1PTOB

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
b'GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
total genus 42
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoB01
2J4XA 1HA5A 1PRTB 1L0YB 1PZJD 1ET6A 1XTCD 3G4NA 4L6TB 3C0MA 2TSSA 1TS4A 1TS5A 1LTTD 1FGBD 1KLUD 1SJHD 1LTRD 5ELCA 1PYWD 1EEID 4RGMA 4RHRA 5D3IB 1DJRD 1HQRD 3G4OA 1ET9A 1BCPD 1RCVD 1S5FD 1JWMD 4DXFA 2QEJC 1CT1D 3DWAA 1RDPD 3V05A 1CK1A 2ICIA 2CHBD 1STEA 1UNSA 1EFID 1L0XB 1LTAD 1V1PB 5FKAC 5D3DA 1JCKB 1EU3A 3C0OA 1EWCA 2RDHA 1DYQA 4RGOS 1RD9D 4L63B 1D5XC 1S5CD 1HXYD 2QILA 1FNWA 3EFXD 3R2IA 4ZYSA 1LT5D 1BCPC 4DXGA 1S5ED 1PTOD 1JR0D 5ELEA 1B44D 1S5BD 3CHBD 4BWGB 3DWPA 1ENFA 1LLRD 2O2LD 2XN9C 2WV6D 1TY0A 4RGNA 1UUPA 2SEBD 1AN8A 1SE4A 1AW7A 3MC0B 3EA6A 1PRTD 2NTTA 1I4GA 1FNVA 2Z8LA 3URYA 4RCOA 1LT4D 1V1PA 1EEFD 1LTBD 1PZKD 1SBBB 1PTOC 1CHQD 3TSSA 3BVGA 4TSSA 1D5ZC 2AQ1B 1LTSD 1KLGD 3BZDB 1G8ZD 1I4XA 1BCPF 4RFBA 3R8BA 1SE2A 2IJ0A 3MFGA 1TS3A 3BVMA 1I4HA 2AQ3B 2R61A 1TY2A 1LTGD 1I4PA 1MD2D 1PRTC 1TS2A 1BCPB 3GP7A 4K6LA 3BYTB 4UDUC 1PRTF 5FK9C 2XNAC 1PTOH 1CQVA 3O13A 2AQ2B 5TSSA 1GOZA 5I4DA 3W2DA 1F77A 1SXTA 1FD7D 5ELBA 1LT6D 1KTKA 1M4VA 3KLSX 1EU4A 1S5DD 1D5MC 1B1ZA 1LTID 1I4QA 4C56C 1JWSD 1PZID 1SE3A 1V1OA 4OHJA 2RDGA 2IPKD 3R2TA 3C0NA 5ELFA 1PTOF 1JQYD 1JWUD 1SEBD 2XRQD 3DWQA 1LT3D 5ELDA 4RHSA 4RH6A 1SJED 3BVZA 1XXGA 1BXTA 1PTOB 2XRSD 3SEBA 1CHPD 1QILA 2G9HD 1HTLD 1Z52A 1T5XD 3OWEB 1I4RA 4Z9CB 1FNUA 1RF2D 1D6EC 1PREA 2NTSA 4O1NA 1ESFA 3BYYB 1LO5D 4RGTA
chains in the Genus database with same CATH superfamily
5EKIA 2VZAA 3HOUG 1L1OB 1CZGA 1OXSC 3J7ZC 3I7FA 3K0XA 1ET6A 2ALYB 3A55A 3D8GA 1PH1A 1B9MA 3ND8A 1QNKA 5G3LF 3RD4A 2F0MA 4A3CG 3IRBA 3QWNA 1LTRD 2XVSA 2XWJB 3H3VI 3TZUA 2G9DA 4DV4Q 1I3QB 1JWMD 3PUZA 1VQ5A 1KRSA 1SNPA 3CCMA 1IW7C 2EE1A 3V05A 2ICIA 4O0AA 3NTKA 3L7ZC 1ZEQX 5IYCG 4C3HH 1EFID 1PFSA 1BUVT 1S40A 4KTAA 1N34Q 1N33Q 3CCSA 5D3DA 1SFOH 1TWFB 5C4HA 4U673 4ZLTF 5C0XH 1FR3A 3L0OA 3PUVA 1HA6A 1Y14B 4OX9Q 1U4PA 2KA7A 4A76A 3VYTA 4YWMA 4LF6Q 4UAIA 2E8GA 2KQ3A 1JORA 3STBC 2WV6D 1TY0A 3KF8B 1TXYA 1YJWA 3WOFA 1DD2A 2SDFA 4R4IA 3H3VC 3U9SA 1NTGA 2JA5H 1PRTD 1U4RA 1JB7A 3HKSA 2C5CA 1M8AA 3TSSA 4JI3L 3HRZC 2OQKA 1C4QA 1DGSA 2UXDL 5LL6S 1Z9FA 2FJ2A 4IZ8A 2NVYH 3NELA 2WP8J 1OTCA 1SR3A 3A54A 1HUMA 4GNXB 2K32A 5FJ8H 4A3MH 2JYOA 2EYHA 1Y1WG 3CD6A 1KNEA 1NJIC 1ZXTA 4QCLA 4L5QA 1I4QA 2E2HH 3HOYH 1B2TA 4BXXH 1PH8A 2RDGA 3G4SA 1JOKA 2ZM6Q 3K59A 4ZRZA 4J6HA 1D1IA 1PMRA 5IODA 5T1IA 5M5WH 1YHBA 1U5KA 1DONA 4J15A 4A3JH 4N8X1 2EOTA 2E2JB 1GXDC 3NPPA 1I94Q 1G91A 1SMXA 3BYYB 3PMFA 4MN3A 3PF5A 1VQOA 3NK9A 3OTOQ 1LYLA 2ZTEA 3KF6B 4LMQD 1VQ7A 5JPMC 1YITA 1EIFA 1PZJD 5HY6A 4J8QA 3K8AA 1Y1WB 4DUZQ 1R9TB 1ENAA 4KD4A 1JE4A 4RHRA 4FP5D 5FOBB 4N9TA 1X32A 4P74A 5C4JB 4YHHL 3KBGA 1RDPD 3A56A 1FJGL 3T1YQ 2E76C 1WTXA 1JOQA 1VQEA 4A4IA 3MWYW 1FNWA 4CDEC 4A3DG 1EIGA 1GUNA 1X3FA 4DR3Q 2F0UA 5KYIA 2R7FA 2L11A 3R93A 2Y0SG 1SMYD 3J81c 3GTJB 1HR0W 4P72A 3R3OA 4YCVA 4X64Q 2K4KA 2KEDA 4IURA 5M3FH 1C7YA 2O5IC 3M7NA 5FLXE 3SVMA 5LMUQ 3L9AX 1CQFA 2E2IH 4DKAC 5KRUA 3M3YB 4EQPA 3H91A 1Z7TA 3I70A 1VQNA 4A3DB 1VQ4A 5JJLA 2A8VA 3ND9A 1XX8A 4IUQA 1DCZA 1I3QH 1GHJA 1PTOH 1TWHH 3A5ZB 4IN3A 5IOCA 4A3EG 4X62L 3W2DA 5EPKA 3M4OH 3VA7A 4A3FH 4UY8C 5KNDA 3J80E 2Y0SB 4Y52H 1SSOA 1V1OA 4OHJA 4XQQA 5C0XI 1T9HA 1IKMA 1RTNA 5JEAG 4LFAL 1TWFH 3EROA 1LT3D 1MKHA 4DFAA 3ULJA 1P8LA 1OO9B 1WTVA 4B3RL 2LY7A 2DNEA 2EQSA 3HOWG 1CHPD 1KD1C 3DHQA 3OOCA 2PNRC 3HOUH 2WINB 3V2TA 3TZDA 4MIUA 1LO5D 4A3CH 1AE2A 3HGBA 3RN2A 3GV6A 4ZKBB 3C1FA 2UXDQ 3TP7A 3K80C 4WFN3 4KHVA 4A3EB 4ME3A 1QJOA 1PFBA 4RWSC 2Q8IB 4CKCA 2KUMA 5KGUA 4LF9Q 3EQLC 2IHEA 5JJIA 5IYCH 5KNBA 5ISRA 3BG3A 3I4OA 1W6KA 3HKZG 1CT1D 4DV0L 4P75A 2YTYA 2R93G 3J81L 1ZYRD 4CKBA 5M5XB 1PH9A 2JA8B 3GV3A 3T4AC 3TMEA 3RZOB 1GM5A 3MTSA 2HT1A 3VYSA 2VUMH 3HOWB 1STHA 4NXNL 4RKLA 1PXUA 4KMUC 4NXML 1DYQA 1WCMG 4RGOS 2B29A 4ZUIA 1HZBA 3EFXD 2GA4B 2R92H 5FO7B 3IFTA 3SR1A 3PIPA 5DLQE 3OW2A 2Z6BA 4R9WA 1JR0D 5DM73 3E5SA 1Q1BA 5JJZA 3ONAB 3JAML 2TMPA 2L12A 1IBLQ 3L2PA 1XNRL 3GTMB 4HTHA 1RL2A 1Q1EA 4WJ4A 1YNND 3K81C 4QMGA 5C44G 1HJPA 5HGTA 2B8FA 2M2LA 2N55A 3HKZB 4EGVA 2NYZD 1HUNA 4NPSA 3P1HA 1KC8C 1TWGB 1BR9A 5DEHA 3D3RA 5EKKA 3K7AB 4FYDA 4YHHQ 4RFBA 1JJCB 1Y1WH 3VDYA 1R9TH 2O5JC 1CKNB 1WCMB 3SK4A 1A3UA 2Q2UA 2K6AA 2XTIA 3FKIG 4CKEA 3Q22A 3CCUA 4UPAA 4DV7L 1Z47A 1DM0B 5C4JH 5E7NA 2PCFB 1YHQA 2HQLA 3MXNA 4G7OC 1ZKOA 1JWSD 2IPKD 2RA4A 1HR0L 3EIVA 4HCEA 4IPGA 1EY7A 4KJNA 5CBAE 3A5UA 1PV4A 1BXTA 4HIOA 2RSNA 1I4RA 3D4DA 4GNXA 1F2MA 4B3ML 1D6EC 4KKSA 1ESFA 3BZKA 1V9PA 2UUBL 5FO8B 4OO1G 2J4XA 2O4XA 1L0YB 1X56A 3FKIB 2L5TA 2LXKA 2QW7A 1FGBD 1NSNS 1XTDA 1E2ZA 3M3YH 2UXCL 1SN8A 2YV5A 2E5LL 4V190 1BCPD 2D0PA 2EJGC 4IUPA 4X62Q 3AYHB 2RHSB 1KDAA 1L0XB 2F0DA 1K83B 1SNOA 2RDHA 3KF6A 3D4RA 5AFWA 4X66L 4L63B 3HOXG 3CMAA 3OWFA 2KVMA 3QJYA 3DWPA 3T1HL 3ERSX 2F1MA 1VCIA 3J7AV 3PUXA 2F0SA 3MC0B 4YCUA 1CTMA 1X3QA 4X3SA 2J0TD 3CC2A 4KKUA 4TVAB 4DV6L 3PIOA 4HIKA 1PTOC 3PO2B 2JP1A 4L5SA 1UE1A 2EY6A 4H02A 3T16A 1E22A 1BVSA 1YZ6A 5M5YB 4Y7NB 2CKZB 3NTIA 5A2QL 2I07B 3HKZE 4A3EH 4MHEA 1GO3E 2OWOA 3GTGB 1WTHA 2B3GA 3SK5A 3HOXB 3S1NB 1PRTF 2YYZA 4NXNQ 1E3PA 4HR7B 5JEAH 5H1SE 1IKLA 2EVBA 2PMZB 4JI0Q 3ULLA 4OWWB 1MHWC 2KCMA 1A3VA 5M5XH 3KJOA 1LTID 3RZOH 4HEDA 2K05A 1QUQB 3HOWH 4A93G 1RJTA 3J81j 4LF4Q 1TQOA 2K75A 5ELDA 1B9NA 5K5PA 2VXWA 2UU9Q 1WTQA 3S1RB 4C2MB 5BN5A 5KIXA 1QOHA 1XNRQ 5IY0A 4JBWA 3JAMi 2YU9B 3VA5A 3A7AB 3NP8A 1PREA 2IHFA 2NTSA 4A3LG 5EGTA 4DUYL 3S2DB 4KK7A 2MO0A 1BKBA 3AB9A 1TU2B 1RKNA 1BBUA 4Q5VA 4HN7A 1LTTD 1J9OA 4CJ0B 2R93H 1GUTA 2OT2A 4R8IA 1P16A 1K8GA 1NR2A 3CCLA 4JI8Q 3K7AH 3KOJA 4L5RC 2R7ZG 1V1QA 2QEJC 1HFNA 3RR5A 3S2HB 1WCMH 4KKTA 4G7ZC 2EYPA 2HHHQ 1EZ6A 1STYA 1CSPA 1X3PA 1V1PB 2AWNA 1HR0Q 2A68D 1JCKB 1KAWA 2NBFA 3MHBA 3HOVG 4HMIA 4I7AA 1SDFA 1VDZA 3MA2B 5CORA 1S5ED 1TWCB 2R7DA 1YJ9A 3VR6A 3FDTA 5C44H 2QGQA 1VQCA 1AFPA 3S14B 1NE3A 3UE1A 1VF5C 2KOLA 5EQ0A 3J7AF 1CKMA 2UUBQ 4ZUJA 4RMFA 1MJEA 1WTWA 3NBIA 4GLAC 4QB4A 3WDNA 4NMZA 2A6EC 3TBIB 2R7ZB 3AEVA 3UDXA 2ATWA 4DR1Q 2UXCQ 3RMHA 1A2UA 3Q8DA 3FKIH 4O42A 2OEOA 3VR2A 3X3NA 4K14A 3HOVB 4DF7A 1A3TA 3J81E 1M1KC 3ULPA 2K5DA 2LMCB 3TDQA 4BBSG 1H9KA 4X6AH 3RZDB 1B7YB 1S5DD 4PMCA 2D2CC 4C56C 1N36L 4DU9A 1I6HH 1SRUA 2CWAA 4LJZC 1K83H 5ELFA 2SNSA 2PMZE 4NB3A 2RQXA 4BS9A 2F0HA 2A69C 4DV3L 4OO1H 1CKNA 4L5TA 1Y69U 2RF4A 2R6GA 1R4QB 3GTKB 3OPOA 1FNUA 4DK1A 5GAHC 3MEHA 4DV6Q 4X65L 3S15B 2NZ1D 1LABA 1HHVA 3KUPA 4H44C 2VQEL 1G291 2DNCA 2A5HA 2VY3A 3HS0C 4S3SA 3Q24A 1XTCD 2JEAI 2PPBC 3TRZA 1B70B 2TSSA 1F9PA 3NTHA 4LW1A 1W6JA 1N8RC 2ZXPA 4RGMA 3T53B 3CPWA 2K52A 1HQRD 4GS3A 1TVXA 4DXFA 1X55A 2K04A 5IP7H 3QOJA 3GTGH 1A63A 2OQ0A 4OL7A 4DR5L 2B2UC 2LFNA 3HOXH 2IWHA 4KHPL 2F0LA 1O7IA 3S1NH 3KLSA 1XPUA 2KEEA 2Q2TA 1Q82C 3E9HA 3I4MG 1JB3A 1JJ2A 3CU7A 2IY5B 2EY5A 3DM3A 3GDEA 5JVG3 1C48A 4DPGA 5K36G 2ENBA 1ONLA 4H13C 3TP6A 1ENCA 4UHVA 4NP5A 2Z0SA 2F0WA 4GLXA 4DUYQ 3S1RH 4C2MH 2UXBQ 1TWAB 3CCQA 4AIMA 1W2BA 2XWBB 3ZJYC 3DEPA 3E3XA 1HZ9A 3OW7A 1EYGA 4RCOA 3NE5B 1SBBB 3FEWX 3I4LA 2JK8A 4X3KA 3S2DH 2F4VL 4M8AA 3P75A 3H0GH 4IALA 1U4MA 5J22A 1STAA 4HJAA 2EXDA 5EBDA 1I4HA 4XTCS 1IBMQ 3J7YW 3I4MB 1X6OA 2N8NA 1PRTC 4UDUC 3K5LA 2F0FA 3D4WA 1EZ8A 2JQOA 3GTQB 4A93H 1EQTA 2DGYA 3HP3A 2B63G 1YBYA 1BOSA 1LT6D 4K0KL 2ZJPA 3T13A 4FF4A 4BY7B 4ID6A 3MXNB 4GN4B 1B1ZA 2CVRA 3D0FA 3DLLA 2F3VA 3A74A 5GADC 2JEBI 1I50H 1D1KA 1SLJA 2LS01 1STBA 4WJ3M 4A3LH 2F4IA 3UDFA 1MJCA 4KV6A 1TWCH 1VQLA 2RCFA 4Z9CB 2EZVA 4F88A 2I5LX 5CV5A 3BU2A 4AYBG 4LFBL 3LWEA 1MGSA 4DR7L 5A2QE 4HJ5A 2R7ZH 1QUQA 3VYUA 2B63B 1VQIA 1KRTA 1KLUD 3BDOA 2F3IA 1E24A 1EEID 2B2VA 4IUTA 1N32Q 3M85A 3PUWA 1D7QA 2IT1A 2MNAA 4DV1L 2Z6KC 5LMNL 3NXWA 1II3A 3HOVH 1ASZA 4JOIC 1GHKA 1EU3A 1EWCA 2XSCA 4C3JG 4LF8Q 1CKOA 1Y1VG 4DGZA 1AH9A 1LT5D 1SYGA 2WKCA 3S17B 4AYBB 3I8ZA 4DV3Q 1W3SA 5ELEA 3NHHA 3M4PA 2XN9C 4OO1I 4DAVA 2UUAQ 2OXPA 4JBKA 4X65Q 3BJUA 3QOLA 1K3BC 1AW7A 1ASYA 4LFCL 2VQEQ 2KCCA 4TRDA 4UP8A 3GTKH 3TQYA 1Y8NB 4CDDC 1V1PA 2PZWA 3UDIA 2KBNA 2I0QA 1I5FA 1QVCA 2A73B 4KN4C 4BBSH 1LTSD 4FF1A 3KJPA 2X6GA 1SMYC 3PCOB 4C3JB 2C9OA 4B3SL 1IBKL 4DR5Q 1Y1VB 3M4YA 1AZPA 2X6LA 3GP7A 4K6LA 4N9PA 4HIDA 4DR6Q 2PI2E 3U4ZA 5CR3A 1KAAA 2BA0A 3LGJA 3BDLA 2E2DC 1QCBD 