1PRTC

The crystal structure of pertussis toxin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 43
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1prtC01
1ENFA 3TSSA 1EWCA 1JQYD 1BCPD 1LT6D 1TS3A 1QILA 1S5ED 1CQVA 1V1OA 2AQ1B 1FD7D 4RGMA 3G4NA 1STEA 4K6LA 3W2DA 1ET6A 1CT1D 1PTOD 1UNSA 1HQRD 1L0YB 1S5BD 1JWUD 1PZID 1G8ZD 1LTSD 1TY0A 1HA5A 4DXGA 5ELEA 2Z8LA 2SEBD 1T5XD 2G9HD 5TSSA 1SJED 4O1NA 3R8BA 1AW7A 5FK9C 3EFXD 1EEFD 1JR0D 1PZKD 1FNWA 2XNAC 1SEBD 4DXFA 3DWPA 4RGNA 1RCVD 1UUPA 1B44D 1GOZA 2AQ2B 1LTAD 1SE3A 1EU4A 1D6EC 1L0XB 1I4QA 2RDHA 4RCOA 1LTBD 5ELCA 3BVMA 1I4RA 1PTOH 1PRTC 3KLSX 5ELDA 1BCPC 1DYQA 1LTRD 2R61A 2XN9C 4RHRA 3CHBD 2WV6D 4RHSA 3URYA 4L6TB 1RD9D 3V05A 1S5DD 5D3IB 1LO5D 4RH6A 3BYTB 1LT5D 3BVZA 1JWSD 3EA6A 4RGOS 3BVGA 2NTTA 1V1PB 1LTTD 1V1PA 1PYWD 1S5FD 1M4VA 1JWMD 4RGTA 3G4OA 1LTGD 1RF2D 1FNUA 2NTSA 4BWGB 2IJ0A 1EFID 3GP7A 5I4DA 1DJRD 1LT4D 2XRSD 1CK1A 1B1ZA 2ICIA 1LT3D 1JCKB 2QILA 5D3DA 3R2TA 1PZJD 1D5XC 1CHQD 3O13A 4C56C 4ZYSA 1TS4A 2J4XA 4Z9CB 1SBBB 1FNVA 4RFBA 1LTID 3C0NA 1I4GA 1TY2A 1PREA 1KLGD 1PTOC 1XTCD 3MC0B 1TS2A 1EEID 3DWQA 1XXGA 4L63B 1F77A 1PRTF 1PRTD 1ESFA 1BCPF 1ET9A 1S5CD 2AQ3B 1SE4A 4OHJA 1FGBD 1LLRD 1RDPD 5ELBA 1EU3A 4UDUC 1Z52A 1PTOF 1AN8A 1D5MC 5ELFA 1D5ZC 2O2LD 2RDGA 1SXTA 2IPKD 3C0MA 3BYYB 1KLUD 2CHBD 5FKAC 1KTKA 1TS5A 1MD2D 1HXYD 1I4XA 1SJHD 3BZDB 3C0OA 3DWAA 1PRTB 2TSSA 1BCPB 1I4HA 1SE2A 1I4PA 3OWEB 3R2IA 4TSSA 2QEJC 1HTLD 3MFGA 3SEBA 1CHPD 2XRQD 1BXTA 1PTOB
chains in the Genus database with same CATH superfamily
4GLAC 5FO8B 3CCJA 4DR7Q 3CRLC 1FD7D 1EIYB 3W1BA 2DGYA 2UU9Q 2JA7B 4C3HH 4M8AA 2F0TA 2WB1G 4GLXA 4CGYB 2Z4HA 3FPUB 4JI0Q 3I70A 4HJ9A 5ELNA 2NVQH 1C7YA 3FEWX 1U4RA 1XMQQ 2K6AA 4IPDA 2L0CA 4ME5A 4ULLA 4RGNA 4OXPA 2JEAI 1VQMA 1B44D 4KJNA 1E2WA 4TRDA 1EY8A 3B6YA 5C4JH 1GXDC 1MHWC 3T56B 2YTVA 5ELCA 1IXRA 2SOBA 1Y1WH 1SYFA 1KDBA 1TWCB 3SK4A 4YCVA 5JJKA 1DYQA 2KQ3A 4XQQA 5C6AA 3PO2H 5ISRA 4HJ5A 5K36H 3S16H 4ZAIA 3BVGA 5C3WA 3K58A 2B2TC 2NZHA 1K0RA 4P71A 1M4VA 1X9NA 1OXTA 2B29A 4IFDH 3EJIA 1J5EL 4RKBA 3I4NB 1WJJA 1VQKA 1EFID 4RAUC 1GKHA 1EWIA 3MZ5A 1T5EA 5E7NA 2PW7A 4IQZA 1WTWA 1P16A 4KY5A 2UUAQ 1CHQD 1YNNC 2QA4A 4OO1G 4DR5Q 1SBBB 4PZ7A 2AWNA 3C0NA 2EY2A 1CKNB 4QF4A 3PUZA 3S2DH 1BR9A 2H1EA 2GN5A 1EY5A 1NUCA 4DNRB 1RL2A 2GA4B 1TWGH 1SE4A 4ABNA 4WRDA 1WTHA 2K5QA 2QF7A 2MGSA 2A73B 4JI3L 1VCIA 3U9SA 2RHSB 3W5OA 4MN3A 2WB1E 3D6CA 5E3FA 4DAYB 2ICEC 1VQ4A 2IT1A 1I4HA 1YVCA 1SE2A 3DM3A 1I4PA 4TQUS 4G7ZC 2ZTEA 3K8AA 4GOPC 1XNQQ 1GJXA 2MQHA 1EZ6A 2C5CA 4GKKL 1CQVA 2K5HA 3F2BA 1JOQA 2KHIA 1YNJC 5DLQE 4DR3Q 2BA0A 4A3DH 1HQRD 4N9PA 2FHTA 4JI4Q 3AFQA 1TY0A 1X56A 1XPOA 1EQQA 1H9SA 2VZAA 4G57A 4X62L 4ZKCB 2EZVA 1XNRL 4MTKA 5I9OA 5C5MA 3VYTA 2EY6A 2GVAA 2CFMA 4BY1H 4B3MQ 3UE1A 4HIKA 4H13C 2F0VA 3KDFA 1RTOA 2QDLA 4ALPA 4DV0L 2K28A 1RODA 1I3QB 5ELDA 4A3LG 2YU9B 2R61A 1STBA 3BZKA 2DNCA 3KLSA 2ZXRA 1Q8IA 4KN4C 1SN8A 1GUNA 3D3RA 1N32Q 1QWYA 3X3MA 3ZJYC 3M85A 4LF8L 3UDFA 2FMMA 4RGTA 1RF2D 1DCZA 3K81C 3F2DA 1HR0L 3TEHB 1CK1A 2A69D 1K3RA 4EQ5A 1X3QA 5FO7B 5IP7G 3CC7A 1JC7A 1NMFA 2AKWB 3T53B 3KFUA 4LFCL 1TWAB 2VXWA 4IUQA 5DM63 1XTCD 1TS2A 3MHBA 3TBIB 1CUKA 1IKLA 4JI7Q 4A3BG 2PCFB 4HMJA 5IP9H 2I5LX 1LLRD 5IGFA 4DAMA 1A3UA 2F0LA 3E9HA 2UXCQ 1HXYD 