H;  5JJZ A;  2CW0 C;  3I90 A;  5KNC A;  1W6J A;  2M2L A;  5I6W A;  4ZUJ A;  4C3I G;  3SDZ A;  1UAP A;  3GTO B;  3KBG A;  1AFP A;  3P75 A;  3BDO A;  5ELC A;  1M4V A;  2B2V A;  4C3I B;  4DA2 A;  2EZV A;  1Y69 U;  4FXG C;  3OMC A;  2DNC A;  1EYC A;  1O7Y A;  4ZQ3 A;  2JA8 B;  3QG1 A;  4BWG B;  5DM7 3;  2XIW A;  5G3L F;  2RDH A;  3TP8 A;  1ZXT A;  1B2T A;  2BA0 A;  4HN7 A;  3UI2 A;  1CT1 D;  2XRQ D;  1JWS D;  1LTB D;  3KLS X;  1X32 A;  2RVL A;  1I3Q B;  3NXW A;  5EKI A;  1JCK B;  1CM9 A;  4Q5V A;  1WVL A;  2FHT A;  1SYF A;  3QIA A;  1B1Z A;  3C1E A;  1CHP D;  1SNM A;  2KQ3 A;  3MTS A;  2AWO A;  4IUU A;  2A73 B;  3A8I E;  1TU2 B;  1R4P B;  1EY7 A;  5JPM C;  3CHB D;  4FF2 A;  2OEO A;  1LTR D;  2FJ2 A;  3VYR A;  4M8A A;  3GP7 A;  1OXT A;  2MHV A;  1IYV A;  2J0T D;  2A6E C;  5DNF A;  1CQV A;  5JVH 3;  1SYC A;  2M9V A;  4BBR B;  4UDU C;  5JOB A;  2K05 A;  3MZ5 A;  5EPL A;  4G7Z C;  2VB3 X;  3P1H A;  3PV0 A;  2X69 A;  3Q22 A;  3S1M B;  5CMD A;  4BBS B;  3MEH A;  1HPC A;  4RCO A;  3KLS A;  5E4W C;  1PMR A;  3G4O A;  3K5L A;  3H91 A;  3V96 A;  2VNU D;  5EPJ A;  1TS4 A;  4IQZ A;  3C2P A;  1RKN A;  1YNN C;  3VYT A;  4JBW A;  1OXS C;  1BR9 A;  1A3V A;  1D1K A;  3S1N B;  1TWC B;  1VDZ A;  4WFN 3;  2EYH A;  4BY1 B;  2EYP A;  3VR2 A;  1EQV A;  3DWA A;  3L9A X;  3GD7 A;  4XQN A;  1BBX C;  3U9O A;  1I4G A;  2AQ3 B;  2RDF A;  3RD4 A;  1XYI A;  2TMP A;  2FMC A;  3CRK C;  1CHQ D;  1I4Q A;  3GQB A;  1LAB A;  2PW7 A;  4C2M B;  3TZU A;  4DGZ A;  4RWS C;  2R61 A;  3OWF A;  2L4N A;  2Q8I B;  1G2T A;  4DNR B;  1V1P A;  4IUT A;  1QNU A;  4HMI A;  3D6C A;  5F2D A;  4CJ1 B;  3KBX A;  4G7H C;  3RUZ A;  4KK7 A;  1HA5 A;  3PO2 B;  4C1N K;  1I4R A;  4I65 A;  5KNB A;  2L1B A;  4RHS A;  1DCZ A;  1TS3 A;  3K59 A;  1TS5 A;  3FPU B;  2B2T C;  1PRT F;  1PFB A;  1QB5 D;  3S9W A;  4DAP A;  2WKD A;  2B39 A;  2RKS A;  3BYY B;  2HUG A;  4Y7N B;  3BZD B;  4CJ0 B;  1PRT B;  2TSS A;  2K32 A;  3S17 B;  2CHB D;  2ZXR A;  5CBE E;  1SJH D;  5C0X G;  1JOR A;  2F0I A;  1IW7 C;  1JC7 A;  4DN4 M;  4N9T A;  2AQ1 B;  1WTR A;  1DJR D;  2JE6 I;  3BVM A;  1BXT A;  2M00 A;  5DM6 3;  1PDQ A;  5JVG 3;  1F2Z A;  3NQT A;  2WV6 D;  4FVM A;  4B08 A;  3EVQ A;  3LNN A;  3NBH A;  3NTH A;  2LKV A;  2L9H A;  2KVM A;  4IUR A;  2F0O A;  2KEC A;  1U9R A;  1STH A;  2QIL A;  1GJX A;  4K6L A;  1YNJ D;  2DNE A;  1BNZ A;  4Z9C B;  3PUZ A;  3I91 A;  2F4I A;  2WP8 J;  2EY2 A;  5CR3 A;  2BOS A;  2XN9 C;  1V43 A;  3MA2 B;  2L5T A;  5COY A;  3G4N A;  1HQR D;  1BUV T;  3PMF A;  3N6R A;  1H9J A;  4A3F B;  4LK1 C;  4X3S A;  4RGO S;  2NTT A;  4MHE A;  1WTP A;  5ELF A;  3RZO B;  2WIN B;  1ZYR D;  2A5H A;  2RBM A;  2EOT A;  1CK1 A;  1PTO H;  2I46 A;  5C3W A;  4DK0 A;  2B2Y C;  4YIJ A;  2A6H C;  1U4M A;  4FP5 D;  