3C46A 5IGGA 3RLNA 2LKVA 4LK1C 5IGDA 5DM63 1PTOF 4PZ7A 1JWUD 1A0IA 3DWQA 1VQMA 3D6CA 3S9WA 1VQ9A 1CZWA 1XXGA 3U50C 3JAMc 2XRSD 1PVOA 2AUJD 1T5XD 1SNCA 2QKIC 4EX5A 5I6WA 1O7ZA 3EJIA 3SE0A 1UE5A 3I3CA 1CA6A 1YJNA 1YNXA 2F4VQ 5DAUA 1TWAH 1E0BA 1HZAA 5I6YA 2A6HD 2N3SA 4IJHA 1KDBA 2OF1A 1ILPA 3GQBA 2KECA 2KHIA 4KLKA 5GROA 4IO9A 5GQOA 4LF5L 2JA8G 4GKKL 1RCVD 5IE8A 1FVIA 2MFIA 3LWUA 2KENA 4ZKCB 1AE3A 4OWTB 3H15A 4JYAL 2Q2HA 3I4MH 1BQQT 1NMGA 1WTOA 1UNSA 2PQAB 1H9JA 2ID0A 1F2ZA 3I2ZA 3RUZA 3N6RA 5FKAC 4JI3Q 5K36H 3K7UC 2CWPA 3I90A 4R1JA 1PDQA 2B2TC 4A3KB 1WVLA 2K5VA 3CF5A 1VMCA 2B2YC 1B44D 4LNQA 4KHZA 4HMJA 1Q81C 1UEBA 2PYKA 1UUPA 2F0PA 4JK1C 2SEBD 1AN8A 1STGA 4AYBE 1MBYA 2Z4IA 3QO2A 4DK6C 1PFNA 2NTTA 1K3RA 1EY6A 4E6IA 4DR7Q 3URYA 4JI5L 3SDZA 4IUUA 2K1BA 3S1QB 4KD3A 4LWCA 2AQ1B 3CCRA 4PMBA 5G3LD 2WAQB 5E4WC 3OYYA 1I4XA 4DV1Q 2IJ0A 3FVQA 2KCNA 1GVPA 1HH2P 1A15A 1XYIA 3CC7A 1S4ZA 2K7VA 1YNNC 1GUOA 1TS2A 2HIVA 4I65A 1YHAA 1J6QA 2NN6G 5FK9C 2AUKA 4RA8A 1OXUA 4C3IG 1NNXA 1GOZA 2EYLA 1B8AA 1MIUA 4R4TA 4ULLA 2B2WA 1G2SA 2E2JH 2XIWA 1VQDA 1K9MC 4JI1L 3G48A 1TIID 4RHSA 5JOBA 3I4NG 1EY0A 2PI2A 2Q8RE 3W1GA 3C3LA 3E0EA 2D9UA 2K03A 2F0VA 4LFCQ 3OWEB 1SNMA 1FJGQ 2B8GA 4PQXA 3K0YA 1KNAA 5T1GA 3GTPB 1B4OA 1WD0A 1IL8A 1E1TA 4RGTA 1EYDA 1HA5A 3FHWA 3AU7A 3UE0A 3A7LA 4XQNA 4A3IB 3EVQA 4XIGS 3G4NA 1CM9A 4C3IB 1EWIA 5IGCA 4X3UA 4B3SQ 1IBKQ 5A35A 1SJHD 3CRLC 3TS0A 3NWSA 1DJRD 2PNHA 1QZHA 5CMDA 1ET9A 3CAMA 3DWAA 1KL9A 1Y8OB 2HD3A 4DV5L 3I4NB 4WJWA 2CHBD 1VQ6A 1QE6A 1Y1VH 3OIPA 5M3MB 1G6PA 2N49A 1VQKA 3OHXC 3GTJH 4OEMB 3VR4A 2QILA 1JT8A 5I9PA 2M00A 1BCPC 3J7A5 4HJ8A 1HNZL 2ZXOA 1JC7A 5C3WA 2MP1A 4HSVA 1HNWL 4DR2L 2K50A 1S3OA 5I9OA 5ELOA 3PO2G 1WTPA 5NUCA 2RHQB 3ICEA 3JC66 4A3DH 2CH4W 2LSSA 1PFMA 2AMCB 4JI7L 4OONA 1LUZA 2EJFC 3V96A 1HFGA 4JPBW 4LFAQ 3PQIA 1SYEA 2JA6G 4PMWA 1IYVA 5DNFA 4K5VA 3HZXA 3IKJA 4JBJA 1PH4A 4ZCKA 4IUNA 4B3RQ 1U4LA 4GOPC 3PF4A 3BZDB 2AHOB 4IPHA 4IFDJ 4R4OA 1K0SA 1IL2A 1LTGD 3A0JA 1L1OC 4A3BB 1A8VA 2K14A 4H7BA 2WAQE 3GTOB 5IYBG 4IQZA 2K01A 2BOSA 3FMCA 1Q86C 3KLSX 4YY3L 4R4QA 5JVH3 3UI2A 2JJQA 4CGYB 2HDLA 2H5XA 2NVQB 1PH6A 4DV0Q 2JA6B 3EBEA 1PLFA 2G9HD 4G4KA 1EQQA 1YVCA 3SGIA 4JI5Q 4IOAA 1Q8IA 4P73A 1Q46A 1I6VC 4NXMQ 3F2DA 2OTJA 2AKWB 3MXGA 3CCJA 2F03A 4FF3A 2PZUA 2YTVA 2V1CC 2SOBA 2JA8H 1EQVA 4FXDA 5CV9A 4RG1A 2CFMA 1TS4A 3CP0A 1TS5A 2JA7B 1OXTA 5ELCA 3S1QH 5IWAL 2IW3A 4KI0A 4F7XA 5IGEA 5EPJA 1Q12A 2CW0C 1YIJA 4QUFA 5IT9c 2HCIA 4HAEA 5J3BA 5CBEE 4FXGC 3ZYYX 3GTMH 1A62A 5I2XA 4CDFC 4JI4L 1SE8A 5D65A 1S5CD 4RCNA 4GNXC 1HTPA 2Z9HA 1B3QA 2A74C 2ICEC 5C5LA 1X54A 3MEFA 1PYBA 1TWGH 3MXUA 4NDXA 4RGNA 4C3HB 1YI2A 1C0AA 5BN4A 4DV7Q 2Z4HA 1SE4A 3L3OC 3KFUA 1O7LA 2A68C 3HFZB 3TP8A 1LTLA 1V8QA 1PH7A 3GTPH 2PQAA 2RKSA 1LV9A 1SYCA 1HNXL 4K5XA 4LF7L 4PZ6A 2N78A 3S24A 1N33L 4PV1C 4TSSA 1X3EA 3E0JA 2B2UA 3NQIA 3I72A 1K8OA 2NN6H 3PO3G 4OX9L 4IPDA 1DOMA 4C3IH 4G7HC 4K2KA 4B3MQ 4DV5Q 1TY2A 1PYSB 2F0OA 2FINB 4UP7A 1N9WA 4ZK9B 1EOTA 4NW2A 2Q2IA 3NENA 3CPFA 2NWGA 5I4DA 5CGKA 3H09A 1AZQA 2RSOA 1VQBA 1RIPA 1PZID 1H9SB 5FLXL 2Q8TA 1Q7YC 1HNZQ 2NVYB 4P71A 1JOOA 3CQZB 2E5LQ 2HIXA 1HNWQ 1EY9A 1BBWA 1U9RA 4CHTB 2MUYA 1QILA 2H4OA 3GO5A 4TKOB 3WWVA 3HOZG 3I73A 4JI7Q 3KLWA 3PO3B 2E2HB 5IT9L 5E3FA 1C8CA 2MQHA 3U9OA 2A19A 2EY2A 4X66Q 1K73C 1BF4A 5IYDG 2MJ8A 3TEHB 5M5WB 3N52A 1A6XA 4FO2A 5LMNW 1PHJA 1AEXA 4AQYL 4A3JB 1EYCA 3JAME 3T1HQ 3IL8A 3W1BA 4Q0FA 1NCVA 1S5FD 1A2TA 2L4NA 3PIO3 4K2LA 2CCZA 2RDFA 4PG3A 4A3GG 2K5HA 1VQFA 1B53A 2A1AA 1LTAD 3VR5A 1I94L 3U58A 2WB1B 3Q0AA 1B50A 2R3ZA 1EOVA 3PV0A 4JC0A 3HOZB 1SROA 3NEMA 4YIJA 1VS0A 2IX3A 4GN3B 3OTOL 2FHTA 3SK8A 5M3FG 3K5OA 2F0GA 1UE6A 1C9OA 1CSQA 1XPRA 1PA6A 4DUZL 3PO2H 3D31A 1GUGA 2BA1A 2DJFC 5M5YH 4Y7NH 1X3GA 3TS2A 2EYOA 2DN8A 2I5HA 2A69D 4FVMA 2JA6H 5C6AA 2NUCA 2PZTA 2Z8LA 4A75A 1Q8KA 1WOCA 3T1YL 1EEFD 1FYCA 2Z6KA 1J8IA 2OTLA 4A3GB 1RODA 5IWAQ 1Q3LA 1BO0A 3K5NA 1D5ZC 2V4DA 5KYLA 4A3FG 4XT3B 1G8ZD 2JE6I 1EQRA 1SE2A 3BVMA 5IYBH 3M4QA 2GVBA 5M3FB 4BY7G 2K33A 2BE5D 2IX1A 1H9RA 1ESRA 1K0RA 2AQ2B 1UAPA 3H94A 1F77A 2YU9H 2E2IB 4JI4Q 1YNJD 4MZ9A 4X64L 3BS1A 1AP0A 2SNMA 2HDMA 4DR4L 3OSOA 3SHLA 4C1NK 3R2TA 3A8IE 5CC4A 4RKBA 5LMUL 2RVLA 2ZT9C 1E7ZA 1PTOB 1TWHB 2DY7A 3SEBA 2FMMA 2IX0A 2H1EA 4BBRG 3M4OB 4DN4M 4A3FB 3AQQA 5C4XG 3CRKC 1HNXQ 4LF7Q 3A8JE 2C35B 1VQAA 3T56B 1EIYB 1IW7D 3S2HH 1HRJA 2ZTCA 4JI2L 2JSOA 3TN2A 3G6EA 2VUMG 2GN5A 5D14A 4UP9A 2WACA 2NN6I 3HOUB 1TR5A 4QF4A 2E75C 1IXRA 3UDGA 1STNA 4XT1B 5FLMG 5KNCA 1QNUA 2R92G 3ER0A 2NB0A 3M7GA 5HGQA 2N88A 3CMEA 3RN5A 3STBD 2EPBA 3S14H 2EJMA 2AWOA 4IJLA 4QJFA 4XYQA 4BBRB 3OMGA 1G6ZA 1SNDA 5C5MA 1J5EL 5C4XB 5IIFA 3P20A 4JV5L 4EQOA 1FL0A 5EKLA 3TP5A 3CHBD 1SAPA 2WB1E 4B3TL 4LF9L 2VB2X 3SK6A 3CCVA 1ENFA 3CQZH 2VUMB 3K57A 1BNZA 1E2WA 5C0XJ 2MHVA 3VR3A 3DXJC 4CJ2C 2BH2A 1GJXA 4B08A 1K8MA 4FF2A 2R92B 1N36Q 4FNFA 4O2DA 3PO3H 2L15A 4DK0A 3KBXA 4AQYQ 2D0OA 3BVGA 5E4XA 5JPNC 4PNYA 2VQFL 3J80i 3RZDH 4IFDG 2MGSA 5EBCA 1KLGD 3T51B 1BCPF 5EAYA 2EIFA 3F2UA 2PO4A 3X3MA 5C3XA 5EJWA 1CI3M 1H95A 2B2TA 1VMPA 4HCSA 1RHPA 1IBLL 4K8IA 2B2YA 1PH3A 1FD7D 1H9MA 1Y8PB 3GD7A 5JJKA 3RLOA 4ALPA 1VQGA 4BA1I 4NKLA 4YCWA 4CBVA 4CDCC 3S15H 3C0NA 3NQTA 1X9NA 4K6DA 2NVXB 1F9QA 3HOZH 4ILWA 4KY6A 1XJVA 2F0EA 4B9WA 1HTLD 3F1ZA 5IYDH 4ME5A 1JMCA 4KHPQ 2NVTB 5JAVA 4F8MA 5IGFA 1L2FA 4HSPA 1IYUA 4JW0A 5IGBA 1XWEA 2L9HA 2G5DA 5IP9G 5L37A 1H9SA 5HURA 1VQPA 2HQEA 4GN5A 1BDOA 4M1UB 4A3GH 1EUJA 2BH8A 5D3IB 2QEXA 4AH6A 3CW2C 5GAGC 4IPCA 1STEA 1SYFA 3VYRA 4DNTB 2CQAA 4DR4Q 1CUKA 1E2VA 1EIHA 2A6HC 4A3KG 1EL0A 1WI5A 1D2BA 2Z1CA 3R2IA 4ZYSA 2EYFA 3ERQA 3NSWA 1KXLA 5EPLA 1VQJA 1ML0D 3G71A 1LLRD 5COYA 2ASBA 3NBHB 2DJGC 1F2YA 5AJ3L 5IT9E 4K0KQ 5BR8L 3EA6A 1VQHA 2YTXA 4F87A 2PW5A 3BDCA 1JICA 2B2VC 4JI2Q 4GLVB 2WAQG 1KHIA 1OXVA 1LTBD 2PW7A 1PZKD 3GTQH 4BY1G 1HZCA 2KHJA 4ODGA 1EYAA 4BY7H 2F0QA 4DAYA 3P7JA 1O80A 2FFKB 2HUGA 1ZYRC 1V43A 3OIQA 4K5WA 1CA5A 1EFWA 2EY1A 3BYTB 4DNIA 2VW9A 2XNAC 2I46A 4G57A 5TSSA 3OMCA 4LFBQ 2B39A 4I7ZC 1KTKA 1J5EQ 1E1OA 1K8AC 4DAMA 5CV8A 1D5MC 2WIIB 4JV5Q 3QG1A 3F8TA 4L8JA 4BBRH 4J1MA 4IOCA 1EY8A 1LM0A 4B3TQ 2HCCA 1U0LA 4RH6A 3MFYA 4JCVE 3I56A 1QVFA 4DV2L 4H0LC 5C4XH 2NZOA 5BN3A 1PH2A 1KQSA 4MTNA 4LUVA 2MPMA 5LMNQ 2B63H 4BY1B 4R4CA 1Z52A 4A3IG 2F0IA 4GOPA 1IHZA 3KDFA 4OIKA 5J39A 1XMOL 2VQFQ 1O78A 1PRTB 4K8JA 1L1OA 3I55A 4JI0L 4YWLA 5FLMH 4KY7A 3K58A 3C0MA 5ELNA 3EN2A 3AFPA 3C1EA 3DMUA 1PYWD 4LF4L 2XGTA 1NAPA 5M3MG 3G4OA 3HEJA 2UU9L 3S17H 5C3EG 3KLRA 1ICWA 2QDBA 4KN7C 1WYDA 4LAAA 5J1ZA 4C1NI 1QB5D 1MSHA 2UUCL 2JXMB 4HJ9A 1WTRA 3U4VA 3C0OA 2R93B 3NWTA 2DUDA 3HG9A 1MI2A 1F9RA 1HXYD 4EQNA 4YWKA 2NVXH 4GKJL 4QY7A 1ILQA 3CKIB 1SNQA 2F0KA 3PSIA 3KF8A 1HQMC 4LUZA 2VNUD 4TQUS 4JI8L 3GTLB 4C3JH 3MZ5A 2FXQA 3FPUB 2CH4A 4IFDH 5FO9B 2NVTH 1Q90A 1X65A 5C3EB 2HHHL 2PQEA 3S16B 3MXPA 4QL5A 3WOEA 1TKWB 2MO1A 3DM1A 5C44B 1ICFB 3MAQA 4KY5A 4A3BG 3FPPA 3R8BA 2Y0SE 5CV4A 5CV6A 3S1MB 4JI6L 3MFGA 2EYMA 2R61A 3RNUA 1I4PA 1MD2D 4X3TA 2EYJA 4ZQ3A 2IL8A 1VQ8A 1CQVA 1HPCA 2ZXRA 2L55A 2F0JA 1SXTA 4P2CB 4PZ8A 2KJXA 3K5MA 4CJ1B 4ZAIA 2D5DA 1JJGA 1SE3A 5F2DA 2EXZA 1QWYA 3E9IA 2KCTA 1JQYD 1CFMA 3C2PA 4LF5Q 4GKKQ 4DR1L 4OWXB 3BVZA 5AJ3Q 1XNQL 2E74C 3PGZA 5BR8Q 4JYAQ 1IYJB 1F9SA 5CYUA 5GAEC 3M9BA 4O1NA 5IP9H 1I6HB 4BWGB 2JA7G 1PH5A 3F2CA 5IP7G 4N8FA 1SYDA 4DK3C 4POGA 1Z6HA 1EY4A 5I2YA 2QA4A 4JG2A 1XMQL 3W5OA 3QB3A 2K5QA 1NY4A 1KABA 3G6JB 1YEZA 2B2WC 1LACA 1D8LA 4BA2I 4LUOA 5C4ZA 4A3KH 3PUYA 4APVA 4U68A 1B3AA 2GVAA 2L1BA 5E1FA 3MVVA 3PIP3 1UWVA 1DOLA 1RD9D 1EWHA 5FLXc 2OCEA 2F0NA 2K5WA 4DV2Q 4C3HG 3QIAA 1QG7A 2ES2A 4HIMA 2RCNA 1PTOD 1UEAB 1S5BD 1DXMA 5C0XG 3H0GG 4FXKC 1XMOQ 3J81i 4BY1H 3DUZA 3AFQA 2VB3X 2I5MX 1FNVA 1I4GA 4JI1Q 3BZCA 1LT4D 4DNRB 2F0TA 1VF7A 3J80c 5KEEA 1IZ6A 4POFA 2JA5G 2QF7A 4DAPA 4QIWB 3H3VH 1SYBA 2K28A 2M9VA 2UUCQ 1UE7A 4XXEA 4DV4L 3NBHA 1KDCA 4EVOA 1L0WA 1SFOB 3O13A 4XDXA 5ELBA 2UXBL 2CW0D 2FMCA 3Q23A 1M4VA 1EU4A 3ITPA 3H0GB 5FJ8G 3CXCA 4A3MG 1WFQA 3F2BA 1QZGA 4JBMA 4HJ7A 1NR4A 1N34L 1XPOA 2JN4A 1R4PB 2DY8A 1SEBD 4GKJQ 2XRQD 2ZTDA 2WKDA 4B9XA 4A3IH 5JEAJ 3KK7A 3HOYG 2ZJQA 4A93B 2QDLA 4BXXG 4LF6L 1FGUA 2JA5B 3A8KE 1IBML 1RF2D 1M90C 4OELB 3E6ZX 1GUSA 4IFDI 3K6OA 1I50B 4QGUA 3GTLH 4A3JG 2QCPX 3I4NH 3QR8A 5M3MH 3DEOA 4L6TB 1EY5A 5C3EH 4JI6Q 1NBWA 1T5EA 3S16H 4GZYC 2BCOA 3NUCA 4A3MB 4V0BA 4DR2Q 3IFDA 4JVZA 2WB1G 3S1MH 5LL6X 1DOKA 1CK1A 1WJJA 3HOYB 1DZ1A 4QUCA 2BDOA 1QVGA 3IAYA 2NZHA 1NUCA 1GUWA 3FP9A 2BDNA 1WD1A 1D5XC 2VS1A 2A6ED 3J80L 5M9OA 4KJOA 4DXGA 1XNQQ 1G51A 3LNNA 3TREA 4MTKA 1NMFA 1KIXA 4WRDA 2ZM6L 4OIJA 1OXXK 2O2LD 4OXPA 2LXJA 3CC4A 2J7ZA 3KYHC 1N32L 2RBMA 1MSGA 3AMUA 3G7LA 1GD7A 4YY3Q 4A3BH 1HCZA 1GKHA 4R8NA 2VL6A 1XMQQ 3RLFA 4WORA 1CHQD 2JA9A 4RAUC 3GTOH 1BBXC 5LHY1 2EDGA 4MNOA 4DAYB 4LF8L 4QQBX 3CCEA 1K28A 5CV7A 1O7YA 1TS3A 3B6YA 4OGQC 2AQ3B 2NVQH 3LX0A 2D62A 1BCPB 2P5ZX 2UUAL 4XQJA 2X69A 4EQ5A 4QIWE 3Q6SA 3SXHA 1S72A 2K5NA 4BBSB 4XYOA 2KHSA 2L0CA 2F52A 3D6WA 2F3WA 1F2LA 3W3AA 4JOIA 4FDBA 1SJED 2BE5C 4DA2A 1TT2A 2ZJRA 4DR3L 3FRPB 2JA7H 1RTOA 3H6MA 1YNJC 1G2TA 4GOPB 4IUVA 1JE5A 2WFWA 2CQOA 3KDFB 4ABNA 3I91A 4DR6L