4GKJL 4E6IA 1I6HB 5CYUA 1HTPA 1SJHD 4A75A 3PUXA 4F8MA 1Q86C 1Q3LA 2A6HD 3R2IA 3DMUA 1GUWA 1QNUA 5IY0A 3FKIB 4HSPA 1X32A 3OMGA 1A2UA 1JQYD 1YNND 4NW2A 3I90A 3EQLC 2JA6B 3NP8A 3I56A 3L3OC 2BA1A 3CU7A 1MJEA 2O4XA 1JWUD 4RKLA 5C0XI 2SEBD 1O78A 2JJQA 1CQFA 4HJ7A 4DPGA 1O7ZA 3OSOA 3ER0A 3CQZB 4JVZA 5M5WH 4JI3Q 2IHEA 3DWPA 3VA7A 1BVSA 2NWGA 1PA6A 2B2WA 1SNDA 4ZLTF 3MWYW 5HURA 4POGA 3J81c 1WTRA 2B63B 1DOKA 1UE6A 3KBXA 1DOLA 2BDNA 2F0FA 2D62A 3CMEA 2HHHQ 2N78A 5NUCA 1PVOA 4CDCC 1YNJD 2EDGA 4FYDA 1WVLA 2A68D 1S5FD 4A3CH 2BH2A 1MSGA 2OTLA 3HOWG 1IKMA 2CW0C 2CQAA 2K03A 5M3FH 4WORA 1Q81C 2ICIA 3RR5A 2F0SA 2M9VA 4DR1L 4FDBA 1PYSB 2F0GA 3HOVB 5IODA 1Z9FA 1U4LA 1W3SA 3E3XA 2ZJRA 3MA2B 4OL7A 1Z7TA 4OX9L 4KLKA 1WCMB 1B3AA 1ZYRC 4A76A 1X54A 4DV2Q 1F77A 1EOTA 3PUYA 5FLXL 1ESFA 2L12A 4DV6L 1HH2P 1SSOA 3I4MB 5J1ZA 1F9QA 1K83B 1IW7C 1HFGA 3LNNA 1L2FA 3U4VA 1KC8C 2KECA 3HOZH 1SXTA 2IPKD 1U4PA 5C44G 4EX5A 4F7XA 3HOXB 3A8IE 3GTGH 4MZ9A 5I6WA 2OF1A 4K8IA 1S72A 2ZXPA 3BZDB 5C3EB 4M1UB 2EYJA 3J81j 1BCPB 1UE5A 2JA5G 5CV7A 3NBHA 4LK1C 4R8NA 2K14A 2UUCL 2PMZB 1QILA 3EVQA 3C1FA 2L55A 2VB2X 3RN5A 4LFCQ 2RHQB 4KD4A 4B9WA 1HNXQ 2EVBA 4QIWE 3M4OH 2WAQG 4A93H 4BBRB 2IX3A 4OONA 5M5YB 4ZKBB 3H3VH 5C4XG 3TMEA 5LL6X 1KDAA 3K5NA 1JOOA 3PO3H 2F0WA 1QVFA 4NDXA 2XNAC 1STGA 4DV1L 1XPRA 1G2SA 3PF4A 3U4ZA 3HKZE 1EQVA 2DY7A 1EU4A 1AZPA 2A6EC 4WJWA 5FLXE 3SDZA 3PIOA 4GKJQ 2Y0SE 3GD7A 4A3JH 2EJGC 2XN9C 1SR3A 3J7YW 1TWHH 3IFDA 3LX0A 1PH3A 4IFDI 5JEAH 3RZDH 4Q5VA 3HOYG 3DHQA 3S1RB 3URYA 1S5DD 4GLVB 4C2MB 1NSNS 1LT5D 3EA6A 4DGZA 5KNBA 3SR1A 4IUNA 4BY7G 1XPUA 1E0BA 1F2YA 2MFIA 3I55A 3FRPB 4A3IH 2B2YC 3TP8A 2E76C 1LT4D 1J8IA 3PGZA 4A3EB 1A2TA 1EY7A 2B8GA 3BS1A 1VQHA 2D9UA 1TS4A 2R92G 1QOHA 5KEEA 4X3KA 3I8ZA 3K80C 1CKNA 1UEAB 2PNRC 4BXXG 4NKLA 4JOIA 2DJFC 2IL8A 3UDIA 5T1IA 3SXHA 2KJXA 5IGDA 3K7UC 1JICA 3NK9A 4PMBA 3C46A 4K0KL 1Q12A 1WTQA 2CCZA 4JC0A 5IGBA 1EQTA 1Y8OB 4JCVE 4S3SA 3U9OA 3CF5A 5IYBG 3CPWA 5M5XB 3GTPH 3BYYB 2JA8G 3HFZB 4DAYA 1BKBA 1X3FA 2M2LA 3J7ZC 1VQ8A 4ME3A 3U50C 5CBAE 2F0MA 4MTNA 5AJ3L 2QEJC 1HTLD 4IZ8A 4X3UA 1B50A 3KLRA 3HOUB 2WACA 2Z1CA 1TS3A 1BCPD 4DR1Q 2PZWA 3GTQH 1STEA 3D4WA 4B3RQ 3ULJA 4A3FG 4Y52H 5IOCA 1S5BD 5M3MH 5CR3A 1G8ZD 1B2TA 2LXJA 3M4QA 2RQXA 2BDOA 3M4YA 1SRUA 5KGUA 2JA7G 2KCNA 3Q23A 4R4TA 1HNZL 2OQ0A 2UXBL 1GUSA 1T9HA 1SNOA 4DV6Q 2N3SA 2TMPA 4P2CB 5FK9C 2R93H 1FNWA 1SMXA 3GTLB 3H3VC 1BNZA 4A3GB 2F0HA 1ZEQX 1PH2A 1QNKA 1JMCA 3ND8A 1YHQA 4ODGA 4BBSH 2N8NA 2ZM6L 3LGJA 3BG3A 4H44C 3PMFA 1N33L 4HR7B 2A1AA 4A3MB 1X3PA 4FXGC 1F2MA 2Q8RE 1ICFB 2UUCQ 1H9KA 5I2YA 2XIWA 2F0QA 4AYBB 2R7ZB 3A55A 5COYA 3OWFA 3K5LA 5EPLA 1TKWB 4IJLA 4PMCA 4JI5Q 3W3AA 4ZUIA 4LF4L 2RCNA 5CORA 1F2LA 3PUVA 4A3KH 4FF1A 2RSNA 3I4NG 2XTIA 4DNTB 4ZRZA 1KQSA 1SLJA 2JA9A 3M4PA 4TVAB 3GTOH 3NUCA 3S1QB 1X65A 1LACA 1F9RA 2MPMA 2H4OA 4H7BA 1W2BA 2KBNA 3J81E 1VQNA 1E1OA 3S1MB 1JORA 3N6RA 5KRUA 4DV7L 1G2TA 1Y8PB 1L0WA 1K3BC 4JYAQ 2MJ8A 2WKDA 1G291 1H95A 4DR6L 2KENA 1IBKL 1HJPA 1HNWL 5JEAJ 1BQQT 3KF8A 4NXML 3OWEB 4DV3L 3GTJB 1R4PB 2B2UC 3KOJA 3TSSA 2PI2A 4KV6A 2NVXB 3CD6A 4UHVA 3NSWA 2YTYA 3QWNA 1UNSA 2NN6H 1NBWA 4L5TA 2A8VA 2IY5B 2CKZB 1T5XD 3E0JA 3H0GH 4PG3A 2JSOA 2NBFA 4DK1A 2ID0A 3EFXD 1ILPA 2E2JB 4HEDA 3MEFA 4K0KQ 3L9AX 5JJZA 2VNUD 