5A35 A;  4EQO A;  1PYW D;  2D2C C;  4QIW B;  5BN4 A;  1GOZ A;  2E2I B;  1OXU A;  3H6M A;  3N52 A;  4WJW A;  1LAC A;  1LTT D;  2F3W A;  1SE3 A;  4RCN A;  1RCV D;  2LMC B;  5IIF A;  2JP1 A;  1LTS D;  3WOF A;  5T1I A;  2E2J B;  3NTI A;  3S2D B;  4DAV A;  4OIK A;  3GTK B;  3QJY A;  5KGU A;  5J39 A;  1QG7 A;  4KHZ A;  4HCE A;  1JOK A;  4HCS A;  3NWT A;  4HAE A;  2EE1 A;  1SYB A;  4LAA A;  5C3E B;  1G6Z A;  4J1M A;  1WTQ A;  4M1U B;  1KDA A;  3MFY A;  5ELB A;  4B9X A;  1QIL A;  4HMJ A;  1WTX A;  4B9W A;  3A55 A;  3E6Z X;  5C5L A;  5EBD A;  4XIG S;  4U68 A;  1GUS A;  1TWA B;  2BE5 D;  2HQE A;  4IFD J;  2E75 C;  1SYG A;  2JA5 B;  3F2U A;  3PUW A;  4C3J G;  3M4O B;  5CV4 A;  4DK1 A;  1Z47 A;  5EKL A;  1XWE A;  2JA6 B;  5CV6 A;  1F2L A;  1Z52 A;  1XTC D;  1ENA A;  2K5W A;  4TRD A;  3MAQ A;  5I2X A;  3IFT A;  4K8I A;  3WOE A;  1SJE D;  2GA4 B;  2PW5 A;  5I9O A;  1BF4 A;  5KRU A;  1WD1 A;  1RHP A;  3VR3 A;  4UAI A;  1H9S A;  2BCO A;  1I6H B;  2NVT B;  3R2T A;  3T16 A;  4TQU S;  1UEA B;  1DM0 B;  1NCV A;  1PLF A;  4KJN A;  3MXP A;  3IFD A;  5BN5 A;  1A3T A;  3BDL A;  3EJI A;  3TBI B;  2CQA A;  2BDO A;  3C0O A;  3DM1 A;  3HOU B;  5DAU A;  4NP5 A;  3DEP A;  2C5C A;  1EY6 A;  4RGN A;  2B2Y A;  4KKT A;  3Q0A A;  2RDG A;  3K58 A;  1LT4 D;  1CFM A;  1JOO A;  2E2H B;  4J8Q A;  2CVR A;  1W6K A;  2R7Z B;  1WTW A;  1GHK A;  1RD9 D;  2E2D C;  5T1G A;  5FK9 C;  4RKL A;  1KNA A;  3L7Z C;  2B2T A;  2EJG C;  3G6J B;  5J22 A;  4CBV A;  2SNM A;  5AFW A;  4NMZ A;  4KY6 A;  1QJO A;  2XRS D;  2NN6 G;  1A15 A;  1EY9 A;  4A3I B;  1ZEQ X;  3I8Z A;  1RF2 D;  2EPB A;  2HCI A;  2I07 B;  1Y8N B;  3FRP B;  2OXP A;  3KLR A;  3HGB A;  3HOZ B;  1VMP A;  1TS2 A;  2F0W A;  4IZ8 A;  3OIP A;  1K83 B;  2R6G A;  2E74 C;  4H0L C;  1Q90 A;  1VF7 A;  4XYO A;  1SNO A;  3BVZ A;  2IL8 A;  5EJW A;  3TZD A;  1WTO A;  1SNQ A;  4XTC S;  1EEF D;  1PTO B;  1NSN S;  3X3M A;  3AB9 A;  3J7A V;  3OOC A;  2K7V A;  5KEE A;  5M3M B;  3J81 L;  1PRT C;  3I4N B;  2BDN A;  4A3J B;  1G91 A;  1OXV A;  4EQN A;  2ENB A;  3NUC A;  4RFB A;  5I9P A;  1HFN A;  2F0E A;  1FNU A;  5TSS A;  1PTO C;  2E76 C;  3NBI A;  1TWH B;  2XNA C;  1EQT A;  1ZKO A;  1ESF A;  4ZAI A;  2D9U A;  3T13 A;  3C1F A;  1PZJ D;  2SEB D;  5EKK A;  1TR5 A;  3SEB A;  4QUC A;  4KN4 C;  3GTG B;  1IKM A;  4BA1 I;  3SK6 A;  1V1P B;  1AP0 A;  3HOV B;  1F9S A;  4MN3 A;  3TN2 A;  1SBB B;  3FDT A;  2K5Q A;  3NQI A;  3VR4 A;  1RDP D;  4J6H A;  1SEB D;  3ND8 A;  4IUN A;  3R8B A;  2L11 A;  1KAB A;  3KUP A;  5C4J B;  1HUM A;  1ROD A;  5ELE A;  1H9K A;  1ICW A;  1I6V C;  1MGS A;  2EVB A;  2RSN A;  2LFN A;  1LTI D;  4ZKB B;  1D2B A;  5CV5 A;  1R9T B;  2K03 A;  3H3V C;  1QCB D;  2J7Z A;  2RQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...