chains in the Genus database with same CATH topology
5EKIA 1CZGA 1OXSC 1ET6A 3A55A 3D8GA 1B9MA 3ND8A 1QNKA 5G3LF 3RD4A 2F0MA 3QWNA 1LTRD 2XVSA 2XWJB 3TZUA 2G9DA 1I3QB 1JWMD 3PUZA 1SNPA 1IW7C 2EE1A 3V05A 2ICIA 3NTKA 3L7ZC 1ZEQX 1EFID 1BUVT 4KTAA 5D3DA 1TWFB 5C4HA 4U673 4ZLTF 5C0XH 1FR3A 3PUVA 1HA6A 1U4PA 2KA7A 3VYTA 4UAIA 2KQ3A 1JORA 2WV6D 1TY0A 1DD2A 3WOFA 2SDFA 3H3VC 3U9SA 1PRTD 1U4RA 2C5CA 1M8AA 3TSSA 3HRZC 1C4QA 5LL6S 2FJ2A 4IZ8A 2WP8J 3A54A 1HUMA 2K32A 2JYOA 2EYHA 1KNEA 1ZXTA 4QCLA 1I4QA 1B2TA 2RDGA 1JOKA 3K59A 4ZRZA 4J6HA 1D1IA 1PMRA 5IODA 5T1IA 1DONA 2EOTA 2E2JB 1GXDC 3NPPA 1G91A 3BYYB 3PMFA 4MN3A 3NK9A 4LMQD 5JPMC 1PZJD 4J8QA 1Y1WB 1R9TB 1ENAA 4KD4A 1JE4A 4RHRA 4FP5D 5FOBB 4N9TA 1X32A 5C4JB 3KBGA 1RDPD 3A56A 2E76C 1WTXA 1JOQA 3MWYW 1FNWA 1EIGA 1GUNA 2F0UA 5KYIA 2L11A 3R93A 1SMYD 3GTJB 3R3OA 2KEDA 4IURA 2O5IC 3M7NA 5FLXE 3SVMA 3L9AX 1CQFA 5KRUA 3M3YB 4EQPA 3H91A 1Z7TA 3I70A 4A3DB 3ND9A 1XX8A 4IUQA 1DCZA 1PTOH 1GHJA 4IN3A 5IOCA 3W2DA 5EPKA 3VA7A 5KNDA 3J80E 2Y0SB 1SSOA 1V1OA 4OHJA 4XQQA 5C0XI 1IKMA 1RTNA 5JEAG 3EROA 1LT3D 4DFAA 1OO9B 1WTVA 2LY7A 2DNEA 1CHPD 3DHQA 3OOCA 2PNRC 2WINB 3V2TA 3TZDA 4MIUA 1LO5D 3HGBA 3GV6A 4ZKBB 3C1FA 3TP7A 4WFN3 4KHVA 4A3EB 2Q8IB 1QJOA 1PFBA 4RWSC 4CKCA 5KGUA 2KUMA 3EQLC 5KNBA 5ISRA 3BG3A 1W6KA 1CT1D 3J81L 1ZYRD 4CKBA 5M5XB 2JA8B 3GV3A 3T4AC 3TMEA 3RZOB 3MTSA 3VYSA 3HOWB 1STHA 4RKLA 1PXUA 4KMUC 1DYQA 4RGOS 4ZUIA 3EFXD 2GA4B 5FO7B 3IFTA 3SR1A 4R9WA 1JR0D 5DM73 3E5SA 1Q1BA 5JJZA 3ONAB 3JAML 2TMPA 2L12A 3GTMB 4HTHA 1Q1EA 1YNND 4QMGA 5HGTA 2B8FA 2M2LA 2N55A 3HKZB 4EGVA 2NYZD 1HUNA 3P1HA 1TWGB 1BR9A 5DEHA 3D3RA 5EKKA 3K7AB 4FYDA 4RFBA 2O5JC 1WCMB 3SK4A 1A3UA 2K6AA 4CKEA 3Q22A 1Z47A 1DM0B 2PCFB 4G7OC 3MXNA 1ZKOA 1JWSD 2IPKD 2RA4A 4HCEA 1EY7A 4KJNA 5CBAE 1BXTA 2RSNA 1I4RA 3D4DA 1F2MA 1D6EC 4KKSA 1ESFA 5FO8B 4OO1G 2J4XA 2O4XA 1L0YB 3FKIB 2L5TA 1FGBD 1NSNS 1E2ZA 4V190 1BCPD 2EJGC 4IUPA 1KDAA 1L0XB 2F0DA 1K83B 1SNOA 2RDHA 3D4RA 5AFWA 4L63B 3OWFA 2KVMA 3QJYA 3DWPA 2F1MA 1VCIA 3J7AV 3PUXA 2F0SA 3MC0B 1CTMA 1X3QA 4X3SA 2J0TD 4KKUA 1PTOC 3PO2B 2JP1A 2EY6A 3T16A 5M5YB 4Y7NB 3NTIA 5A2QL 2I07B 4MHEA 3GTGB 3SK5A 3HOXB 3S1NB 1PRTF 2YYZA 4HR7B 5JEAH 1IKLA 2EVBA 2PMZB 1A3VA 1LTID 4HEDA 2K05A 1RJTA 1TQOA 5K5PA 5ELDA 1B9NA 2VXWA 1WTQA 3S1RB 4C2MB 5BN5A 5KIXA 1QOHA 4JBWA 2YU9B 3VA5A 3A7AB 3NP8A 1PREA 2NTSA 5EGTA 3S2DB 4KK7A 3AB9A 1TU2B 1RKNA 4Q5VA 4HN7A 1LTTD 1J9OA 4CJ0B 1GUTA 2OT2A 4R8IA 1NR2A 1HFNA 2QEJC 3S2HB 4KKTA 4G7ZC 2EYPA 1EZ6A 1STYA 1X3PA 2AWNA 1V1PB 2A68D 1JCKB 2NBFA 3MHBA 4HMIA 1SDFA 1VDZA 3MA2B 5CORA 1S5ED 1TWCB 3VR6A 3FDTA 1AFPA 3S14B 1VF5C 2KOLA 5EQ0A 3J7AF 4ZUJA 1WTWA 3NBIA 4QB4A 3WDNA 4NMZA 2A6EC 3TBIB 2R7ZB 3RMHA 1A2UA 4O42A 2OEOA 3VR2A 3X3NA 4K14A 3HOVB 4DF7A 1A3TA 3J81E 2K5DA 2LMCB 3TDQA 1H9KA 3RZDB 1S5DD 4PMCA 2D2CC 4C56C 4DU9A 4LJZC 5ELFA 2SNSA 4BS9A 2RQXA 2F0HA 2A69C 4OO1H 1Y69U 2R6GA 1R4QB 3GTKB 3OPOA 1FNUA 4DK1A 3MEHA 3S15B 2NZ1D 1LABA 1HHVA 3KUPA 4H44C 1G291 2DNCA 2A5HA 3HS0C 4S3SA 3Q24A 1XTCD 2JEAI 2PPBC 2TSSA 1F9PA 3NTHA 1W6JA 2ZXPA 4RGMA 3T53B 1HQRD 1TVXA 4DXFA 2K04A 3QOJA 4OL7A 2B2UC 2LFNA 2IWHA 2F0LA 3KLSA 2KEEA 1JB3A 3CU7A 2EY5A 5JVG3 1C48A 5K36G 2ENBA 1ONLA 4H13C 3TP6A 1ENCA 4NP5A 2F0WA 1TWAB 2XWBB 3DEPA 3OW7A 4RCOA 3NE5B 1SBBB 3FEWX 3I4LA 4X3KA 4M8AA 3P75A 4IALA 1U4MA 5J22A 1STAA 5EBDA 1I4HA 4XTCS 3I4MB 3J7YW 1PRTC 4UDUC 3K5LA 2F0FA 3D4WA 1EZ8A 3GTQB 1EQTA 3HP3A 1BOSA 1LT6D 3T13A 4FF4A 4BY7B 4ID6A 1B1ZA 2CVRA 2F3VA 2JEBI 1D1KA 2LS01 1STBA 2F4IA 4KV6A 4Z9CB 2EZVA 4F88A 5CV5A 3LWEA 1MGSA 5A2QE 3VYUA 2B63B 1KLUD 3BDOA 2B2VA 1EEID 4IUTA 3M85A 3PUWA 2IT1A 3NXWA 1II3A 1GHKA 1EU3A 1EWCA 2XSCA 4C3JG 4DGZA 1LT5D 1SYGA 2WKCA 3S17B 4AYBB 3I8ZA 5ELEA 3NHHA 4OO1I 2XN9C 4DAVA 2OXPA 3QOLA 1AW7A 2KCCA 4TRDA 1Y8NB 1V1PA 2PZWA 2A73B 4KN4C 1LTSD 4FF1A 2X6GA 1SMYC 4C3JB 2C9OA 1Y1VB 3M4YA 1AZPA 2X6LA 3GP7A 4K6LA 4N9PA 5CR3A 1KAAA 2BA0A 3BDLA 2E2DC 1QCBD 3C46A 5IGGA 2LKVA 4LK1C 5IGDA 5DM63 1PTOF 1JWUD 3DWQA 3D6CA 3S9WA 1CZWA 1XXGA 2XRSD 2AUJD 1T5XD 1SNCA 2QKIC 5I6WA 1O7ZA 3EJIA 3SE0A 3I3CA 1CA6A 5DAUA 1E0BA 5I6YA 2A6HD 1KDBA 2OF1A 1ILPA 3GQBA 2KECA 1RCVD 3LWUA 4ZKCB 1BQQT 1WTOA 1UNSA 1H9JA 2ID0A 1F2ZA 3RUZA 3N6RA 5FKAC 5K36H 3I90A 1PDQA 2B2TC 4A3KB 1WVLA 1VMCA 2B2YC 1B44D 4KHZA 4HMJA 2PYKA 1UUPA 2F0PA 4JK1C 2SEBD 1AN8A 1STGA 1MBYA 2Z4IA 3QO2A 1PFNA 2NTTA 1EY6A 4E6IA 3URYA 3SDZA 4IUUA 2K1BA 3S1QB 4KD3A 2AQ1B 4PMBA 5G3LD 2WAQB 5E4WC 1I4XA 2IJ0A 2KCNA 3FVQA 1A15A 1XYIA 1S4ZA 2K7VA 1YNNC 1GUOA 1TS2A 4I65A 2NN6G 5FK9C 2AUKA 4RA8A 1OXUA 4C3IG 1GOZA 2EYLA 4ULLA 2B2WA 1G2SA 2XIWA 1TIID 4RHSA 5JOBA 1EY0A 2Q8RE 3C3LA 2D9UA 2K03A 2F0VA 3OWEB 1SNMA 2B8GA 4PQXA 3K0YA 1KNAA 5T1GA 3GTPB 1B4OA 1WD0A 1IL8A 4RGTA 1EYDA 1HA5A 3AU7A 3A7LA 4XQNA 4A3IB 3EVQA 4XIGS 3G4NA 1CM9A 4C3IB 5IGCA 4X3UA 5A35A 1SJHD 3CRLC 3NWSA 1DJRD 5CMDA 1ET9A 3DWAA 1Y8OB 3I4NB 4WJWA 2CHBD 1QE6A 3OIPA 5M3MB 3OHXC 3VR4A 2QILA 5I9PA 2M00A 1BCPC 2ZXOA 1JC7A 5C3WA 2MP1A 4HSVA 5I9OA 1WTPA 5NUCA 1PFMA 2EJFC 3V96A 1HFGA 1SYEA 1IYVA 4PMWA 5DNFA 4K5VA 3HZXA 3IKJA 4IUNA 1U4LA 3BZDB 4IFDJ 1LTGD 4A3BB 4H7BA 3GTOB 4IQZA 2K01A 2BOSA 3FMCA 3KLSX 5JVH3 3UI2A 4CGYB 2HDLA 2NVQB 2JA6B 1PLFA 2G9HD 4G4KA 1Q8IA 1I6VC 3MXGA 2F03A 4FF3A 2PZUA 4FXDA 2SOBA 1EQVA 5CV9A 1TS4A 1TS5A 2JA7B 1OXTA 5ELCA 2IW3A 4KI0A 4F7XA 5IGEA 5EPJA 1Q12A 2CW0C 4QUFA 2HCIA 4HAEA 5CBEE 4FXGC 3ZYYX 5I2XA 5D65A 1S5CD 4RCNA 1HTPA 2A74C 2ICEC 5C5LA 3MXUA 4NDXA 4RGNA 4C3HB 5BN4A 2Z4HA 1SE4A 3L3OC 1O7LA 2A68C 3TP8A 1V8QA 2RKSA 1LV9A 1SYCA 4K5XA 4PV1C 4TSSA 3E0JA 3NQIA 2B2UA 3I72A 1K8OA 2NN6H 1DOMA 4G7HC 4K2KA 1TY2A 2F0OA 2FINB 4ZK9B 1EOTA 4NW2A 2NWGA 5I4DA 5CGKA 3H09A 1AZQA 2RSOA 1PZID 1H9SB 5FLXL 2Q8TA 2NVYB 1JOOA 3CQZB 1EY9A 1U9RA 4CHTB 2MUYA 1QILA 2H4OA 3GO5A 4TKOB 3I73A 3PO3B 2E2HB 5IT9L 5E3FA 1C8CA 3U9OA 2EY2A 1BF4A 2MJ8A 5M5WB 3N52A 1A6XA 4FO2A 1AEXA 4A3JB 1EYCA 3JAME 3IL8A 4Q0FA 1NCVA 1S5FD 1A2TA 2L4NA 3PIO3 4K2LA 2RDFA 1B53A 1LTAD 3VR5A 2WB1B 3Q0AA 1B50A 2R3ZA 3PV0A 3HOZB 4YIJA 2IX3A 2FHTA 3SK8A 3K5OA 2F0GA 3D31A 1GUGA 2BA1A 2EYOA 2DN8A 4FVMA 2A69D 5C6AA 2NUCA 2PZTA 2Z8LA 1EEFD 1FYCA 1J8IA 4A3GB 1RODA 1Q3LA 1BO0A 3K5NA 1D5ZC 2V4DA 5KYLA 4XT3B 1G8ZD 2JE6I 1SE2A 3BVMA 5M3FB 2K33A 2BE5D 2IX1A 1H9RA 1ESRA 2AQ2B 1UAPA 3H94A 1F77A 2E2IB 1YNJD 3BS1A 1AP0A 2SNMA 2HDMA 3OSOA 3SHLA 4C1NK 3R2TA 3A8IE 5CC4A 4RKBA 2RVLA 2ZT9C 1PTOB 1TWHB 2DY7A 3SEBA 2FMMA 2IX0A 2H1EA 3M4OB 4DN4M 4A3FB 3CRKC 3A8JE 3T56B 1IW7D 1HRJA 2JSOA 3TN2A 5D14A 2WACA 2NN6I 3HOUB 1TR5A 4QF4A 2E75C 1STNA 4XT1B 5KNCA 1QNUA 2NB0A 3M7GA 2N88A 2EPBA 2EJMA 2AWOA 4XYQA 4BBRB 3OMGA 1G6ZA 1SNDA 5C5MA 5C4XB 5IIFA 3P20A 4EQOA 5EKLA 3TP5A 3CHBD 1SAPA 2VB2X 3SK6A 1ENFA 2VUMB 3K57A 1BNZA 1E2WA 5C0XJ 2MHVA 3VR3A 3DXJC 4CJ2C 1GJXA 4B08A 1K8MA 4FF2A 2R92B 4FNFA 4DK0A 3KBXA 5JPNC 3BVGA 5E4XA 4PNYA 4IFDG 2MGSA 5EBCA 1KLGD 3T51B 1BCPF 3F2UA 2PO4A 3X3MA 5C3XA 5EJWA 1CI3M 2B2TA 1VMPA 4HCSA 1RHPA 4K8IA 2B2YA 1FD7D 1H9MA 1Y8PB 3GD7A 4BA1I 4NKLA 4CBVA 3C0NA 3NQTA 4K6DA 2NVXB 1F9QA 4ILWA 4KY6A 2F0EA 4B9WA 1HTLD 4ME5A 2NVTB 5JAVA 4F8MA 5IGFA 4HSPA 1IYUA 5IGBA 1XWEA 2L9HA 1H9SA 5HURA 2HQEA 1BDOA 4M1UB 5D3IB 1STEA 1SYFA 3VYRA 4DNTB 2CQAA 1EIHA 1E2VA 2A6HC 1EL0A 1D2BA 2Z1CA 3R2IA 4ZYSA 2EYFA 3ERQA 3NSWA 5EPLA 1ML0D 1LLRD 5COYA 1F2YA 5IT9E 3EA6A 4F87A 2PW5A 3BDCA 1JICA 2B2VC 1OXVA 2PW7A 1LTBD 1PZKD 4ODGA 1EYAA 2F0QA 4DAYA 3P7JA 1O80A 2FFKB 2HUGA 1ZYRC 1V43A 3OIQA 4K5WA 1CA5A 2EY1A 3BYTB 2XNAC 2I46A 4G57A 5TSSA 