3MXNB 3RZOB 1H9JA 4YY3L 1GOZA 1D6EC 2KCTA 4RCOA 4HAEA 1VQOA 3A74A 5AJ3Q 4I65A 1RHPA 5HY6A 2WV6D 3TN2A 2F0UA 4FF2A 1AE2A 4L6TB 4KHZA 4K5WA 2N88A 5T1GA 1TWFB 3CMAA 2XWJB 3BYTB 1JE4A 1QVCA 4K6DA 2EXZA 2BH8A 3UDXA 1LTTD 2K04A 4Q0FA 4NXNQ 4HCEA 1LV9A 2FINB 3K57A 4DK3C 2VB3X 3G4OA 1B70B 1OXUA 4YWLA 2B2VC 2XRSD 1GVPA 3GTKH 2WP8J 2QILA 4CJ1B 4C3JB 1QUQB 4LWCA 3MVVA 2PPBC 1PHJA 4JBMA 4EVOA 3DWQA 2F0IA 4LF9Q 4L63B 1H9RA 2BCOA 2E2IB 3LWUA 1CM9A 1BCPF 2AQ3B 4FO2A 5GAHC 2ZM6Q 3SE0A 3MXPA 5I2XA 1Z52A 2EY1A 4R4QA 3K0YA 1E2VA 3NPPA 5IYDG 4JBJA 2RBMA 3I73A 3WDNA 3A5UA 1DGSA 2MO1A 4ZUJA 3KLWA 4OO1H 4J6HA 4OIKA 3C0OA 3K6OA 2TSSA 3EROA 1EYAA 4LF4Q 3S17B 1N36Q 2PQAB 1PLFA 4OWTB 5IT9L 5JPMC 3NTHA 5IWAQ 3TQYA 5CBEE 1NNXA 3H3VI 1X3GA 1A6XA 3AEVA 5C0XJ 3FKIG 2HT1A 4GN5A 2FJ2A 2M00A 2XWBB 3D31A 2JA6G 2K5DA 1KRSA 2IWHA 1B9MA 1HZBA 4F88A 3AYHB 1PZKD 4IPGA 4L8JA 5LHY1 3P75A 1II3A 4DUYQ 1VQ5A 1SE3A 2MUYA 3G48A 4DR6Q 1L0XB 1JB7A 3RLNA 4OWXB 1IBKQ 2NVYB 1BF4A 1PTOH 4DNIA 4LF7L 1PRTC 3KLSX 2QKIC 1HNWQ 1LTRD 3Q8DA 3BDLA 4NXMQ 2RVLA 3J80c 4K2LA 1D1IA 4JK1C 2J7ZA 1ILQA 3HGBA 4RH6A 1YBYA 2B63G 5GQOA 2E8GA 2K52A 1KNEA 1PH9A 5IYCG 3Q22A 2XGTA 3ERQA 3NQIA 4LFAL 4CBVA 2VUMB 3DEOA 1STAA 2NTSA 5JOBA 5KNCA 5IT9E 3CC4A 1O80A 1ZKOA 2A5HA 4GOPB 1B3QA 4XT3B 2LS01 5E1FA 1SYDA 1RJTA 2BOSA 3S1NB 2JYOA 1L1OC 1HFNA 4C3IB 4HIMA 4A3LH 4X64L 1YNXA 1ENCA 2EYFA 2KUMA 3D6WA 3S14B 1LUZA 4GNXC 3AQQA 4YY3Q 3E9IA 1HUNA 1Y1VB 2F3WA 3T1YL 3HOVG 3EN2A 4C3HB 1EIGA 3OIPA 4FXKC 2VQEL 1ET9A 1EOVA 1N9WA 5JVH3 4DV4L 1WCMG 3CCQA 3GO5A 3GQBA 2OT2A 1SNMA 4IPCA 4FF4A 2JE6I 3G7LA 2NVQB 3I4MG 2F0NA 3C0MA 5CMDA 1QVGA 1E22A 1BOSA 3P1HA 1QE6A 1BBUA 5IP7H 4CKEA 3DUZA 1AFPA 3ZYYX 5C4JB 1UE7A 3G6EA 3HOXG 1Y1WB 4HCSA 2MNAA 1ONLA 4TKOB 1ENFA 4HMIA 5C3EG 4A3BH 3RNUA 3STBC 4DF7A 4ZK9B 1XWEA 3PO2B 3W2DA 3H91A 3FHWA 1DXMA 3K59A 3S16B 1KXLA 1L0YB 1PZID 2CVRA 4V0BA 1LTLA 3IRBA 2PNHA 5AFWA 1TU2B 1Q82C 1IHZA 2EYLA 1J5EQ 4NB3A 1OXXK 4BBRG 3MAQA 4NP5A 3BDOA 4LF5L 2NUCA 4P75A 2UUBL 3LWEA 3D4DA 3ULPA 1X55A 2FFKB 3OTOL 1TXYA 3C2PA 3EBEA 3K7AH 5G3LD 1WOCA 1A3VA 2HIXA 3CKIB 4IOCA 4IFDJ 3S2DB 1MSHA 4DK0A 3Q0AA 3HG9A 4IALA 3GDEA 1C0AA 1TWGB 1VF5C 2HQLA 3PQIA 1S3OA 2VY3A 2E75C 3SK5A 2F52A 3QJYA 2Z0SA 1R9TH 5LMNL 4ZCKA 1YJWA 5FLMG 1EY6A 1OO9B 2NZOA 4PZ6A 2WIIB 4JI6L 1JCKB 1QG7A 1A0IA 2OEOA 4JPBW 4XXEA 2R7FA 1NMGA 4Z9CB 3M9BA 2V1CC 4A3EG 3NQTA 3MXUA 1LTID 1HHVA 4LUZA 5FJ8G 1WD0A 1VQDA 2D0PA 3RN2A 4GKKQ 2WFWA 1W6JA 3AFPA 1VQBA 2FMCA 2F0EA 3ERSX 4A3DB 1PRTD 4JI8L 2I5MX 3OIQA 1IBLL 4GN4B 1AN8A 3QOLA 3HOWH 3I4LA 1YJ9A 3WOEA 4X62Q 1PH7A 4IUPA 1XNRQ 2LFNA 4BA2I 1J6QA 1KTKA 2PMZE 3HEJA 4NMZA 4UY8C 3L7ZC 4N8FA 3L2PA 4LF6L 4BY1B 1Y14B 2P5ZX 4LFAQ 2KCMA 4R4IA 1I94L 2KHSA 2NN6I 5HGTA 1D2BA 2C9OA 2PQEA 2EE1A 5JPNC 2E2HH 2YYZA 1V1OA 4DV0Q 1WYDA 3SK8A 4IPHA 2XSCA 2WKCA 2NVTH 2R6GA 1SYEA 3HOUG 3M7GA 5C44H 2FXQA 2F0DA 3QO2A 4B3TL 4UP7A 4LF8Q 1PDQA 4X3TA 3HS0C 1PH8A 4DV4Q 3F2UA 5GROA 4U673 1STYA 1HR0W 5J3BA 1N34L 3CXCA 1RTNA 4XDXA 1HR0Q 2JA5H 2UXDL 3MXNA 5CV8A 3JAMc 2HCCA 2F1MA 1I4QA 4A3GG 5EGTA 4LJZC 4FVMA 3TRZA 1KAAA 4HIOA 4LUVA 3E0EA 3STBD 1RD9D 2EIFA 3DEPA 2Z6KA 5C4XH 3PIO3 4A3MG 2A74C 2F4IA 4PV1C 1OXVA 1Z6HA 1FVIA 2Q2HA 1JWMD 4AYBG 4APVA 2K1BA 2R7ZG 2IX1A 1IL2A 1E24A 1DJRD 2CWAA 4RWSC 1EYGA 1FYCA 4XYQA 3S15H 1D7QA 3J7A5 1PZJD 4LF5Q 1MI2A 1QUQA 4KD3A 4F87A 3J81i 2UUBQ 4RFBA 1ENAA 3HOYH 3F8TA 2QW7A 3M3YH 1BDOA 2L9HA 1CSPA 5A2QE 1VQGA 3EIVA 1Q1BA 1GUTA 3J80E 1SFOH 1TQOA 3CPFA 1JB3A 1GD7A 4OHJA 3VYSA 4BY7H 4OO1I 4R1JA 5LMUL 3S1MH 1K8AC 4JBWA 5ELFA 2O2LD 2LSSA 2RDGA 1C4QA 4BS9A 1XTDA 3A5ZB 5BR8L 1VS0A 3L0OA 5FKAC 4NPSA 5M5WB 3DM1A 3BJUA 1I4XA 2R92H 4Y7NH 5LMNQ 3J7AV 2D2CC 3T13A 1M8AA 1VQFA 1VQ9A 2RDFA 3GTMH 2PQAA 4BXXH 4R4OA 4JI6Q 3KF6B 1CHPD 1JE5A 3WWVA 1S5ED 5HGQA 5G3LF 4K6LA 5H1SE 1CTMA 1I50H 3GTJH 2ZTDA 2B2TA 2OCEA 2RSOA 3I4OA 4X65L 5CV6A 3U58A 4PQXA 5ELEA 5IYBH 5GAGC 2G9HD 1IYJB 3TDQA 4JI8Q 3E6ZX 2JA8H 2WAQE 2Y0SB 3R8BA 2CW0D 1AW7A 1TIID 4K2KA 3A56A 5M3FB 4MNOA 2HDMA 1SEBD 3CCUA 2VQFL 4GS3A 5IIFA 4DV5L 4HIDA 4AYBE 4DA2A 4HJAA 3AMUA 4LF6Q 4A3FH 2IW3A 1I94Q 3VYRA 3BZCA 4XIGS 2AHOB 1ZYRD 4OX9Q 1EY9A 4RHRA 4O2DA 3T1HL 4YWMA 3J81L 5DEHA 2JA7H 5D3IB 1SROA 3V96A 1IW7D 3NWSA 1JWSD 3H15A 2B39A 3TZDA 4DAPA 1PYWD 4IJHA 3HOZB 3A0JA 1WTPA 1YI2A 1YJNA 5I4DA 2OWOA 3GTGB 1UWVA 1MJCA 2PW5A 1VQAA 4A4IA 4GOPA 4C1NI 5KYLA 3F1ZA 4C56C 4XT1B 2UXDQ 1WTVA 2RKSA 2EQSA 1N34Q 5DM73 4CKBA 4YIJA 4DR2L 1XMOL 1TY2A 2JN4A 3W1GA 1TWCH 2B2WC 4KMUC 4C3JG 1CA6A 3DLLA 1JT8A 5EKLA 4H0LC 2I0QA 3M4OB 4A93B 1MGSA 4QGUA 4UDUC 1HRJA 2KCCA 4UPAA 1D5ZC 2PZUA 3PO3B 3I4NH 1KLUD 3RUZA 4WJ3M 4V190 2RCFA 4DV1Q 3VR3A 1SAPA 3DWAA 2MP1A 1ML0D 2VS1A 5EKKA 2A6ED 1VQCA 1PH6A 3MFGA 4XQNA 1KNAA 1BBWA 1JJCB 2XRQD 5C0XG 1H9MA 4A3JB 4KHVA 1LT6D 1TWHB 4FF3A 3A8KE 4IO9A 5CV4A 5EAYA 2K5VA 3NELA 1VQEA 1B9NA 1C48A 5TSSA 1FL0A 4A3IB 4JBKA 4EQNA 1X3EA 3I2ZA 1ESRA 5FO9B 1QJOA 2ALYB 2EYMA 4G4KA 1GM5A 1BBXC 1CZWA 1U4MA 4DU9A 5BR8Q 4G7OC 5IGCA 2RF4A 4RA8A 5DAUA 1LTBD 1PH5A 1XNQL 4DN4M 4KHPL 3BVMA 1STHA 3VR2A 4HSVA 1SNCA 2JQOA 2PO4A 4CJ2C 1QB5D 2GVBA 2Z4IA 2K75A 4FXDA 4DR3L 2F3VA 1E1TA 4JI4L 2AUKA 1LO5D 3VR5A 1KIXA 1IL8A 1ASZA 4L5SA 1QZGA 1EL0A 1O7YA 3CAMA 1V1PB 1I5FA 5C5LA 1YIJA 3G6JB 4OEMB 1YITA 1AZQA 3M7NA 3GTPB 3MTSA 2ASBA 1EQRA 1G51A 5L37A 4O0AA 3K5MA 1B1ZA 3R93A 4WJ4A 1DZ1A 1K73C 2VUMG 3JAME 3RMHA 3BDCA 1AH9A 4H02A 1RKNA 3P7JA 4QUCA 1KLGD 3MC0B 3GTQB 4C3IG 1I3QH 4DV5Q 4KJOA 2YU9H 3D0FA 1V1QA 5M3MB 3G4SA 1Y1VG 1Y1VH 3NTIA 2QCPX 4CKCA 2K5NA 4U68A 1SDFA 4C3HG 1N32L 3T1HQ 2L5TA 1SE8A 1HNZQ 1ICWA 2DY8A 2UXBQ 1GUGA 1LABA 1G6PA 2RA4A 2R93B 5E4WC 2CHBD 4J8QA 1O7IA 1VF7A 4EQPA 1MBYA 2KA7A 2A69C 3K0XA 4DUZL 1SNPA 1NCVA 1KRTA 1KABA 3SEBA 4BBSB 4PZ8A 4EGVA 2RDHA 1Q46A 4QJFA 1EWCA 1Y8NB 2O5IC 1TWAH 3Q6SA 2CH4W 2LXKA 2EJFC 1N33Q 1EYDA 1K8MA 4JI7L 4LFBL 3SGIA 1Y1WG 3JC66 4DR2Q 1XMOQ 4DK6C 5IYDH 3T16A 1DONA 1PV4A 1B53A 1XX8A 4K14A 3PUWA 1CZGA 1LTSD 2MHVA 1HA5A 4JOIC 3SVMA 3PO2G 2Z8LA 5K36G 2VW9A 4OWWB 1SJED 4O1NA 1EFWA 3FVQA 2UXCL 2ES2A 2EPBA 3P20A 1K8OA 5CV9A 4DXFA 1UE1A 4FNFA 4A3KB 4IFDG 3QG1A 1I6HH 1LTAD 1U0LA 1BO0A 3S2HB 2KHJA 2A6HC 2K7VA 3GTOB 5ELOA 3I7FA 3FKIH 3SHLA 4HTHA 2R7DA 2N55A 5BN3A 2JA6H 1FGUA 5CV5A 2Q8TA 1TT2A 2EYPA 4J15A 2HUGA 4DV7Q 3PF5A 1EWHA 4KY6A 3QR8A 1OXSC 3KYHC 3GV3A 4N8X1 3TREA 1FR3A 2F0PA 1C9OA 5J22A 2F4VL 1HZAA 4CHTB 2IX0A 4BWGB 2EYOA 4C1NK 3BU2A 3UDGA 1P8LA 1C8CA 3CQZH 2ZXOA 3A7LA 3IL8A 2JEBI 3R2TA 3RLOA 4QUFA 4OELB 4DFAA 5I9PA 4DV3Q 5D65A 2HQEA 4RG1A 1NAPA 2EOTA 3KBGA 1HZ9A 5FLXc 4JI1L 2B63H 1PMRA 