3OMCA 2B39A 4I7ZC 1KTKA 5CV8A 1D5MC 2WIIB 3QG1A 4L8JA 4J1MA 1EY8A 2HCCA 4RH6A 3MFYA 4H0LC 5BN3A 2MPMA 4BY1B 1Z52A 2F0IA 1IHZA 4OIKA 5J39A 1O78A 1PRTB 4K8JA 4KY7A 3K58A 3C0MA 3C1EA 3DMUA 1PYWD 1NAPA 3G4OA 3HEJA 3KLRA 1ICWA 2QDBA 4KN7C 4LAAA 5J1ZA 4C1NI 1QB5D 1MSHA 2JXMB 1WTRA 3C0OA 2R93B 3NWTA 3HG9A 1MI2A 1F9RA 1HXYD 4EQNA 1ILQA 3CKIB 1SNQA 2F0KA 3KF8A 1HQMC 2VNUD 4TQUS 3GTLB 3MZ5A 3FPUB 4IFDH 5FO9B 1Q90A 5C3EB 2PQEA 3S16B 3MXPA 3WOEA 1TKWB 3DM1A 5C44B 3MAQA 4KY5A 3FPPA 3R8BA 5CV4A 3S1MB 5CV6A 3MFGA 2EYMA 2R61A 1I4PA 1MD2D 4X3TA 2EYJA 4ZQ3A 2IL8A 1CQVA 1HPCA 2L55A 2ZXRA 2F0JA 1SXTA 4P2CB 2KJXA 3K5MA 4CJ1B 4ZAIA 2D5DA 1SE3A 5F2DA 2EXZA 1QWYA 1JQYD 1CFMA 3C2PA 3BVZA 2E74C 1F9SA 5CYUA 4O1NA 1I6HB 4BWGB 1SYDA 1Z6HA 1EY4A 5I2YA 3QB3A 2K5QA 1KABA 3G6JB 2B2WC 1LACA 4BA2I 5C4ZA 3PUYA 4U68A 1B3AA 2L1BA 5E1FA 3MVVA 3PIP3 1DOLA 1RD9D 1EWHA 2F0NA 2K5WA 4C3HG 3QIAA 1QG7A 1PTOD 1UEAB 1S5BD 1DXMA 5C0XG 4FXKC 3DUZA 2VB3X 1FNVA 1I4GA 1LT4D 4DNRB 2F0TA 1VF7A 5KEEA 2QF7A 4DAPA 4QIWB 1SYBA 2K28A 2M9VA 4XXEA 3NBHA 1KDCA 4EVOA 1SFOB 3O13A 4XDXA 5ELBA 2CW0D 2FMCA 3Q23A 1M4VA 1EU4A 3ITPA 3H0GB 1NR4A 1R4PB 2DY8A 1SEBD 2XRQD 2WKDA 4B9XA 5JEAJ 3KK7A 4A93B 2JA5B 3A8KE 1RF2D 3E6ZX 1GUSA 4IFDI 3K6OA 1I50B 2QCPX 3DEOA 4L6TB 1EY5A 1T5EA 4GZYC 2BCOA 3NUCA 4A3MB 4V0BA 3IFDA 5LL6X 1DOKA 1CK1A 3HOYB 1DZ1A 4QUCA 2BDOA 3IAYA 1NUCA 1GUWA 2BDNA 1WD1A 1D5XC 2A6ED 3J80L 5M9OA 4KJOA 4DXGA 3LNNA 4WRDA 4OIJA 1OXXK 2O2LD 2J7ZA 2RBMA 1MSGA 3AMUA 3G7LA 1HCZA 4R8NA 3RLFA 4WORA 1CHQD 4RAUC 1BBXC 5LHY1 2EDGA 5CV7A 1O7YA 1TS3A 4OGQC 2AQ3B 3LX0A 2D62A 1BCPB 4XQJA 2X69A 3Q6SA 3SXHA 4BBSB 4XYOA 2KHSA 2L0CA 3D6WA 2F3WA 1F2LA 3W3AA 1SJED 2BE5C 4DA2A 1TT2A 3FRPB 1RTOA 3H6MA 1YNJC 1G2TA 4IUVA 4ABNA 3I91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4X A;  1HA5 A;  1PRT B;  1L0Y B;  1PZJ D;  1ET6 A;  1XTC D;  3G4N A;  4L6T B;  3C0M A;  2TSS A;  1TS4 A;  1TS5 A;  1LTT D;  1FGB D;  1KLU D;  1SJH D;  1LTR D;  5ELC A;  1PYW D;  1EEI D;  4RGM A;  4RHR A;  5D3I B;  1DJR D;  1HQR D;  3G4O A;  1ET9 A;  1BCP D;  1RCV D;  1S5F D;  1JWM D;  4DXF A;  2QEJ C;  1CT1 D;  3DWA A;  1RDP D;  3V05 A;  1CK1 A;  2ICI A;  2CHB D;  1STE A;  1UNS A;  1EFI D;  1L0X B;  1LTA D;  1V1P B;  5FKA C;  5D3D A;  1JCK B;  1EU3 A;  3C0O A;  1EWC A;  2RDH A;  1DYQ A;  4RGO S;  1RD9 D;  4L63 B;  1D5X C;  1S5C D;  1HXY D;  2QIL A;  1FNW A;  3EFX D;  3R2I A;  4ZYS A;  1LT5 D;  1BCP C;  4DXG A;  1S5E D;  1PTO D;  1JR0 D;  5ELE A;  1B44 D;  1S5B D;  3CHB D;  4BWG B;  3DWP A;  1ENF A;  1LLR D;  2O2L D;  2XN9 C;  2WV6 D;  1TY0 A;  4RGN A;  1UUP A;  2SEB D;  1AN8 A;  1SE4 A;  1AW7 A;  3MC0 B;  3EA6 A;  1PRT D;  2NTT A;  1I4G A;  1FNV A;  2Z8L A;  3URY A;  4RCO A;  1LT4 D;  1V1P A;  1EEF D;  1LTB D;  1PZK D;  1SBB B;  1PTO C;  1CHQ D;  3TSS A;  3BVG A;  4TSS A;  1D5Z C;  2AQ1 B;  1LTS D;  1KLG D;  3BZD B;  1G8Z D;  1I4X A;  1BCP F;  4RFB A;  3R8B A;  1SE2 A;  2IJ0 A;  3MFG A;  1TS3 A;  3BVM A;  1I4H A;  2AQ3 B;  2R61 A;  1TY2 A;  1LTG D;  1I4P A;  1MD2 D;  1PRT C;  1TS2 A;  1BCP B;  3GP7 A;  4K6L A;  3BYT B;  4UDU C;  1PRT F;  5FK9 C;  2XNA C;  1PTO H;  1CQV A;  3O13 A;  2AQ2 B;  5TSS A;  1GOZ A;  5I4D A;  3W2D A;  1F77 A;  1SXT A;  1FD7 D;  5ELB A;  1LT6 D;  1KTK A;  1M4V A;  3KLS X;  1EU4 A;  1S5D D;  1D5M C;  1B1Z A;  1LTI D;  1I4Q A;  4C56 C;  1JWS D;  1PZI D;  1SE3 A;  1V1O A;  4OHJ A;  2RDG A;  2IPK D;  3R2T A;  3C0N A;  5ELF A;  1PTO F;  1JQY D;  1JWU D;  1SEB D;  2XRQ D;  3DWQ A;  1LT3 D;  5ELD A;  4RHS A;  4RH6 A;  1SJE D;  3BVZ A;  1XXG A;  1BXT A;  1PTO B;  2XRS D;  3SEB A;  1CHP D;  1QIL A;  2G9H D;  1HTL D;  1Z52 A;  1T5X D;  3OWE B;  1I4R A;  4Z9C B;  1FNU A;  1RF2 D;  1D6E C;  1PRE A;  2NTS A;  4O1N A;  1ESF A;  3BYY B;  1LO5 D;  4RGT A; 
#chains in the Genus database with same CATH topology
 5EKI A;  2VZA A;  3HOU G;  1L1O B;  1CZG A;  1OXS C;  3J7Z C;  3I7F A;  3K0X A;  1ET6 A;  2ALY B;  3A55 A;  3D8G A;  1PH1 A;  1B9M A;  3ND8 A;  1QNK A;  5G3L F;  3RD4 A;  2F0M A;  4A3C G;  3IRB A;  3QWN A;  1LTR D;  2XVS A;  2XWJ B;  3H3V I;  3TZU A;  2G9D A;  4DV4 Q;  1I3Q B;  1JWM D;  3PUZ A;  1VQ5 A;  1KRS A;  1SNP A;  3CCM A;  1IW7 C;  2EE1 A;  3V05 A;  2ICI A;  4O0A A;  3NTK A;  3L7Z C;  1ZEQ X;  5IYC G;  4C3H H;  1EFI D;  1PFS A;  1BUV T;  1S40 A;  4KTA A;  1N34 Q;  1N33 Q;  3CCS A;  5D3D A;  1SFO H;  1TWF B;  5C4H A;  4U67 3;  4ZLT F;  5C0X H;  1FR3 A;  3L0O A;  3PUV A;  1HA6 A;  1Y14 B;  4OX9 Q;  1U4P A;  2KA7 A;  4A76 A;  3VYT A;  4YWM A;  4LF6 Q;  4UAI A;  2E8G A;  2KQ3 A;  1JOR A;  3STB C;  2WV6 D;  1TY0 A;  3KF8 B;  1TXY A;  1YJW A;  3WOF A;  1DD2 A;  2SDF A;  4R4I A;  3H3V C;  3U9S A;  1NTG A;  2JA5 H;  1PRT D;  1U4R A;  1JB7 A;  3HKS A;  2C5C A;  1M8A A;  3TSS A;  4JI3 L;  3HRZ C;  2OQK A;  1C4Q A;  1DGS A;  2UXD L;  5LL6 S;  1Z9F A;  2FJ2 A;  4IZ8 A;  2NVY H;  3NEL A;  2WP8 J;  1OTC A;  1SR3 A;  3A54 A;  1HUM A;  4GNX B;  2K32 A;  5FJ8 H;  4A3M H;  2JYO A;  2EYH A;  1Y1W G;  3CD6 A;  1KNE A;  1NJI C;  1ZXT A;  4QCL A;  4L5Q A;  1I4Q A;  2E2H H;  3HOY H;  1B2T A;  4BXX H;  1PH8 A;  2RDG A;  3G4S A;  1JOK A;  2ZM6 Q;  3K59 A;  4ZRZ A;  4J6H A;  1D1I A;  1PMR A;  5IOD A;  5T1I A;  5M5W H;  1YHB A;  1U5K A;  1DON A;  4J15 A;  4A3J H;  4N8X 1;  2EOT A;  2E2J B;  1GXD C;  3NPP A;  1I94 Q;  1G91 A;  1SMX A;  3BYY B;  3PMF A;  4MN3 A;  3PF5 A;  1VQO A;  3NK9 A;  3OTO Q;  1LYL A;  2ZTE A;  3KF6 B;  4LMQ D;  1VQ7 A;  5JPM C;  1YIT A;  1EIF A;  1PZJ D;  5HY6 A;  4J8Q A;  3K8A A;  1Y1W B;  4DUZ Q;  1R9T B;  1ENA A;  4KD4 A;  1JE4 A;  4RHR A;  4FP5 D;  5FOB B;  4N9T A;  1X32 A;  4P74 A;  5C4J B;  4YHH L;  3KBG A;  1RDP D;  3A56 A;  1FJG L;  3T1Y Q;  2E76 C;  1WTX A;  1JOQ A;  1VQE A;  4A4I A;  3MWY W;  1FNW A;  4CDE C;  4A3D G;  1EIG A;  1GUN A;  1X3F A;  4DR3 Q;  2F0U A;  5KYI A;  2R7F A;  2L11 A;  3R93 A;  2Y0S G;  1SMY D;  3J81 c;  3GTJ B;  1HR0 W;  4P72 A;  3R3O A;  4YCV A;  4X64 Q;  2K4K A;  2KED A;  4IUR A;  5M3F H;  1C7Y A;  2O5I C;  3M7N A;  5FLX E;  3SVM A;  5LMU Q;  3L9A X;  1CQF A;  2E2I H;  4DKA C;  5KRU A;  3M3Y B;  4EQP A;  3H91 A;  1Z7T A;  3I70 A;  1VQN A;  4A3D B;  1VQ4 A;  5JJL A;  2A8V A;  3ND9 A;  1XX8 A;  4IUQ A;  1DCZ A;  1I3Q H;  1GHJ A;  1PTO H;  1TWH H;  3A5Z B;  4IN3 A;  5IOC A;  4A3E G;  4X62 L;  3W2D A;  5EPK A;  3M4O H;  3VA7 A;  4A3F H;  4UY8 C;  5KND A;  3J80 E;  2Y0S B;  4Y52 H;  1SSO A;  1V1O A;  4OHJ A;  4XQQ A;  5C0X I;  1T9H A;  1IKM A;  1RTN A;  5JEA G;  4LFA L;  1TWF H;  3ERO A;  1LT3 D;  1MKH A;  4DFA A;  3ULJ A;  1P8L A;  1OO9 B;  1WTV A;  4B3R L;  2LY7 A;  2DNE A;  2EQS A;  3HOW G;  1CHP D;  1KD1 C;  3DHQ A;  3OOC A;  2PNR C;  3HOU H;  2WIN B;  3V2T A;  3TZD A;  4MIU A;  1LO5 D;  4A3C H;  1AE2 A;  3HGB A;  3RN2 A;  3GV6 A;  4ZKB B;  3C1F A;  2UXD Q;  3TP7 A;  3K80 C;  4WFN 3;  4KHV A;  4A3E B;  4ME3 A;  1QJO A;  1PFB A;  4RWS C;  2Q8I B;  4CKC A;  2KUM A;  5KGU A;  4LF9 Q;  3EQL C;  2IHE A;  5JJI A;  5IYC H;  5KNB A;  5ISR A;  3BG3 A;  3I4O A;  1W6K A;  3HKZ G;  1CT1 D;  4DV0 L;  4P75 A;  2YTY A;  2R93 G;  3J81 L;  1ZYR D;  4CKB A;  5M5X B;  1PH9 A;  2JA8 B;  3GV3 A;  3T4A C;  3TME A;  3RZO B;  1GM5 A;  3MTS A;  2HT1 A;  3VYS A;  2VUM H;  3HOW B;  1STH A;  4NXN L;  4RKL A;  1PXU A;  4KMU C;  4NXM L;  1DYQ A;  1WCM G;  4RGO S;  2B29 A;  4ZUI A;  1HZB A;  3EFX D;  2GA4 B;  2R92 H;  5FO7 B;  3IFT A;  3SR1 A;  3PIP A;  5DLQ E;  3OW2 A;  2Z6B A;  4R9W A;  1JR0 D;  5DM7 3;  3E5S A;  1Q1B A;  5JJZ A;  3ONA B;  3JAM L;  2TMP A;  2L12 A;  1IBL Q;  3L2P A;  1XNR L;  3GTM B;  4HTH A;  1RL2 A;  1Q1E A;  4WJ4 A;  1YNN D;  3K81 C;  4QMG A;  5C44 G;  1HJP A;  5HGT A;  2B8F A;  2M2L A;  2N55 A;  3HKZ B;  4EGV A;  2NYZ D;  1HUN A;  4NPS A;  3P1H A;  1KC8 C;  1TWG B;  1BR9 A;  5DEH A;  3D3R A;  5EKK A;  3K7A B;  4FYD A;  4YHH Q;  4RFB A;  1JJC B;  1Y1W H;  3VDY A;  1R9T H;  2O5J C;  1CKN B;  1WCM B;  3SK4 A;  1A3U A;  2Q2U A;  2K6A A;  2XTI A;  3FKI G;  4CKE A;  3Q22 A;  3CCU A;  4UPA A;  4DV7 L;  1Z47 A;  1DM0 B;  5C4J H;  5E7N A;  2PCF B;  1YHQ A;  2HQL A;  3MXN A;  4G7O C;  1ZKO A;  1JWS D;  2IPK D;  2RA4 A;  1HR0 L;  3EIV A;  4HCE A;  4IPG A;  1EY7 A;  4KJN A;  5CBA E;  3A5U A;  1PV4 A;  1BXT A;  4HIO