4YHHL 4ZQ3A 5KYIA 4KHPQ 1A3TA 3RLFA 5IYCH 2HHHL 4B9XA 5ELBA 4PNYA 1ASYA 3H0GB 2BE5C 4A3DG 2A68C 4IUVA 4L5QA 2R3ZA 1R4QB 2KEEA 2JP1A 3OHXC 1PRTB 4XYOA 2I46A 3ITPA 4B3SL 3HOVH 3AB9A 3H09A 3KF6A 4BY1G 2WB1B 1PFNA 3CCRA 3QOJA 2NB0A 1WCMH 1GUOA 4DV2L 2K50A 3NXWA 1VQ6A 2EXDA 1D8LA 5JJLA 3I4MH 3V2TA 2B2YA 4X6AH 1K83H 4KY7A 2PI2E 2L1BA 2E74C 2B3GA 5LL6S 1L1OB 1HUMA 2HIVA 5BN5A 4IUTA 3GTKB 1IZ6A 5GAEC 3HOXH 1Q7YC 3X3NA 4GNXB 3J7AF 1RCVD 5C3EH 1PFMA 2HD3A 2Q8IB 3T4AC 1I4RA 4DUZQ 4G7HC 1V8QA 4K5VA 2D5DA 4IN3A 2AWOA 1S40A 1K8GA 1HNXL 3S9WA 2Q2UA 4KKTA 3DXJC 4LFBQ 4BBRH 2NTTA 5IP9G 2DN8A 5M5YH 3Q24A 3K5OA 5EKIA 3VR6A 3TP5A 4DR4L 2L4NA 4KTAA 3SK6A 1HPCA 4MHEA 1QZHA 3MFYA 2I07B 1FNVA 3J80i 4PMWA 1I4GA 4CJ0B 5CGKA 4JI2L 1PTOC 4ID6A 3KF8B 2ATWA 3A54A 5GADC 4P72A 3S1RH 2K32A 3NENA 2DNEA 1U9RA 1KDCA 2DJGC 4R8IA 4C2MH 5FLMH 2ZJPA 4UP8A 3OW7A 4P74A 2YTXA 1SYGA 1B8AA 1SNQA 1F2ZA 2V4DA 3PIP3 1WTOA 3G71A 4A3EH 2F4VQ 4DKAC 5FJ8H 1CKMA 4LNQA 3VA5A 1NR4A 1VQJA 4TSSA 2LKVA 4CDEC 1UAPA 2AMCB 1CKOA 1PTOB 4LF7Q 1FJGL 1E2ZA 3PIPA 4YCWA 4JV5L 1ET6A 1DOMA 5EBDA 3T51B 2HDLA 2F03A 2EY5A 1A63A 4AQYL 2K5WA 4JI1Q 3CCVA 4QMGA 4YHHQ 3NBIA 4DXGA 2Z6BA 1G6ZA 2CQOA 2X6GA 3PV0A 2IHFA 3HKZG 2BE5D 1EEFD 5M5XH 4A3CG 1W6KA 4MIUA 1WTXA 4QB4A 1K9MC 3VYUA 2Y0SG 2AQ2B 5M3FG 4X64Q 1PYBA 3TP6A 2K4KA 1G91A 1WD1A 4B3SQ 3HOUH 1A62A 1BCPC 2ZT9C 3T1YQ 5BN4A 4R9WA 4B3RL 2N49A 4IUUA 5A2QL 1GHKA 4O42A 2VQEQ 2VL6A 3J80L 4I7ZC 4J1MA 4LUOA 4POFA 5FOBB 1V1PA 3ND9A 1STNA 1LTGD 2KVMA 1ZXTA 1KD1C 1FNUA 2IJ0A 4BA1I 3GP7A 1MIUA 1Z47A 1F9PA 1IYVA 3NE5B 3HOZG 3GTLH 4A3GH 2B2UA 2SNSA 3O13A 1XJVA 4ZYSA 2J4XA 1HCZA 1CFMA 1QCBD 3PCOB 2F0KA 4LAAA 3S24A 1Q1EA 4A3BB 1PREA 1EIFA 1YHAA 1NE3A 3TP7A 5K5PA 3C1EA 2F3IA 1XXGA 1A15A 3UI2A 4A3MH 1SMYC 3FP9A 2SDFA 1M90C 1WI5A 2JK8A 1RDPD 3F2CA 4R4CA 4UP9A 2O5JC 2R7ZH 2CH4A 1EU3A 3WOFA 2LY7A 1YZ6A 4I7AA 3N52A 4KKUA 4JI5L 3H6MA 4A93G 4CDFC 4QCLA 1AP0A 4QQBX 4JG2A 4UAIA 5C3XA 1U5KA 3OTOQ 3PO3G 3IFTA 3OW2A 3I3CA 4DR4Q 1V9PA 3K7AB 4X66L 2I5HA 4WFN3 1VQLA 1D1KA 5J39A 3GV6A 1Q90A 2G5DA 2J0TD 3S1QH 3KK7A 2AQ1B 4RGMA 2KEDA 1SYBA 5F2DA 3ONAB 1CT1D 1PTOD 4JI2Q 3CCMA 2PYKA 4A3JG 1PFSA 3OMCA 1JOKA 5JEAG 3E5SA 1KL9A 2HCIA 5C4HA 1R9TB 1H9SB 2SNMA 1JJGA 2B2VA 2LMCB 3CCSA 4JYAL 5LMNW 1K28A 2A19A 1IYUA 1JR0D 2E5LL 4QIWB 2OQKA 1S4ZA 4A3IG 1XYIA 4KN7C 1UUPA 1TVXA 2XVSA 2D0OA 2AUJD 1I6VC 3KDFB 1DD2A 2OTJA 4DAVA 3OYYA 4QL5A 1PXUA 3NTKA 2EYHA 2Z9HA 3I91A 2YV5A 2NVXH 3HKZB 1IBML 3A7AB 4RHSA 3HZXA 5JJIA 1SYCA 1AE3A 2X6LA 2C35B 1FJGQ 2L11A 1IBLQ 4JV5Q 3HOWB 1B4OA 1E7ZA 1AEXA 4RGOS 1WFQA 2QDBA 3HRZC 4GN3B 1EUJA 2K33A 3IAYA 1VDZA 4AQYQ 1HA6A 1CI3M 3CCEA 2ZTCA 2QGQA 3JAMi 2H5XA 1E3PA 2MO0A 1CSQA 4P73A 4XTCS 4XQJA 2E2JH 5IGGA 4OGQC 4B08A 3TZUA 3TS0A 5D3DA 3ICEA 1VQPA 1KHIA 2OXPA 3RZOH 5C4ZA 1D5XC 1VMPA 4DR7L 1HZCA 2UU9L 2E2HB 4ILWA 2PZTA 3AU7A 2G9DA 1EZ8A 2NYZD 4LW1A 5KIXA 1CA5A 1EEID 2F0JA 3MXGA 4EQOA 2NVTB 1PRTF 4JI0L 2KOLA 5EJWA 3QIAA 1Q8KA 1FGBD 4IOAA 1TWFH 4KI0A 1NY4A 3CW2C 5C44B 3KJPA 1PH1A 1XMQL 4B3TQ 4NXNL 5M3MG 1NTGA 1LM0A 1M1KC 2F0OA 3VDYA 2JA5B 1LYLA 1F9SA 3HP3A 1A8VA 5EPJA 1YHBA 5IT9c 2JXMB 4CDDC 2R93G 4AH6A 3CC2A 4C3JH 5KNDA 5IE8A 3D8GA 1EYCA 3C3LA 1BXTA 4YCUA 2ZJQA 5M9OA 1MKHA 4L5RC 2WAQB 3ULLA 3G4NA 4LF9L 5E4XA 3UE0A 1HQMC 3I72A 4BBSG 4RCNA 3RD4A 3PSIA 1V43A 2E2IH 5DNFA 2EJMA 5C4XB 1BUVT 1SMYD 1O7LA 1PFBA 1EY0A 4GZYC 4IURA 5EBCA 3D4RA 5JVG3 2UUAL 1L1OA 4DR5L 3S15B 5C0XH 4GNXA 1GO3E 1JJ2A 1N36L 2DUDA 3S17H 3RZDB 3HOYB 3JAML 2NZ1D 4A3KG 1X6OA 1UEBA 2WINB 3QB3A 5IWAL 3M3YB 5CC4A 2Q2IA 1RIPA 3S2HH 4X66Q 3CHBD 1PH4A 1KAWA 1B7YB 4HJ8A 1SFOB 4AIMA 3HKSA 4BY7B 3V05A 4K8JA 3MEHA 4X3SA 3BVZA 2K05A 5LMUQ 1VQ7A 3R3OA 5A35A 2QEXA 1VMCA 4HN7A 1N8RC 5JAVA 5EQ0A 2R92B 4Y7NB 1NJIC 1NR2A 2K01A 1LT3D 4DUYL 3IKJA 3VR4A 1VQIA 5D14A 3KJOA 3CCLA 3GTMB 2E5LQ 4YWKA 3FDTA 1Y69U 5EPKA 2Q2TA 2CWPA 4RMFA 3FMCA 2NVYH 3NHHA 1EY4A 1YEZA 3CP0A 1EIHA 1I50B 1K0SA 4JW0A 3KUPA 1S5CD 4K5XA 3NWTA 4X65Q 4KK7A 5I6YA 3H94A 1IBMQ 1PTOF 2NN6G 2X69A 2E2DC 1D5MC 2JA8B 1DM0B 4N9TA 2Z6KC 1OTCA 4B3ML 3CRKC 3FPPA 2VUMH 3OOCA 1GHJA 3H0GG 3OPOA 1TS5A 1MD2D 1TR5A 4KKSA 4QY7A 4OIJA 1J9OA 2VQFQ 3S1NH 3TS2A 4C3IH 4FP5D 2ENBA 4LMQD 3NBHB 2B8FA 2L15A 3A8JE 5IGEA 3S14H 3NEMA 4A3FB
chains in the Genus database with same CATH topology
5FO8B 3CRLC 1FD7D 2JA7B 4M8AA 2F0TA 4CGYB 2Z4HA 3FPUB 3I70A 3FEWX 1U4RA 2K6AA 2L0CA 4ME5A 4ULLA 4RGNA 2JEAI 1B44D 4KJNA 1E2WA 4TRDA 1EY8A 1GXDC 3T56B 5ELCA 2SOBA 1SYFA 1KDBA 1TWCB 3SK4A 1DYQA 2KQ3A 4XQQA 5C6AA 5ISRA 5K36H 4ZAIA 3BVGA 5C3WA 3K58A 2B2TC 1M4VA 1OXTA 4IFDH 3EJIA 4RKBA 3I4NB 1EFID 4RAUC 3MZ5A 1T5EA 2PW7A 4IQZA 1WTWA 4KY5A 1CHQD 1YNNC 4OO1G 1SBBB 2AWNA 3C0NA 2EY2A 4QF4A 3PUZA 1BR9A 2H1EA 1EY5A 1NUCA 4DNRB 2GA4B 1SE4A 4ABNA 4WRDA 2K5QA 2QF7A 2MGSA 2A73B 1VCIA 3U9SA 4MN3A 3D6CA 5E3FA 2ICEC 2IT1A 1I4HA 1SE2A 1I4PA 4TQUS 4G7ZC 1GJXA 1EZ6A 2C5CA 1CQVA 1JOQA 1YNJC 2BA0A 1HQRD 4N9PA 2FHTA 1TY0A 1H9SA 4G57A 4ZKCB 2EZVA 5I9OA 5C5MA 3VYTA 2EY6A 4H13C 2F0VA 1RTOA 2K28A 1RODA 1I3QB 5ELDA 2YU9B 2R61A 1STBA 2DNCA 3KLSA 2ZXRA 1Q8IA 4KN4C 1GUNA 3D3RA 1QWYA 3X3MA 3M85A 2FMMA 4RGTA 1RF2D 1DCZA 1CK1A 2A69D 1X3QA 5FO7B 1JC7A 3T53B 1TWAB 2VXWA 4IUQA 5DM63 1XTCD 1TS2A 3MHBA 3TBIB 1IKLA 2PCFB 4HMJA 1LLRD 5IGFA 1A3UA 2F0LA 1HXYD 4E6IA 1I6HB 5CYUA 1HTPA 1SJHD 3PUXA 4F8MA 1Q3LA 2A6HD 3R2IA 3DMUA 1GUWA 1QNUA 3FKIB 4HSPA 1X32A 3OMGA 1A2UA 1JQYD 1YNND 4NW2A 3I90A 3EQLC 2JA6B 3NP8A 3L3OC 2BA1A 3CU7A 2O4XA 1JWUD 4RKLA 5C0XI 2SEBD 1O78A 1CQFA 1O7ZA 3OSOA 3CQZB 3DWPA 3VA7A 2NWGA 2B2WA 1SNDA 4ZLTF 3MWYW 5HURA 2B63B 1WTRA 1DOKA 3KBXA 1DOLA 2BDNA 2F0FA 2D62A 5NUCA 1YNJD 2EDGA 4FYDA 1WVLA 2A68D 1S5FD 1MSGA 1IKMA 2CW0C 2CQAA 2K03A 4WORA 2ICIA 2F0SA 2M9VA 2F0GA 3HOVB 5IODA 1U4LA 3MA2B 4OL7A 1Z7TA 1WCMB 1B3AA 1ZYRC 1F77A 1EOTA 3PUYA 5FLXL 1ESFA 2L12A 1SSOA 3I4MB 5J1ZA 1F9QA 1K83B 1IW7C 1HFGA 3LNNA 2KECA 1SXTA 2IPKD 1U4PA 4F7XA 3HOXB 3A8IE 5I6WA 2OF1A 4K8IA 2ZXPA 3BZDB 5C3EB 4M1UB 2EYJA 1BCPB 5CV7A 3NBHA 4LK1C 4R8NA 2PMZB 1QILA 3EVQA 3C1FA 2L55A 2VB2X 4KD4A 4B9WA 2EVBA 4BBRB 2IX3A 5M5YB 4ZKBB 3TMEA 5LL6X 1KDAA 3K5NA 1JOOA 2F0WA 4NDXA 2XNAC 1STGA 1G2SA 1EQVA 2DY7A 1EU4A 1AZPA 2A6EC 4WJWA 5FLXE 3SDZA 3GD7A 2EJGC 2XN9C 3J7YW 3IFDA 3LX0A 4IFDI 5JEAH 4Q5VA 3DHQA 3S1RB 3URYA 1S5DD 4C2MB 1NSNS 4DGZA 1LT5D 3EA6A 5KNBA 3SR1A 4IUNA 1E0BA 1F2YA 3FRPB 2B2YC 3TP8A 2E76C 1LT4D 1J8IA 4A3EB 1A2TA 1EY7A 2B8GA 3BS1A 2D9UA 1TS4A 1QOHA 5KEEA 4X3KA 3I8ZA 1UEAB 2PNRC 4NKLA 2IL8A 5T1IA 3SXHA 2KJXA 5IGDA 1JICA 3NK9A 4PMBA 3C46A 1Q12A 1WTQA 5IGBA 1EQTA 1Y8OB 4S3SA 3U9OA 