A;  2RSN A;  1I4R A;  3D4D A;  4GNX A;  1F2M A;  4B3M L;  1D6E C;  4KKS A;  1ESF A;  3BZK A;  1V9P A;  2UUB L;  5FO8 B;  4OO1 G;  2J4X A;  2O4X A;  1L0Y B;  1X56 A;  3FKI B;  2L5T A;  2LXK A;  2QW7 A;  1FGB D;  1NSN S;  1XTD A;  1E2Z A;  3M3Y H;  2UXC L;  1SN8 A;  2YV5 A;  2E5L L;  4V19 0;  1BCP D;  2D0P A;  2EJG C;  4IUP A;  4X62 Q;  3AYH B;  2RHS B;  1KDA A;  1L0X B;  2F0D A;  1K83 B;  1SNO A;  2RDH A;  3KF6 A;  3D4R A;  5AFW A;  4X66 L;  4L63 B;  3HOX G;  3CMA A;  3OWF A;  2KVM A;  3QJY A;  3DWP A;  3T1H L;  3ERS X;  2F1M A;  1VCI A;  3J7A V;  3PUX A;  2F0S A;  3MC0 B;  4YCU A;  1CTM A;  1X3Q A;  4X3S A;  2J0T D;  3CC2 A;  4KKU A;  4TVA B;  4DV6 L;  3PIO A;  4HIK A;  1PTO C;  3PO2 B;  2JP1 A;  4L5S A;  1UE1 A;  2EY6 A;  4H02 A;  3T16 A;  1E22 A;  1BVS A;  1YZ6 A;  5M5Y B;  4Y7N B;  2CKZ B;  3NTI A;  5A2Q L;  2I07 B;  3HKZ E;  4A3E H;  4MHE A;  1GO3 E;  2OWO A;  3GTG B;  1WTH A;  2B3G A;  3SK5 A;  3HOX B;  3S1N B;  1PRT F;  2YYZ A;  4NXN Q;  1E3P A;  4HR7 B;  5JEA H;  5H1S E;  1IKL A;  2EVB A;  2PMZ B;  4JI0 Q;  3ULL A;  4OWW B;  1MHW C;  2KCM A;  1A3V A;  5M5X H;  3KJO A;  1LTI D;  3RZO H;  4HED A;  2K05 A;  1QUQ B;  3HOW H;  4A93 G;  1RJT A;  3J81 j;  4LF4 Q;  1TQO A;  2K75 A;  5ELD A;  1B9N A;  5K5P A;  2VXW A;  2UU9 Q;  1WTQ A;  3S1R B;  4C2M B;  5BN5 A;  5KIX A;  1QOH A;  1XNR Q;  5IY0 A;  4JBW A;  3JAM i;  2YU9 B;  3VA5 A;  3A7A B;  3NP8 A;  1PRE A;  2IHF A;  2NTS A;  4A3L G;  5EGT A;  4DUY L;  3S2D B;  4KK7 A;  2MO0 A;  1BKB A;  3AB9 A;  1TU2 B;  1RKN A;  1BBU A;  4Q5V A;  4HN7 A;  1LTT D;  1J9O A;  4CJ0 B;  2R93 H;  1GUT A;  2OT2 A;  4R8I A;  1P16 A;  1K8G A;  1NR2 A;  3CCL A;  4JI8 Q;  3K7A H;  3KOJ A;  4L5R C;  2R7Z G;  1V1Q A;  2QEJ C;  1HFN A;  3RR5 A;  3S2H B;  1WCM H;  4KKT A;  4G7Z C;  2EYP A;  2HHH Q;  1EZ6 A;  1STY A;  1CSP A;  1X3P A;  1V1P B;  2AWN A;  1HR0 Q;  2A68 D;  1JCK B;  1KAW A;  2NBF A;  3MHB A;  3HOV G;  4HMI A;  4I7A A;  1SDF A;  1VDZ A;  3MA2 B;  5COR A;  1S5E D;  1TWC B;  2R7D A;  1YJ9 A;  3VR6 A;  3FDT A;  5C44 H;  2QGQ A;  1VQC A;  1AFP A;  3S14 B;  1NE3 A;  3UE1 A;  1VF5 C;  2KOL A;  5EQ0 A;  3J7A F;  1CKM A;  2UUB Q;  4ZUJ A;  4RMF A;  1MJE A;  1WTW A;  3NBI A;  4GLA C;  4QB4 A;  3WDN A;  4NMZ A;  2A6E C;  3TBI B;  2R7Z B;  3AEV A;  3UDX A;  2ATW A;  4DR1 Q;  2UXC Q;  3RMH A;  1A2U A;  3Q8D A;  3FKI H;  4O42 A;  2OEO A;  3VR2 A;  3X3N A;  4K14 A;  3HOV B;  4DF7 A;  1A3T A;  3J81 E;  1M1K C;  3ULP A;  2K5D A;  2LMC B;  3TDQ A;  4BBS G;  1H9K A;  4X6A H;  3RZD B;  1B7Y B;  1S5D D;  4PMC A;  2D2C C;  4C56 C;  1N36 L;  4DU9 A;  1I6H H;  1SRU A;  2CWA A;  4LJZ C;  1K83 H;  5ELF A;  2SNS A;  2PMZ E;  4NB3 A;  2RQX A;  4BS9 A;  2F0H A;  2A69 C;  4DV3 L;  4OO1 H;  1CKN A;  4L5T A;  1Y69 U;  2RF4 A;  2R6G A;  1R4Q B;  3GTK B;  3OPO A;  1FNU A;  4DK1 A;  5GAH C;  3MEH A;  4DV6 Q;  4X65 L;  3S15 B;  2NZ1 D;  1LAB A;  1HHV A;  3KUP A;  4H44 C;  2VQE L;  1G29 1;  2DNC A;  2A5H A;  2VY3 A;  3HS0 C;  4S3S A;  3Q24 A;  1XTC D;  2JEA I;  2PPB C;  3TRZ A;  1B70 B;  2TSS A;  1F9P A;  3NTH A;  4LW1 A;  1W6J A;  1N8R C;  2ZXP A;  4RGM A;  3T53 B;  3CPW A;  2K52 A;  1HQR D;  4GS3 A;  1TVX A;  4DXF A;  1X55 A;  2K04 A;  5IP7 H;  3QOJ A;  3GTG H;  1A63 A;  2OQ0 A;  4OL7 A;  4DR5 L;  2B2U C;  2LFN A;  3HOX H;  2IWH A;  4KHP L;  2F0L A;  1O7I A;  3S1N H;  3KLS A;  1XPU A;  2KEE A;  2Q2T A;  1Q82 C;  3E9H A;  3I4M G;  1JB3 A;  1JJ2 A;  3CU7 A;  2IY5 B;  2EY5 A;  3DM3 A;  3GDE A;  5JVG 3;  1C48 A;  4DPG A;  5K36 G;  2ENB A;  1ONL A;  4H13 C;  3TP6 A;  1ENC A;  4UHV A;  4NP5 A;  2Z0S A;  2F0W A;  4GLX A;  4DUY Q;  3S1R H;  4C2M H;  2UXB Q;  1TWA B;  3CCQ A;  4AIM A;  1W2B A;  2XWB B;  3ZJY C;  3DEP A;  3E3X A;  1HZ9 A;  3OW7 A;  1EYG A;  4RCO A;  3NE5 B;  1SBB B;  3FEW X;  3I4L A;  2JK8 A;  4X3K A;  3S2D H;  2F4V L;  4M8A A;  3P75 A;  3H0G H;  4IAL A;  1U4M A;  5J22 A;  1STA A;  4HJA A;  2EXD A;  5EBD A;  1I4H A;  4XTC S;  1IBM Q;  3J7Y W;  3I4M B;  1X6O A;  2N8N A;  1PRT C;  4UDU C;  3K5L A;  2F0F A;  3D4W A;  1EZ8 A;  2JQO A;  3GTQ B;  4A93 H;  1EQT A;  2DGY A;  3HP3 A;  2B63 G;  1YBY A;  1BOS A;  1LT6 D;  4K0K L;  2ZJP A;  3T13 A;  4FF4 A;  4BY7 B;  4ID6 A;  3MXN B;  4GN4 B;  1B1Z A;  2CVR A;  3D0F A;  3DLL A;  2F3V A;  3A74 A;  5GAD C;  2JEB I;  1I50 H;  1D1K A;  1SLJ A;  2LS0 1;  1STB A;  4WJ3 M;  4A3L H;  2F4I A;  3UDF A;  1MJC A;  4KV6 A;  1TWC H;  1VQL A;  2RCF A;  4Z9C B;  2EZV A;  4F88 A;  2I5L X;  5CV5 A;  3BU2 A;  4AYB G;  4LFB L;  3LWE A;  1MGS A;  4DR7 L;  5A2Q E;  4HJ5 A;  2R7Z H;  1QUQ A;  3VYU A;  2B63 B;  1VQI A;  1KRT A;  1KLU D;  3BDO A;  2F3I A;  1E24 A;  1EEI D;  2B2V A;  4IUT A;  1N32 Q;  3M85 A;  3PUW A;  1D7Q A;  2IT1 A;  2MNA A;  4DV1 L;  2Z6K C;  5LMN L;  3NXW A;  1II3 A;  3HOV H;  1ASZ A;  4JOI C;  1GHK A;  1EU3 A;  1EWC A;  2XSC A;  4C3J G;  4LF8 Q;  1CKO A;  1Y1V G;  4DGZ A;  1AH9 A;  1LT5 D;  1SYG A;  2WKC A;  3S17 B;  4AYB B;  3I8Z A;  4DV3 Q;  1W3S A;  5ELE A;  3NHH A;  3M4P A;  2XN9 C;  4OO1 I;  4DAV A;  2UUA Q;  2OXP A;  4JBK A;  4X65 Q;  3BJU A;  3QOL A;  1K3B C;  1AW7 A;  1ASY A;  4LFC L;  2VQE Q;  2KCC A;  4TRD A;  4UP8 A;  3GTK H;  3TQY A;  1Y8N B;  4CDD C;  1V1P A;  2PZW A;  3UDI A;  2KBN A;  2I0Q A;  1I5F A;  1QVC A;  2A73 B;  4KN4 C;  4BBS H;  1LTS D;  4FF1 A;  3KJP A;  2X6G A;  1SMY C;  3PCO B;  4C3J B;  2C9O A;  4B3S L;  1IBK L;  4DR5 Q;  1Y1V B;  3M4Y A;  1AZP A;  2X6L A;  3GP7 A;  4K6L A;  4N9P A;  4HID A;  4DR6 Q;  2PI2 E;  3U4Z A;  5CR3 A;  1KAA A;  2BA0 A;  3LGJ A;  3BDL A;  2E2D C;  1QCB D;  3C46 A;  5IGG A;  3RLN A;  2LKV A;  4LK1 C;  5IGD A;  5DM6 3;  1PTO F;  4PZ7 A;  1JWU D;  1A0I A;  3DWQ A;  1VQM A;  3D6C A;  3S9W A;  1VQ9 A;  1CZW A;  1XXG A;  3U50 C;  3JAM c;  2XRS D;  1PVO A;  2AUJ D;  1T5X D;  1SNC A;  2QKI C;  4EX5 A;  5I6W A;  1O7Z A;  3EJI A;  3SE0 A;  1UE5 A;  3I3C A;  1CA6 A;  1YJN A;  1YNX A;  2F4V Q;  5DAU A;  1TWA H;  1E0B A;  1HZA A;  5I6Y A;  2A6H D;  2N3S A;  4IJH A;  1KDB A;  2OF1 A;  1ILP A;  3GQB A;  2KEC A;  2KHI A;  4KLK A;  5GRO A;  4IO9 A;  5GQO A;  4LF5 L;  2JA8 G;  4GKK L;  1RCV D;  5IE8 A;  1FVI A;  2MFI A;  3LWU A;  2KEN A;  4ZKC B;  1AE3 A;  4OWT B;  3H15 A;  4JYA L;  2Q2H A;  3I4M H;  1BQQ T;  1NMG A;  1WTO A;  1UNS A;  2PQA B;  1H9J A;  2ID0 A;  1F2Z A;  3I2Z A;  3RUZ A;  3N6R A;  5FKA C;  4JI3 Q;  5K36 H;  3K7U C;  2CWP A;  3I90 A;  4R1J A;  1PDQ A;  2B2T C;  4A3K B;  1WVL A;  2K5V A;  3CF5 A;  1VMC A;  2B2Y C;  1B44 D;  4LNQ A;  4KHZ A;  4HMJ A;  1Q81 C;  1UEB A;  2PYK A;  1UUP A;  2F0P A;  4JK1 C;  2SEB D;  1AN8 A;  1STG A;  4AYB E;  1MBY A;  2Z4I A;  3QO2 A;  4DK6 C;  1PFN A;  2NTT A;  1K3R A;  1EY6 A;  4E6I A;  4DR7 Q;  3URY A;  4JI5 L;  3SDZ A;  4IUU A;  2K1B A;  3S1Q B;  4KD3 A;  4LWC A;  2AQ1 B;  3CCR A;  4PMB A;  5G3L D;  2WAQ B;  5E4W C;  3OYY A;  1I4X A;  4DV1 Q;  2IJ0 A;  3FVQ A;  2KCN A;  1GVP A;  1HH2 P;  1A15 A;  1XYI A;  3CC7 A;  1S4Z A;  2K7V A;  1YNN C;  1GUO A;  1TS2 A;  2HIV A;  4I65 A;  1YHA A;  1J6Q A;  2NN6 G;  5FK9 C;  2AUK A;  4RA8 A;  1OXU A;  4C3I G;  1NNX A;  1GOZ A;  2EYL A;  1B8A A;  1MIU A;  4R4T A;  4ULL A;  2B2W A;  1G2S A;  2E2J H;  2XIW A;  1VQD A;  1K9M C;  4JI1 L;  3G48 A;  1TII D;  4RHS A;  5JOB A;  3I4N G;  1EY0 A;  2PI2 A;  2Q8R E;  3W1G A;  3C3L A;  3E0E A;  2D9U A;  2K03 A;  2F0V A;  4LFC Q;  3OWE B;  1SNM A;  1FJG Q;  2B8G A;  4PQX A;  3K0Y A;  1KNA A;  5T1G A;  3GTP B;  1B4O A;  1WD0 A;  1IL8 A;  1E1T A;  4RGT A;  1EYD A;  1HA5 A;  3FHW A;  3AU7 A;  3UE0 A;  3A7L A;  4XQN A;  4A3I B;  3EVQ A;  4XIG S;  3G4N A;  1CM9 A;  4C3I B;  1EWI A;  5IGC A;  4X3U A;  4B3S Q;  1IBK Q;  5A35 A;  1SJH D;  3CRL C;  3TS0 A;  3NWS A;  1DJR D;  2PNH A;  1QZH A;  5CMD A;  1ET9 A;  3CAM A;  3DWA A;  1KL9 A;  1Y8O B;  2HD3 A;  4DV5 L;  3I4N B;  4WJW A;  2CHB D;  1VQ6 A;  1QE6 A;  1Y1V H;  3OIP A;  5M3M B;  1G6P A;  2N49 A;  1VQK A;  3OHX C;  3GTJ H;  4OEM B;  3VR4 A;  2QIL A;  1JT8 A;  5I9P A;  2M00 A;  1BCP C;  3J7A 5;  4HJ8 A;  1HNZ L;  2ZXO A;  1JC7 A;  5C3W A;  2MP1 A;  4HSV A;  1HNW L;  4DR2 L;  2K50 A;  1S3O A;  5I9O A;  5ELO A;  3PO2 G;  1WTP A;  5NUC A;  2RHQ B;  3ICE A;  3JC6 6;  4A3D H;  2CH4 W;  2LSS A;  1PFM A;  2AMC B;  4JI7 L;  4OON A;  1LUZ A;  2EJF C;  3V96 A;  1HFG A;  4JPB W;  4LFA Q;  3PQI A;  1SYE A;  2JA6 G;  4PMW A;  1IYV A;  5DNF A;  4K5V A;  3HZX A;  3IKJ A;  4JBJ A;  1PH4 A;  4ZCK A;  4IUN A;  4B3R Q;  1U4L A;  4GOP C;  3PF4 A;  3BZD B;  2AHO B;  4IPH A;  4IFD J;  4R4O A;  1K0S A;  1IL2 A;  1LTG D;  3A0J A;  1L1O C;  4A3B B;  1A8V A;  2K14 A;  4H7B A;  2WAQ E;  3GTO B;  5IYB G;  4IQZ A;  2K01 A;  2BOS A;  3FMC A;  1Q86 C;  3KLS X;  4YY3 L;  4R4Q A;  5JVH 3;  3UI2 A;  2JJQ A;  4CGY B;  2HDL A;  2H5X A;  2NVQ B;  1PH6 A;  4DV0 Q;  2JA6 B;  3EBE A;  1PLF A;  2G9H D;  4G4K A;  1EQQ A;  1YVC A;  3SGI A;  4JI5 Q;  4IOA A;  1Q8I A;  4P73 A;  1Q46 A;  1I6V C;  4NXM Q;  3F2D A;  2OTJ A;  2AKW B;  3MXG A;  3CCJ A;  2F03 A;  4FF3 A;  2PZU A;  2YTV A;  2V1C C;  2SOB A;  2JA8 H;  1EQV A;  4FXD A;  5CV9 A;  4RG1 A;  2CFM A;  1TS4 A;  3CP0 A;  1TS5 A;  2JA7 B;  1OXT A;  5ELC A;  3S1Q H;  5IWA L;  2IW3 A;  4KI0 A;  4F7X A;  5IGE A;  5EPJ A;  1Q12 A;  2CW0 C;  1YIJ A;  4QUF A;  5IT9 c;  2HCI A;  4HAE A;  5J3B A;  5CBE E;  4FXG C;  3ZYY X;  3GTM H;  1A62 A;  5I2X A;  4CDF C;  4JI4 L;  1SE8 A;  5D65 A;  1S5C D;  4RCN A;  4GNX C;  1HTP A;  2Z9H A;  1B3Q A;  2A74 C;  2ICE C;  5C5L A;  1X54 A;  3MEF A;  1PYB A;  1TWG H;  3MXU A;  4NDX A;  4RGN A;  4C3H B;  1YI2 A;  1C0A A;  5BN4 A;  4DV7 Q;  2Z4H A;  1SE4 A;  3L3O C;  3KFU A;  1O7L A;  2A68 C;  3HFZ B;  3TP8 A;  1LTL A;  1V8Q A;  1PH7 A;  3GTP H;  2PQA A;  2RKS A;  1LV9 A;  1SYC A;  1HNX L;  4K5X A;  4LF7 L;  4PZ6 A;  2N78 A;  3S24 A;  1N33 L;  4PV1 C;  4TSS A;  1X3E A;  3E0J A;  2B2U A;  3NQI A;  3I72 A;  1K8O A;  2NN6 H;  3PO3 G;  4OX9 L;  4IPD A;  1DOM A;  4C3I H;  4G7H C;  4K2K A;  4B3M Q;  4DV5 Q;  1TY2 A;  1PYS B;  2F0O A;  2FIN B;  4UP7 A;  1N9W A;  4ZK9 B;  1EOT A;  4NW2 A;  2Q2I A;  3NEN A;  3CPF A;  2NWG A;  5I4D A;  5CGK A;  3H09 A;  1AZQ A;  2RSO A;  1VQB A;  1RIP A;  1PZI D;  1H9S B;  5FLX L;  2Q8T A;  1Q7Y C;  1HNZ Q;  2NVY B;  4P71 A;  1JOO A;  3CQZ B;  2E5L Q;  2HIX A;  1HNW Q;  1EY9 A;  1BBW A;  1U9R A;  4CHT B;  2MUY A;  1QIL A;  2H4O A;  3GO5 A;  4TKO B;  3WWV A;  3HOZ G;  3I73 A;  4JI7 Q;  3KLW A;  3PO3 B;  2E2H B;  5IT9 L;  5E3F A;  1C8C A;  2MQH A;  3U9O A;  2A19 A;  2EY2 A;  4X66 Q;  1K73 C;  1BF4 A;  5IYD G;  2MJ8 A;  3TEH B;  5M5W B;  3N52 A;  1A6X A;  4FO2 A;  5LMN W;  1PHJ A;  1AEX A;  4AQY L;  4A3J B;  1EYC A;  3JAM E;  3T1H Q;  3IL8 A;  3W1B A;  4Q0F A;  1NCV A;  1S5F D;  1A2T A;  2L4N A;  3PIO 3;  4K2L A;  2CCZ A;  2RDF A;  4PG3 A;  4A3G G;  2K5H A;  1VQF A;  1B53 A;  2A1A A;  1LTA D;  3VR5 A;  1I94 L;  3U58 A;  2WB1 B;  3Q0A A;  1B50 A;  2R3Z A;  1EOV A;  3PV0 A;  4JC0 A;  3HOZ B;  1SRO A;  3NEM A;  4YIJ A;  1VS0 A;  2IX3 A;  4GN3 B;  3OTO L;  2FHT A;  3SK8 A;  5M3F G;  3K5O A;  2F0G A;  1UE6 A;  1C9O A;  1CSQ A;  1XPR A;  1PA6 A;  4DUZ L;  3PO2 H;  3D31 A;  1GUG A;  2BA1 A;  2DJF C;  5M5Y H;  4Y7N H;  1X3G A;  3TS2 A;  2EYO A;  2DN8 A;  2I5H A;  2A69 D;  4FVM A;  2JA6 H;  5C6A A;  2NUC A;  2PZT A;  2Z8L A;  4A75 A;  1Q8K A;  1WOC A;  3T1Y L;  1EEF D;  1FYC A;  2Z6K A;  1J8I A;  2OTL A;  4A3G B;  1ROD A;  5IWA Q;  1Q3L A;  1BO0 A;  3K5N A;  1D5Z C;  2V4D A;  5KYL A;  4A3F G;  4XT3 B;  1G8Z D;  2JE6 I;  1EQR A;  1SE2 A;  3BVM A;  5IYB H;  3M4Q A;  2GVB A;  5M3F B;  4BY7 G;  2K33 A;  2BE5 D;  2IX1 A;  1H9R A;  1ESR A;  1K0R A;  2AQ2 B;  1UAP A;  3H94 A;  1F77 A;  2YU9 H;  2E2I B;  4JI4 Q;  1YNJ D;  4MZ9 A;  4X64 L;  3BS1 A;  1AP0 A;  2SNM A;  2HDM A;  4DR4 L;  3OSO A;  3SHL A;  4C1N K;  3R2T A;  3A8I E;  5CC4 A;  4RKB A;  5LMU L;  2RVL A;  2ZT9 C;  1E7Z A;  1PTO B;  1TWH B;  2DY7 A;  3SEB A;  2FMM A;  2IX0 A;  2H1E A;  4BBR G;  3M4O B;  4DN4 M;  4A3F B;  3AQQ A;  5C4X G;  3CRK C;  1HNX Q;  4LF7 Q;  3A8J E;  2C35 B;  1VQA A;  3T56 B;  1EIY B;  1IW7 D;  3S2H H;  1HRJ A;  2ZTC A;  4JI2 L;  2JSO A;  3TN2 A;  3G6E A;  2VUM G;  2GN5 A;  5D14 A;  4UP9 A;  2WAC A;  2NN6 I;  3HOU B;  1TR5 A;  4QF4 A;  2E75 C;  1IXR A;  3UDG A;  1STN A;  4XT1 B;  5FLM G;  5KNC A;  1QNU A;  2R92 G;  3ER0 A;  2NB0 A;  3M7G A;  5HGQ A;  2N88 A;  3CME A;  3RN5 A;  3STB D;  2EPB A;  3S14 H;  2EJM A;  2AWO A;  4IJL A;  4QJF A;  4XYQ A;  4BBR B;  3OMG A;  1G6Z A;  1SND A;  5C5M A;  1J5E L;  5C4X B;  5IIF A;  3P20 A;  4JV5 L;  4EQO A;  1FL0 A;  5EKL A;  3TP5 A;  3CHB D;  1SAP A;  2WB1 E;  4B3T L;  4LF9 L;  2VB2 X;  3SK6 A;  3CCV A;  1ENF A;  3CQZ H;  2VUM B;  3K57 A;  1BNZ A;  1E2W A;  5C0X J;  2MHV A;  3VR3 A;  3DXJ C;  4CJ2 C;  2BH2 A;  1GJX A;  4B08 A;  1K8M A;  4FF2 A;  2R92 B;  1N36 Q;  4FNF A;  4O2D A;  3PO3 H;  2L15 A;  4DK0 A;  3KBX A;  4AQY Q;  2D0O A;  3BVG A;  5E4X A;  5JPN C;  4PNY A;  2VQF L;  3J80 i;  3RZD H;  4IFD G;  2MGS A;  5EBC A;  1KLG D;  3T51 B;  1BCP F;  5EAY A;  2EIF A;  3F2U A;  2PO4 A;  3X3M A;  5C3X A;  5EJW A;  1CI3 M;  1H95 A;  2B2T A;  1VMP A;  4HCS A;  1RHP A;  1IBL L;  4K8I A;  2B2Y A;  1PH3 A;  1FD7 D;  1H9M A;  1Y8P B;  3GD7 A;  5JJK A;  3RLO A;  4ALP A;  1VQG A;  4BA1 I;  4NKL A;  4YCW A;  4CBV A;  4CDC C;  3S15 H;  3C0N A;  3NQT A;  1X9N A;  4K6D A;  2NVX B;  1F9Q A;  3HOZ H;  4ILW A;  4KY6 A;  1XJV A;  2F0E A;  4B9W A;  1HTL D;  3F1Z A;  5IYD H;  4ME5 A;  1JMC A;  4KHP Q;  2NVT B;  5JAV A;  4F8M A;  5IGF A;  1L2F A;  4HSP A;  1IYU A;  4JW0 A;  5IGB A;  1XWE A;  2L9H A;  2G5D A;  5IP9 G;  5L37 A;  1H9S A;  5HUR A;  1VQP A;  2HQE A;  4GN5 A;  1BDO A;  4M1U B;  4A3G H;  1EUJ A;  2BH8 A;  5D3I B;  2QEX A;  4AH6 A;  3CW2 C;  5GAG C;  4IPC A;  1STE A;  1SYF A;  3VYR A;  4DNT B;  2CQA A;  4DR4 Q;  1CUK A;  1E2V A;  1EIH A;  2A6H C;  4A3K G;  1EL0 A;  1WI5 A;  1D2B A;  2Z1C A;  3R2I A;  4ZYS A;  2EYF A;  3ERQ A;  3NSW A;  1KXL A;  5EPL A;  1VQJ A;  1ML0 D;  3G71 A;  1LLR D;  5COY A;  2ASB A;  3NBH B;  2DJG C;  1F2Y A;  5AJ3 L;  5IT9 E;  4K0K Q;  5BR8 L;  3EA6 A;  1VQH A;  2YTX A;  4F87 A;  2PW5 A;  3BDC A;  1JIC A;  2B2V C;  4JI2 Q;  4GLV B;  2WAQ G;  1KHI A;  1OXV A;  1LTB D;  2PW7 A;  1PZK D;  3GTQ H;  4BY1 G;  1HZC A;  2KHJ A;  4ODG A;  1EYA A;  4BY7 H;  2F0Q A;  4DAY A;  3P7J A;  1O80 A;  2FFK B;  2HUG A;  1ZYR C;  1V43 A;  3OIQ A;  4K5W A;  1CA5 A;  1EFW A;  2EY1 A;  3BYT B;  4DNI A;  2VW9 A;  2XNA C;  2I46 A;  4G57 A;  5TSS A;  3OMC A;  4LFB Q;  2B39 A;  4I7Z C;  1KTK A;  1J5E Q;  1E1O A;  1K8A C;  4DAM A;  5CV8 A;  1D5M C;  2WII B;  4JV5 Q;  3QG1 A;  3F8T A;  4L8J A;  4BBR H;  4J1M A;  4IOC A;  1EY8 A;  1LM0 A;  4B3T Q;  2HCC A;  1U0L A;  4RH6 A;  3MFY A;  4JCV E;  3I56 A;  1QVF A;  4DV2 L;  4H0L C;  5C4X H;  2NZO A;  5BN3 A;  1PH2 A;  1KQS A;  4MTN A;  4LUV A;  2MPM A;  5LMN Q;  2B63 H;  4BY1 B;  4R4C A;  1Z52 A;  4A3I G;  2F0I A;  4GOP A;  1IHZ A;  3KDF A;  4OIK A;  5J39 A;  1XMO L;  2VQF Q;  1O78 A;  1PRT B;  4K8J A;  1L1O A;  3I55 A;  4JI0 L;  4YWL A;  5FLM H;  4KY7 A;  3K58 A;  3C0M A;  5ELN A;  3EN2 A;  3AFP A;  3C1E A;  3DMU A;  1PYW D;  4LF4 L;  2XGT A;  1NAP A;  5M3M G;  3G4O A;  3HEJ A;  2UU9 L;  3S17 H;  5C3E G;  3KLR A;  1ICW A;  2QDB A;  4KN7 C;  1WYD A;  4LAA A;  5J1Z A;  4C1N I;  1QB5 D;  1MSH A;  2UUC L;  2JXM B;  4HJ9 A;  1WTR A;  3U4V A;  3C0O A;  2R93 B;  3NWT A;  2DUD A;  3HG9 A;  1MI2 A;  1F9R A;  1HXY D;  4EQN A;  4YWK A;  2NVX H;  4GKJ L;  4QY7 A;  1ILQ A;  3CKI B;  1SNQ A;  2F0K A;  3PSI A;  3KF8 A;  1HQM C;  4LUZ A;  2VNU D;  4TQU S;  4JI8 L;  3GTL B;  4C3J H;  3MZ5 A;  2FXQ A;  3FPU B;  2CH4 A;  4IFD H;  5FO9 B;  2NVT H;  1Q90 A;  1X65 A;  5C3E B;  2HHH L;  2PQE A;  3S16 B;  3MXP A;  4QL5 A;  3WOE A;  1TKW B;  2MO1 A;  3DM1 A;  5C44 B;  1ICF B;  3MAQ A;  4KY5 A;  4A3B G;  3FPP A;  3R8B A;  2Y0S E;  5CV4 A;  5CV6 A;  3S1M B;  4JI6 L;  3MFG A;  2EYM A;  2R61 A;  3RNU A;  1I4P A;  1MD2 D;  4X3T A;  2EYJ A;  4ZQ3 A;  2IL8 A;  1VQ8 A;  1CQV A;  1HPC A;  2ZXR A;  2L55 A;  2F0J A;  1SXT A;  4P2C B;  4PZ8 A;  2KJX A;  3K5M A;  4CJ1 B;  4ZAI A;  2D5D A;  1JJG A;  1SE3 A;  5F2D A;  2EXZ A;  1QWY A;  3E9I A;  2KCT A;  1JQY D;  1CFM A;  3C2P A;  4LF5 Q;  4GKK Q;  4DR1 L;  4OWX B;  3BVZ A;  5AJ3 Q;  1XNQ L;  2E74 C;  3PGZ A;  5BR8 Q;  4JYA Q;  1IYJ B;  1F9S A;  5CYU A;  5GAE C;  3M9B A;  4O1N A;  5IP9 H;  1I6H B;  4BWG B;  2JA7 G;  1PH5 A;  3F2C A;  5IP7 G;  