5M5XB 3BYYB 4DAYA 2M2LA 5CBAE 2F0MA 2QEJC 1HTLD 4IZ8A 4X3UA 1B50A 3KLRA 3HOUB 2WACA 2Z1CA 1TS3A 1BCPD 2PZWA 1STEA 3D4WA 5IOCA 1S5BD 5CR3A 1G8ZD 1B2TA 2RQXA 2BDOA 3M4YA 5KGUA 2KCNA 3Q23A 1GUSA 1SNOA 2TMPA 4P2CB 5FK9C 1FNWA 3GTLB 3H3VC 1BNZA 4A3GB 2F0HA 1ZEQX 1QNKA 3ND8A 4ODGA 3BG3A 4H44C 3PMFA 4HR7B 4A3MB 1X3PA 4FXGC 1F2MA 2Q8RE 1H9KA 5I2YA 2XIWA 2F0QA 4AYBB 2R7ZB 3A55A 5COYA 3OWFA 3K5LA 5EPLA 1TKWB 4PMCA 3W3AA 4ZUIA 5CORA 1F2LA 3PUVA 4FF1A 2RSNA 4DNTB 4ZRZA 3NUCA 3S1QB 1LACA 1F9RA 2MPMA 2H4OA 4H7BA 3J81E 3S1MB 1JORA 3N6RA 5KRUA 1G2TA 1Y8PB 2MJ8A 2WKDA 1G291 5JEAJ 1BQQT 3KF8A 3OWEB 3GTJB 1R4PB 2B2UC 3TSSA 2NVXB 4KV6A 3NSWA 3QWNA 1UNSA 2NN6H 1T5XD 3E0JA 2JSOA 2NBFA 4DK1A 2ID0A 3EFXD 1ILPA 2E2JB 4HEDA 3L9AX 5JJZA 2VNUD 3RZOB 1H9JA 1GOZA 1D6EC 4RCOA 4HAEA 4I65A 1RHPA 2WV6D 3TN2A 2F0UA 4FF2A 4L6TB 4KHZA 4K5WA 2N88A 5T1GA 1TWFB 2XWJB 3BYTB 1JE4A 4K6DA 2EXZA 1LTTD 2K04A 4Q0FA 4HCEA 1LV9A 2FINB 3K57A 3G4OA 2VB3X 1OXUA 2B2VC 2XRSD 2WP8J 2QILA 4CJ1B 4C3JB 3MVVA 2PPBC 4EVOA 3DWQA 2F0IA 4L63B 1H9RA 2BCOA 2E2IB 3LWUA 1CM9A 1BCPF 2AQ3B 4FO2A 3SE0A 3MXPA 5I2XA 1Z52A 2EY1A 3K0YA 1E2VA 3NPPA 2RBMA 3I73A 3WDNA 4ZUJA 4OO1H 4J6HA 4OIKA 3C0OA 3K6OA 2TSSA 3EROA 1EYAA 3S17B 1PLFA 5IT9L 5JPMC 3NTHA 5CBEE 1A6XA 5C0XJ 2FJ2A 2M00A 2XWBB 3D31A 2K5DA 2IWHA 1B9MA 4F88A 1PZKD 4L8JA 5LHY1 3P75A 1II3A 1SE3A 2MUYA 1L0XB 1BF4A 2NVYB 1PTOH 1PRTC 3KLSX 2QKIC 1LTRD 3BDLA 2RVLA 4K2LA 1D1IA 4JK1C 2J7ZA 1ILQA 3HGBA 4RH6A 1KNEA 3Q22A 3ERQA 3NQIA 4CBVA 2VUMB 3DEOA 1STAA 2NTSA 5JOBA 5KNCA 5IT9E 1O80A 1ZKOA 2A5HA 4XT3B 2LS01 5E1FA 1SYDA 1RJTA 2BOSA 3S1NB 2JYOA 1HFNA 4C3IB 2EYFA 1ENCA 3S14B 2KUMA 3D6WA 1HUNA 1Y1VB 2F3WA 4C3HB 1EIGA 3OIPA 4FXKC 1ET9A 5JVH3 3GO5A 3GQBA 2OT2A 1SNMA 4FF4A 2JE6I 3G7LA 2NVQB 2F0NA 3C0MA 5CMDA 1BOSA 3P1HA 1QE6A 4CKEA 3DUZA 1AFPA 3ZYYX 5C4JB 1Y1WB 4HCSA 1ONLA 4TKOB 1ENFA 4HMIA 4DF7A 4ZK9B 1XWEA 3PO2B 3W2DA 3H91A 1DXMA 3K59A 3S16B 1L0YB 1PZID 2CVRA 4V0BA 5AFWA 1TU2B 1IHZA 2EYLA 1OXXK 3MAQA 4NP5A 3BDOA 2NUCA 3LWEA 3D4DA 2FFKB 3C2PA 5G3LD 1A3VA 3CKIB 4IFDJ 3S2DB 1MSHA 4DK0A 3Q0AA 3HG9A 4IALA 1TWGB 1VF5C 2E75C 3SK5A 3QJYA 1EY6A 1OO9B 2WIIB 1JCKB 1QG7A 2OEOA 4XXEA 4Z9CB 3NQTA 3MXUA 1LTID 1HHVA 1WD0A 1W6JA 2FMCA 2F0EA 4A3DB 1PRTD 3OIQA 1AN8A 3QOLA 3I4LA 3WOEA 4IUPA 2LFNA 4BA2I 1KTKA 3HEJA 4NMZA 3L7ZC 4BY1B 2KHSA 2NN6I 5HGTA 1D2BA 2C9OA 2PQEA 2EE1A 5JPNC 2YYZA 1V1OA 3SK8A 2XSCA 2WKCA 2R6GA 1SYEA 3M7GA 2F0DA 3QO2A 1PDQA 4X3TA 3HS0C 3F2UA 4U673 1STYA 1RTNA 4XDXA 3MXNA 5CV8A 2HCCA 2F1MA 1I4QA 5EGTA 4LJZC 4FVMA 1KAAA 1RD9D 3DEPA 3PIO3 2A74C 2F4IA 4PV1C 1OXVA 1Z6HA 1JWMD 2K1BA 2IX1A 1DJRD 4RWSC 1FYCA 4XYQA 1PZJD 1MI2A 4KD3A 4F87A 4RFBA 1ENAA 1BDOA 2L9HA 5A2QE 1Q1BA 1GUTA 3J80E 1TQOA 1JB3A 3VYSA 4OHJA 4OO1I 4JBWA 5ELFA 2O2LD 2RDGA 1C4QA 4BS9A 5FKAC 5M5WB 3DM1A 1I4XA 3J7AV 2D2CC 3T13A 1M8AA 2RDFA 1CHPD 1S5ED 5G3LF 4K6LA 1CTMA 2B2TA 2RSOA 5CV6A 4PQXA 5ELEA 2G9HD 3TDQA 3E6ZX 2Y0SB 3R8BA 2CW0D 1AW7A 1TIID 4K2KA 3A56A 5M3FB 2HDMA 1SEBD 5IIFA 4DA2A 3AMUA 2IW3A 3VYRA 4XIGS 1ZYRD 1EY9A 4RHRA 3J81L 5DEHA 5D3IB 3V96A 1IW7D 3NWSA 1JWSD 2B39A 3TZDA 4DAPA 1PYWD 3HOZB 1WTPA 5I4DA 3GTGB 2PW5A 4C1NI 5KYLA 4C56C 4XT1B 1WTVA 2RKSA 5DM73 4CKBA 4YIJA 1TY2A 4C3JG 2B2WC 4KMUC 1CA6A 5EKLA 4H0LC 3M4OB 4A93B 1MGSA 1HRJA 