4N8F A;  1SYD A;  4DK3 C;  4POG A;  1Z6H A;  1EY4 A;  5I2Y A;  2QA4 A;  4JG2 A;  1XMQ L;  3W5O A;  3QB3 A;  2K5Q A;  1NY4 A;  1KAB A;  3G6J B;  1YEZ A;  2B2W C;  1LAC A;  1D8L A;  4BA2 I;  4LUO A;  5C4Z A;  4A3K H;  3PUY A;  4APV A;  4U68 A;  1B3A A;  2GVA A;  2L1B A;  5E1F A;  3MVV A;  3PIP 3;  1UWV A;  1DOL A;  1RD9 D;  1EWH A;  5FLX c;  2OCE A;  2F0N A;  2K5W A;  4DV2 Q;  4C3H G;  3QIA A;  1QG7 A;  2ES2 A;  4HIM A;  2RCN A;  1PTO D;  1UEA B;  1S5B D;  1DXM A;  5C0X G;  3H0G G;  4FXK C;  1XMO Q;  3J81 i;  4BY1 H;  3DUZ A;  3AFQ A;  2VB3 X;  2I5M X;  1FNV A;  1I4G A;  4JI1 Q;  3BZC A;  1LT4 D;  4DNR B;  2F0T A;  1VF7 A;  3J80 c;  5KEE A;  1IZ6 A;  4POF A;  2JA5 G;  2QF7 A;  4DAP A;  4QIW B;  3H3V H;  1SYB A;  2K28 A;  2M9V A;  2UUC Q;  1UE7 A;  4XXE A;  4DV4 L;  3NBH A;  1KDC A;  4EVO A;  1L0W A;  1SFO B;  3O13 A;  4XDX A;  5ELB A;  2UXB L;  2CW0 D;  2FMC A;  3Q23 A;  1M4V A;  1EU4 A;  3ITP A;  3H0G B;  5FJ8 G;  3CXC A;  4A3M G;  1WFQ A;  3F2B A;  1QZG A;  4JBM A;  4HJ7 A;  1NR4 A;  1N34 L;  1XPO A;  2JN4 A;  1R4P B;  2DY8 A;  1SEB D;  4GKJ Q;  2XRQ D;  2ZTD A;  2WKD A;  4B9X A;  4A3I H;  5JEA J;  3KK7 A;  3HOY G;  2ZJQ A;  4A93 B;  2QDL A;  4BXX G;  4LF6 L;  1FGU A;  2JA5 B;  3A8K E;  1IBM L;  1RF2 D;  1M90 C;  4OEL B;  3E6Z X;  1GUS A;  4IFD I;  3K6O A;  1I50 B;  4QGU A;  3GTL H;  4A3J G;  2QCP X;  3I4N H;  3QR8 A;  5M3M H;  3DEO A;  4L6T B;  1EY5 A;  5C3E H;  4JI6 Q;  1NBW A;  1T5E A;  3S16 H;  4GZY C;  2BCO A;  3NUC A;  4A3M B;  4V0B A;  4DR2 Q;  3IFD A;  4JVZ A;  2WB1 G;  3S1M H;  5LL6 X;  1DOK A;  1CK1 A;  1WJJ A;  3HOY B;  1DZ1 A;  4QUC A;  2BDO A;  1QVG A;  3IAY A;  2NZH A;  1NUC A;  1GUW A;  3FP9 A;  2BDN A;  1WD1 A;  1D5X C;  2VS1 A;  2A6E D;  3J80 L;  5M9O A;  4KJO A;  4DXG A;  1XNQ Q;  1G51 A;  3LNN A;  3TRE A;  4MTK A;  1NMF A;  1KIX A;  4WRD A;  2ZM6 L;  4OIJ A;  1OXX K;  2O2L D;  4OXP A;  2LXJ A;  3CC4 A;  2J7Z A;  3KYH C;  1N32 L;  2RBM A;  1MSG A;  3AMU A;  3G7L A;  1GD7 A;  4YY3 Q;  4A3B H;  1HCZ A;  1GKH A;  4R8N A;  2VL6 A;  1XMQ Q;  3RLF A;  4WOR A;  1CHQ D;  2JA9 A;  4RAU C;  3GTO H;  1BBX C;  5LHY 1;  2EDG A;  4MNO A;  4DAY B;  4LF8 L;  4QQB X;  3CCE A;  1K28 A;  5CV7 A;  1O7Y A;  1TS3 A;  3B6Y A;  4OGQ C;  2AQ3 B;  2NVQ H;  3LX0 A;  2D62 A;  1BCP B;  2P5Z X;  2UUA L;  4XQJ A;  2X69 A;  4EQ5 A;  4QIW E;  3Q6S A;  3SXH A;  1S72 A;  2K5N A;  4BBS B;  4XYO A;  2KHS A;  2L0C A;  2F52 A;  3D6W A;  2F3W A;  1F2L A;  3W3A A;  4JOI A;  4FDB A;  1SJE D;  2BE5 C;  4DA2 A;  1TT2 A;  2ZJR A;  4DR3 L;  3FRP B;  2JA7 H;  1RTO A;  3H6M A;  1YNJ C;  1G2T A;  4GOP B;  4IUV A;  1JE5 A;  2WFW A;  2CQO A;  3KDF B;  4ABN A;  3I91 A;  4DR6 L; 
#chains in the Genus database with same CATH homology
 5EKI A;  1CZG A;  1OXS C;  1ET6 A;  3A55 A;  3D8G A;  1B9M A;  3ND8 A;  1QNK A;  5G3L F;  3RD4 A;  2F0M A;  3QWN A;  1LTR D;  2XVS A;  2XWJ B;  3TZU A;  2G9D A;  1I3Q B;  1JWM D;  3PUZ A;  1SNP A;  1IW7 C;  2EE1 A;  3V05 A;  2ICI A;  3NTK A;  3L7Z C;  1ZEQ X;  1EFI D;  1BUV T;  4KTA A;  5D3D A;  1TWF B;  5C4H A;  4U67 3;  4ZLT F;  5C0X H;  1FR3 A;  3PUV A;  1HA6 A;  1U4P A;  2KA7 A;  3VYT A;  4UAI A;  2KQ3 A;  1JOR A;  2WV6 D;  1TY0 A;  1DD2 A;  3WOF A;  2SDF A;  3H3V C;  3U9S A;  1PRT D;  1U4R A;  2C5C A;  1M8A A;  3TSS A;  3HRZ C;  1C4Q A;  5LL6 S;  2FJ2 A;  4IZ8 A;  2WP8 J;  3A54 A;  1HUM A;  2K32 A;  2JYO A;  2EYH A;  1KNE A;  1ZXT A;  4QCL A;  1I4Q A;  1B2T A;  2RDG A;  1JOK A;  3K59 A;  4ZRZ A;  4J6H A;  1D1I A;  1PMR A;  5IOD A;  5T1I A;  1DON A;  2EOT A;  2E2J B;  1GXD C;  3NPP A;  1G91 A;  3BYY B;  3PMF A;  4MN3 A;  3NK9 A;  4LMQ D;  5JPM C;  1PZJ D;  4J8Q A;  1Y1W B;  1R9T B;  1ENA A;  4KD4 A;  1JE4 A;  4RHR A;  4FP5 D;  5FOB B;  4N9T A;  1X32 A;  5C4J B;  3KBG A;  1RDP D;  3A56 A;  2E76 C;  1WTX A;  1JOQ A;  3MWY W;  1FNW A;  1EIG A;  1GUN A;  2F0U A;  5KYI A;  2L11 A;  3R93 A;  1SMY D;  3GTJ B;  3R3O A;  2KED A;  4IUR A;  2O5I C;  3M7N A;  5FLX E;  3SVM A;  3L9A X;  1CQF A;  5KRU A;  3M3Y B;  4EQP A;  3H91 A;  1Z7T A;  3I70 A;  4A3D B;  3ND9 A;  1XX8 A;  4IUQ A;  1DCZ A;  1PTO H;  1GHJ A;  4IN3 A;  5IOC A;  3W2D A;  5EPK A;  3VA7 A;  5KND A;  3J80 E;  2Y0S B;  1SSO A;  1V1O A;  4OHJ A;  4XQQ A;  5C0X I;  1IKM A;  1RTN A;  5JEA G;  3ERO A;  1LT3 D;  4DFA A;  1OO9 B;  1WTV A;  2LY7 A;  2DNE A;  1CHP D;  3DHQ A;  3OOC A;  2PNR C;  2WIN B;  3V2T A;  3TZD A;  4MIU A;  1LO5 D;  3HGB A;  3GV6 A;  4ZKB B;  3C1F A;  3TP7 A;  4WFN 3;  4KHV A;  4A3E B;  2Q8I B;  1QJO A;  1PFB A;  4RWS C;  4CKC A;  5KGU A;  2KUM A;  3EQL C;  5KNB A;  5ISR A;  3BG3 A;  1W6K A;  1CT1 D;  3J81 L;  1ZYR D;  4CKB A;  5M5X B;  2JA8 B;  3GV3 A;  3T4A C;  3TME A;  3RZO B;  3MTS A;  3VYS A;  3HOW B;  1STH A;  4RKL A;  1PXU A;  4KMU C;  1DYQ A;  4RGO S;  4ZUI A;  3EFX D;  2GA4 B;  5FO7 B;  3IFT A;  3SR1 A;  4R9W A;  1JR0 D;  5DM7 3;  3E5S A;  1Q1B A;  5JJZ A;  3ONA B;  3JAM L;  2TMP A;  2L12 A;  3GTM B;  4HTH A;  1Q1E A;  1YNN D;  4QMG A;  5HGT A;  2B8F A;  2M2L A;  2N55 A;  3HKZ B;  4EGV A;  2NYZ D;  1HUN A;  3P1H A;  1TWG B;  1BR9 A;  5DEH A;  3D3R A;  5EKK A;  3K7A B;  4FYD A;  4RFB A;  2O5J C;  1WCM B;  3SK4 A;  1A3U A;  2K6A A;  4CKE A;  3Q22 A;  1Z47 A;  1DM0 B;  2PCF B;  4G7O C;  3MXN A;  1ZKO A;  1JWS D;  2IPK D;  2RA4 A;  4HCE A;  1EY7 A;  4KJN A;  5CBA E;  1BXT A;  2RSN A;  1I4R A;  3D4D A;  1F2M A;  1D6E C;  4KKS A;  1ESF A;  5FO8 B;  4OO1 G;  2J4X A;  2O4X A;  1L0Y B;  3FKI B;  2L5T A;  1FGB D;  1NSN S;  1E2Z A;  4V19 0;  1BCP D;  2EJG C;  4IUP A;  1KDA A;  1L0X B;  2F0D A;  1K83 B;  1SNO A;  2RDH A;  3D4R A;  5AFW A;  4L63 B;  3OWF A;  2KVM A;  3QJY A;  3DWP A;  2F1M A;  1VCI A;  3J7A V;  3PUX A;  2F0S A;  3MC0 B;  1CTM A;  1X3Q A;  4X3S A;  2J0T D;  4KKU A;  1PTO C;  3PO2 B;  2JP1 A;  2EY6 A;  3T16 A;  5M5Y B;  4Y7N B;  3NTI A;  5A2Q L;  2I07 B;  4MHE A;  3GTG B;  3SK5 A;  3HOX B;  3S1N B;  1PRT F;  2YYZ A;  4HR7 B;  5JEA H;  1IKL A;  2EVB A;  2PMZ B;  1A3V A;  1LTI D;  4HED A;  2K05 A;  1RJT A;  1TQO A;  5K5P A;  5ELD A;  1B9N A;  2VXW A;  1WTQ A;  3S1R B;  4C2M B;  5BN5 A;  5KIX A;  1QOH A;  4JBW A;  2YU9 B;  3VA5 A;  3A7A B;  3NP8 A;  1PRE A;  2NTS A;  5EGT A;  3S2D B;  4KK7 A;  3AB9 A;  1TU2 B;  1RKN A;  4Q5V A;  4HN7 A;  1LTT D;  1J9O A;  4CJ0 B;  1GUT A;  2OT2 A;  4R8I A;  1NR2 A;  1HFN A;  2QEJ C;  3S2H B;  4KKT A;  4G7Z C;  2EYP A;  1EZ6 A;  1STY A;  1X3P A;  2AWN A;  1V1P B;  2A68 D;  1JCK B;  2NBF A;  3MHB A;  4HMI A;  1SDF A;  1VDZ A;  3MA2 B;  5COR A;  1S5E D;  1TWC B;  3VR6 A;  3FDT A;  1AFP A;  3S14 B;  1VF5 C;  2KOL A;  5EQ0 A;  3J7A F;  4ZUJ A;  1WTW A;  3NBI A;  4QB4 A;  3WDN A;  4NMZ A;  2A6E C;  3TBI B;  2R7Z B;  3RMH A;  1A2U A;  4O42 A;  2OEO A;  3VR2 A;  3X3N A;  4K14 A;  3HOV B;  4DF7 A;  1A3T A;  3J81 E;  2K5D A;  2LMC B;  3TDQ A;  1H9K A;  3RZD B;  1S5D D;  4PMC A;  2D2C C;  4C56 C;  4DU9 A;  4LJZ C;  5ELF A;  2SNS A;  4BS9 A;  2RQX A;  2F0H A;  2A69 C;  4OO1 H;  1Y69 U;  2R6G A;  1R4Q B;  3GTK B;  3OPO A;  1FNU A;  4DK1 A;  3MEH A;  3S15 B;  2NZ1 D;  1LAB A;  1HHV A;  3KUP A;  4H44 C;  1G29 1;  2DNC A;  2A5H A;  3HS0 C;  4S3S A;  3Q24 A;  1XTC D;  2JEA I;  2PPB C;  2TSS A;  1F9P A;  3NTH A;  1W6J A;  2ZXP A;  4RGM A;  3T53 B;  1HQR D;  1TVX A;  4DXF A;  2K04 A;  3QOJ A;  4OL7 A;  2B2U C;  2LFN A;  2IWH A;  2F0L A;  3KLS A;  2KEE A;  1JB3 A;  3CU7 A;  2EY5 A;  5JVG 3;  1C48 A;  5K36 G;  2ENB A;  1ONL A;  4H13 C;  3TP6 A;  1ENC A;  4NP5 A;  2F0W A;  1TWA B;  2XWB B;  3DEP A;  3OW7 A;  4RCO A;  3NE5 B;  1SBB B;  3FEW X;  3I4L A;  4X3K A;  4M8A A;  3P75 A;  4IAL A;  1U4M A;  5J22 A;  1STA A;  5EBD A;  1I4H A;  4XTC S;  3I4M B;  3J7Y W;  1PRT C;  4UDU C;  3K5L A;  2F0F A;  3D4W A;  1EZ8 A;  3GTQ B;  1EQT A;  3HP3 A;  1BOS A;  1LT6 D;  3T13 A;  4FF4 A;  4BY7 B;  4ID6 A;  1B1Z A;  2CVR A;  2F3V A;  2JEB I;  1D1K A;  2LS0 1;  1STB A;  2F4I A;  4KV6 A;  4Z9C B;  2EZV A;  4F88 A;  5CV5 A;  3LWE A;  1MGS A;  5A2Q E;  3VYU A;  2B63 B;  1KLU D;  3BDO A;  2B2V A;  1EEI D;  4IUT A;  3M85 A;  3PUW A;  2IT1 A;  3NXW A;  1II3 A;  1GHK A;  1EU3 A;  1EWC A;  2XSC A;  4C3J G;  4DGZ A;  1LT5 D;  1SYG A;  2WKC A;  3S17 B;  4AYB B;  3I8Z A;  5ELE A;  3NHH A;  4OO1 I;  2XN9 C;  4DAV A;  2OXP A;  3QOL A;  1AW7 A;  2KCC A;  4TRD A;  1Y8N B;  1V1P A;  2PZW A;  2A73 B;  4KN4 C;  1LTS D;  4FF1 A;  2X6G A;  1SMY C;  4C3J B;  2C9O A;  1Y1V B;  3M4Y A;  1AZP A;  2X6L A;  3GP7 A;  4K6L A;  4N9P A;  5CR3 A;  1KAA A;  2BA0 A;  3BDL A;  2E2D C;  1QCB D;  3C46 A;  5IGG A;  2LKV A;  4LK1 C;  5IGD A;  5DM6 3;  1PTO F;  1JWU D;  3DWQ A;  3D6C A;  3S9W A;  1CZW A;  1XXG A;  2XRS D;  2AUJ D;  1T5X D;  1SNC A;  2QKI C;  5I6W A;  1O7Z A;  3EJI A;  3SE0 A;  3I3C A;  1CA6 A;  5DAU A;  1E0B A;  5I6Y A;  2A6H D;  1KDB A;  2OF1 A;  1ILP A;  3GQB A;  2KEC A;  1RCV D;  3LWU A;  4ZKC B;  1BQQ T;  1WTO A;  1UNS A;  1H9J A;  2ID0 A;  1F2Z A;  3RUZ A;  3N6R A;  5FKA C;  5K36 H;  3I90 A;  1PDQ A;  2B2T C;  4A3K B;  1WVL A;  1VMC A;  2B2Y C;  1B44 D;  4KHZ A;  4HMJ A;  2PYK A;  1UUP A;  2F0P A;  4JK1 C;  2SEB D;  1AN8 A;  1STG A;  1MBY A;  2Z4I A;  3QO2 A;  1PFN A;  2NTT A;  1EY6 A;  4E6I A;  3URY A;  3SDZ A;  4IUU A;  2K1B A;  3S1Q B;  4KD3 A;  2AQ1 B;  4PMB A;  5G3L D;  2WAQ B;  5E4W C;  1I4X A;  2IJ0 A;  2KCN A;  3FVQ A;  1A15 A;  1XYI A;  1S4Z A;  2K7V A;  1YNN C;  1GUO A;  1TS2 A;  4I65 A;  2NN6 G;  5FK9 C;  2AUK A;  4RA8 A;  1OXU A;  4C3I G;  1GOZ A;  2EYL A;  4ULL A;  2B2W A;  1G2S A;  2XIW A;  1TII D;  4RHS A;  5JOB A;  1EY0 A;  2Q8R E;  3C3L A;  2D9U A;  2K03 A;  2F0V A;  3OWE B;  1SNM A;  2B8G A;  4PQX A;  3K0Y A;  1KNA A;  5T1G A;  3GTP B;  1B4O A;  1WD0 A;  1IL8 A;  4RGT A;  1EYD A;  1HA5 A;  3AU7 A;  3A7L A;  4XQN A;  4A3I B;  3EVQ A;  4XIG S;  3G4N A;  1CM9 A;  4C3I B;  5IGC A;  4X3U A;  5A35 A;  1SJH D;  3CRL C;  3NWS A;  1DJR D;  5CMD A;  1ET9 A;  3DWA A;  1Y8O B;  3I4N B;  4WJW A;  2CHB D;  1QE6 A;  3OIP A;  5M3M B;  3OHX C;  3VR4 A;  2QIL A;  5I9P A;  2M00 A;  1BCP C;  2ZXO A;  1JC7 A;  5C3W A;  2MP1 A;  4HSV A;  5I9O A;  1WTP A;  5NUC A;  1PFM A;  2EJF C;  3V96 A;  1HFG A;  1SYE A;  1IYV A;  4PMW A;  5DNF A;  4K5V A;  3HZX A;  3IKJ A;  4IUN A;  1U4L A;  3BZD B;  4IFD J;  1LTG D;  4A3B B;  4H7B A;  3GTO B;  4IQZ A;  2K01 A;  2BOS A;  3FMC A;  3KLS X;  5JVH 3;  3UI2 A;  4CGY B;  2HDL A;  2NVQ B;  2JA6 B;  1PLF A;  2G9H D;  4G4K A;  1Q8I A;  1I6V C;  3MXG A;  2F03 A;  4FF3 A;  2PZU A;  4FXD A;  2SOB A;  1EQV A;  5CV9 A;  1TS4 A;  1TS5 A;  2JA7 B;  1OXT A;  5ELC A;  2IW3 A;  4KI0 A;  4F7X A;  5IGE A;  5EPJ A;  1Q12 A;  2CW0 C;  4QUF A;  2HCI A;  4HAE A;  5CBE E;  4FXG C;  3ZYY X;  5I2X A;  5D65 A;  1S5C D;  4RCN A;  1HTP A;  2A74 C;  2ICE C;  5C5L A;  3MXU A;  4NDX A;  4RGN A;  4C3H B;  5BN4 A;  2Z4H A;  1SE4 A;  3L3O C;  1O7L A;  2A68 C;  3TP8 A;  1V8Q A;  2RKS A;  1LV9 A;  1SYC A;  4K5X A;  4PV1 C;  4TSS A;  3E0J A;  3NQI A;  2B2U A;  3I72 A;  1K8O A;  2NN6 H;  1DOM A;  4G7H C;  4K2K A;  1TY2 A;  2F0O A;  2FIN B;  4ZK9 B;  1EOT A;  4NW2 A;  2NWG A;  5I4D A;  5CGK A;  3H09 A;  1AZQ A;  2RSO A;  1PZI D;  1H9S B;  5FLX L;  2Q8T A;  2NVY B;  1JOO A;  3CQZ B;  1EY9 A;  1U9R A;  4CHT B;  2MUY A;  1QIL A;  2H4O A;  3GO5 A;  4TKO B;  3I73 A;  3PO3 B;  2E2H B;  5IT9 L;  5E3F A;  1C8C A;  3U9O A;  2EY2 A;  1BF4 A;  2MJ8 A;  5M5W B;  3N52 A;  1A6X A;  4FO2 A;  1AEX A;  4A3J B;  1EYC A;  3JAM E;  3IL8 A;  4Q0F A;  1NCV A;  1S5F D;  1A2T A;  2L4N A;  3PIO 3;  4K2L A;  2RDF A;  1B53 A;  1LTA D;  3VR5 A;  2WB1 B;  3Q0A A;  1B50 A;  2R3Z A;  3PV0 A;  3HOZ B;  4YIJ A;  2IX3 A;  2FHT A;  3SK8 A;  3K5O A;  2F0G A;  3D31 A;  1GUG A;  2BA1 A;  2EYO A;  2DN8 A;  4FVM A;  2A69 D;  5C6A A;  2NUC A;  2PZT A;  2Z8L A;  1EEF D;  1FYC A;  1J8I A;  4A3G B;  1ROD A;  1Q3L A;  1BO0 A;  3K5N A;  1D5Z C;  2V4D A;  5KYL A;  4XT3 B;  1G8Z D;  2JE6 I;  1SE2 A;  3BVM A;  5M3F B;  2K33 A;  2BE5 D;  2IX1 A;  1H9R A;  1ESR A;  2AQ2 B;  1UAP A;  3H94 A;  1F77 A;  2E2I B;  1YNJ D;  3BS1 A;  1AP0 A;  2SNM A;  2HDM A;  3OSO A;  3SHL A;  4C1N K;  3R2T A;  3A8I E;  5CC4 A;  4RKB A;  2RVL A;  2ZT9 C;  1PTO B;  1TWH B;  2DY7 A;  3SEB A;  2FMM A;  2IX0 A;  2H1E A;  3M4O B;  4DN4 M;  4A3F B;  3CRK C;  3A8J E;  3T56 B;  1IW7 D;  1HRJ A;  2JSO A;  3TN2 A;  5D14 A;  2WAC A;  2NN6 I;  3HOU B;  1TR5 A;  4QF4 A;  2E75 C;  1STN A;  4XT1 B;  5KNC A;  1QNU A;  2NB0 A;  3M7G A;  2N88 A;  2EPB A;  2EJM A;  2AWO A;  4XYQ A;  4BBR B;  3OMG A;  1G6Z A;  1SND A;  5C5M A;  5C4X B;  5IIF A;  3P20 A;  4EQO A;  5EKL A;  3TP5 A;  3CHB D;  1SAP A;  2VB2 X;  3SK6 A;  1ENF A;  2VUM B;  3K57 A;  1BNZ A;  1E2W A;  5C0X J;  2MHV A;  3VR3 A;  3DXJ C;  4CJ2 C;  1GJX A;  4B08 A;  1K8M A;  4FF2 A;  2R92 B;  4FNF A;  4DK0 A;  3KBX A;  5JPN C;  3BVG A;  5E4X A;  4PNY A;  4IFD G;  2MGS A;  5EBC A;  1KLG D;  3T51 B;  1BCP F;  3F2U A;  2PO4 A;  3X3M A;  5C3X A;  5EJW A;  1CI3 M;  2B2T A;  1VMP A;  4HCS A;  1RHP A;  4K8I A;  2B2Y A;  1FD7 D;  1H9M A;  1Y8P B;  3GD7 A;  4BA1 I;  4NKL A;  4CBV A;  3C0N A;  3NQT A;  4K6D A;  2NVX B;  1F9Q A;  4ILW A;  4KY6 A;  2F0E A;  4B9W A;  1HTL D;  4ME5 A;  2NVT B;  5JAV A;  4F8M A;  5IGF A;  4HSP A;  1IYU A;  5IGB A;  1XWE A;  2L9H A;  1H9S A;  5HUR A;  2HQE A;  1BDO A;  4M1U B;  5D3I B;  1STE A;  1SYF A;  3VYR A;  4DNT B;  2CQA A;  1EIH A;  1E2V A;  2A6H C;  1EL0 A;  1D2B A;  2Z1C A;  3R2I A;  4ZYS A;  2EYF A;  3ERQ A;  3NSW A;  5EPL A;  1ML0 D;  1LLR D;  5COY A;  1F2Y A;  5IT9 E;  3EA6 A;  4F87 A;  2PW5 A;  3BDC A;  1JIC A;  2B2V C;  1OXV A;  2PW7 A;  1LTB D;  1PZK D;  4ODG A;  1EYA A;  2F0Q A;  4DAY A;  3P7J A;  1O80 A;  2FFK B;  2HUG A;  1ZYR C;  1V43 A;  3OIQ A;  4K5W A;  1CA5 A;  2EY1 A;  3BYT B;  2XNA C;  2I46 A;  4G57 A;  5TSS A;  3OMC A;  2B39 A;  4I7Z C;  1KTK A;  5CV8 A;  1D5M C;  2WII B;  3QG1 A;  4L8J A;  4J1M A;  1EY8 A;  2HCC A;  4RH6 A;  3MFY A;  4H0L C;  5BN3 A;  2MPM A;  4BY1 B;  1Z52 A;  2F0I A;  1IHZ A;  4OIK A;  5J39 A;  1O78 A;  1PRT B;  4K8J A;  4KY7 A;  3K58 A;  3C0M A;  3C1E A;  3DMU A;  1PYW D;  1NAP A;  3G4O A;  3HEJ A;  3KLR A;  1ICW A;  2QDB A;  4KN7 C;  4LAA A;  5J1Z A;  4C1N I;  1QB5 D;  1MSH A;  2JXM B;  1WTR A;  3C0O A;  2R93 B;  3NWT A;  3HG9 A;  1MI2 A;  1F9R A;  1HXY D;  4EQN A;  1ILQ A;  3CKI B;  1SNQ A;  2F0K A;  3KF8 A;  1HQM C;  2VNU D;  4TQU S;  3GTL B;  3MZ5 A;  3FPU B;  4IFD H;  5FO9 B;  1Q90 A;  5C3E B;  2PQE A;  3S16 B;  3MXP A;  3WOE A;  1TKW B;  3DM1 A;  5C44 B;  3MAQ A;  4KY5 A;  3FPP A;  3R8B A;  5CV4 A;  3S1M B;  5CV6 A;  3MFG A;  2EYM A;  2R61 A;  1I4P A;  1MD2 D;  4X3T A;  2EYJ A;  4ZQ3 A;  2IL8 A;  1CQV A;  1HPC A;  2L55 A;  2ZXR A;  2F0J A;  1SXT A;  4P2C B;  2KJX A;  3K5M A;  4CJ1 B;  4ZAI A;  2D5D A;  1SE3 A;  5F2D A;  2EXZ A;  1QWY A;  1JQY D;  1CFM A;  3C2P A;  3BVZ A;  2E74 C;  1F9S A;  5CYU A;  4O1N A;  1I6H B;  4BWG B;  1SYD A;  1Z6H A;  1EY4 A;  5I2Y A;  3QB3 A;  2K5Q A;  1KAB A;  3G6J B;  2B2W C;  1LAC A;  4BA2 I;  5C4Z A;  3PUY A;  4U68 A;  1B3A A;  2L1B A;  5E1F A;  3MVV A;  3PIP 3;  1DOL A;  1RD9 D;  1EWH A;  2F0N A;  2K5W A;  4C3H G;  3QIA A;  1QG7 A;  1PTO D;  1UEA B;  1S5B D;  1DXM A;  5C0X G;  4FXK C;  3DUZ A;  2VB3 X;  1FNV A;  1I4G A;  1LT4 D;  4DNR B;  2F0T A;  1VF7 A;  5KEE A;  2QF7 A;  4DAP A;  4QIW B;  1SYB A;  2K28 A;  2M9V A;  4XXE A;  3NBH A;  1KDC A;  4EVO A;  1SFO B;  3O13 A;  4XDX A;  5ELB A;  2CW0 D;  2FMC A;  3Q23 A;  1M4V A;  1EU4 A;  3ITP A;  3H0G B;  1NR4 A;  1R4P B;  2DY8 A;  1SEB D;  2XRQ D;  2WKD A;  4B9X A;  5JEA J;  3KK7 A;  4A93 B;  2JA5 B;  3A8K E;  1RF2 D;  3E6Z X;  1GUS A;  4IFD I;  3K6O A;  1I50 B;  2QCP X;  3DEO A;  4L6T B;  1EY5 A;  1T5E A;  4GZY C;  2BCO A;  3NUC A;  4A3M B;  4V0B A;  3IFD A;  5LL6 X;  1DOK A;  1CK1 A;  3HOY B;  1DZ1 A;  4QUC A;  2BDO A;  3IAY A;  1NUC A;  1GUW A;  2BDN A;  1WD1 A;  1D5X C;  2A6E D;  3J80 L;  5M9O A;  4KJO A;  4DXG A;  3LNN A;  4WRD A;  4OIJ A;  1OXX K;  2O2L D;  2J7Z A;  2RBM A;  1MSG A;  3AMU A;  3G7L A;  1HCZ A;  4R8N A;  3RLF A;  4WOR A;  1CHQ D;  4RAU C;  1BBX C;  5LHY 1;  2EDG A;  5CV7 A;  1O7Y A;  1TS3 A;  4OGQ C;  2AQ3 B;  3LX0 A;  2D62 A;  1BCP B;  4XQJ A;  2X69 A;  3Q6S A;  3SXH A;  4BBS B;  4XYO A;  2KHS A;  2L0C A;  3D6W A;  2F3W A;  1F2L A;  3W3A A;  1SJE D;  2BE5 C;  4DA2 A;  1TT2 A;  3FRP B;  1RTO A;  3H6M A;  1YNJ C;  1G2T A;  4IUV A;  4ABN A;  3I91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...