4UDUC 2KCCA 1D5ZC 2PZUA 3PO3B 1KLUD 3RUZA 4V190 3VR3A 1SAPA 3DWAA 2MP1A 1ML0D 5EKKA 2A6ED 3MFGA 4XQNA 1KNAA 2XRQD 5C0XG 1H9MA 4A3JB 4KHVA 1LT6D 1TWHB 4FF3A 3A8KE 5CV4A 1B9NA 1C48A 5TSSA 4A3IB 4EQNA 5FO9B 1ESRA 1QJOA 2EYMA 4G4KA 1BBXC 1CZWA 1U4MA 4DU9A 4G7OC 5IGCA 4RA8A 5DAUA 1LTBD 4DN4M 3BVMA 1STHA 3VR2A 4HSVA 1SNCA 2PO4A 4CJ2C 1QB5D 2Z4IA 4FXDA 2F3VA 2AUKA 1LO5D 3VR5A 1IL8A 1EL0A 1O7YA 1V1PB 5C5LA 3G6JB 1AZQA 3M7NA 3GTPB 3MTSA 3K5MA 1B1ZA 3R93A 1DZ1A 3JAME 3RMHA 3BDCA 1RKNA 3P7JA 4QUCA 1KLGD 3MC0B 3GTQB 4C3IG 4KJOA 5M3MB 3NTIA 2QCPX 4CKCA 4U68A 1SDFA 4C3HG 2L5TA 1ICWA 2DY8A 1GUGA 1LABA 2RA4A 2R93B 5E4WC 2CHBD 4J8QA 1VF7A 4EQPA 1MBYA 2KA7A 2A69C 1SNPA 1NCVA 1KABA 3SEBA 4BBSB 4EGVA 2RDHA 1EWCA 1Y8NB 2O5IC 3Q6SA 2EJFC 1EYDA 1K8MA 3T16A 1DONA 1B53A 1XX8A 4K14A 3PUWA 1CZGA 1LTSD 2MHVA 1HA5A 3SVMA 2Z8LA 5K36G 1SJED 4O1NA 3FVQA 2EPBA 3P20A 1K8OA 5CV9A 4DXFA 4FNFA 4A3KB 4IFDG 3QG1A 1LTAD 1BO0A 3S2HB 2A6HC 2K7VA 3GTOB 3SHLA 4HTHA 2N55A 5BN3A 5CV5A 2Q8TA 1TT2A 2EYPA 2HUGA 1EWHA 4KY6A 1OXSC 3GV3A 1FR3A 2F0PA 5J22A 4CHTB 2IX0A 4BWGB 2EYOA 4C1NK 1C8CA 2ZXOA 3A7LA 3IL8A 2JEBI 3R2TA 4QUFA 4DFAA 5I9PA 5D65A 2HQEA 1NAPA 2EOTA 3KBGA 1PMRA 4ZQ3A 5KYIA 1A3TA 3RLFA 4B9XA 5ELBA 4PNYA 3H0GB 2BE5C 2A68C 4IUVA 2R3ZA 1R4QB 2KEEA 2JP1A 3OHXC 1PRTB 4XYOA 2I46A 3ITPA 3AB9A 3H09A 2WB1B 1PFNA 3QOJA 2NB0A 1GUOA 3NXWA 3V2TA 2B2YA 4KY7A 2L1BA 2E74C 5LL6S 1HUMA 5BN5A 4IUTA 3GTKB 3X3NA 3J7AF 1RCVD 1PFMA 2Q8IB 3T4AC 1I4RA 4G7HC 1V8QA 4K5VA 2D5DA 4IN3A 2AWOA 3S9WA 4KKTA 3DXJC 2NTTA 2DN8A 3Q24A 3K5OA 5EKIA 3VR6A 3TP5A 2L4NA 4KTAA 3SK6A 1HPCA 4MHEA 3MFYA 2I07B 1FNVA 4PMWA 1I4GA 4CJ0B 5CGKA 1PTOC 4ID6A 3A54A 2K32A 2DNEA 1U9RA 1KDCA 4R8IA 3OW7A 1SYGA 1SNQA 1F2ZA 2V4DA 3PIP3 1WTOA 3VA5A 1NR4A 4TSSA 2LKVA 1UAPA 1PTOB 1E2ZA 1ET6A 1DOMA 5EBDA 3T51B 2HDLA 2F03A 2EY5A 2K5WA 4QMGA 3NBIA 4DXGA 1G6ZA 2X6GA 3PV0A 2BE5D 1EEFD 1W6KA 4MIUA 1WTXA 4QB4A 3VYUA 2AQ2B 3TP6A 1G91A 1WD1A 1BCPC 2ZT9C 5BN4A 4R9WA 4IUUA 5A2QL 1GHKA 4O42A 3J80L 4I7ZC 4J1MA 5FOBB 1V1PA 3ND9A 1STNA 1LTGD 2KVMA 1ZXTA 1FNUA 2IJ0A 4BA1I 3GP7A 1Z47A 1F9PA 1IYVA 3NE5B 2B2UA 2SNSA 3O13A 4ZYSA 2J4XA 1HCZA 1CFMA 1QCBD 2F0KA 4LAAA 1Q1EA 4A3BB 1PREA 3TP7A 5K5PA 3C1EA 1XXGA 1A15A 3UI2A 1SMYC 2SDFA 1RDPD 2O5JC 1EU3A 3WOFA 2LY7A 3N52A 4KKUA 3H6MA 4QCLA 1AP0A 4UAIA 5C3XA 3IFTA 3I3CA 3K7AB 4WFN3 1D1KA 5J39A 3GV6A 1Q90A 2J0TD 3KK7A 2AQ1B 4RGMA 2KEDA 1SYBA 5F2DA 3ONAB 1CT1D 1PTOD 2PYKA 3OMCA 1JOKA 5JEAG 3E5SA 2HCIA 5C4HA 1R9TB 1H9SB 2SNMA 2B2VA 2LMCB 1IYUA 1JR0D 4QIWB 1S4ZA 1XYIA 4KN7C 1UUPA 1TVXA 2XVSA 2AUJD 1I6VC 1DD2A 4DAVA 1PXUA 3NTKA 2EYHA 3I91A 3HKZB 3A7AB 4RHSA 3HZXA 1SYCA 2X6LA 2L11A 3HOWB 1B4OA 4RGOS 1AEXA 2QDBA 3HRZC 3IAYA 2K33A 1VDZA 1HA6A 1CI3M 4XTCS 4XQJA 5IGGA 4OGQC 4B08A 3TZUA 5D3DA 2OXPA 5C4ZA 1D5XC 1VMPA 2E2HB 4ILWA 2PZTA 3AU7A 2G9DA 1EZ8A 2NYZD 5KIXA 1CA5A 1EEID 2F0JA 3MXGA 4EQOA 2NVTB 1PRTF 2KOLA 5EJWA 3QIAA 1FGBD 4KI0A 5C44B 2F0OA 2JA5B 1F9SA 3HP3A 5EPJA 2JXMB 5KNDA 3D8GA 1EYCA 3C3LA 1BXTA 5M9OA 2WAQB 3G4NA 5E4XA 1HQMC 3I72A 4RCNA 3RD4A 1V43A 5DNFA 2EJMA 5C4XB 1BUVT 1SMYD 1O7LA 1PFBA 1EY0A 4GZYC 4IURA 5EBCA 3D4RA 5JVG3 3S15B 5C0XH 3RZDB 3HOYB 3JAML 2NZ1D 2WINB 3QB3A 3M3YB 5CC4A 3CHBD 1SFOB 4BY7B 3V05A 4K8JA 3MEHA 4X3SA 3BVZA 2K05A 3R3OA 5A35A 1VMCA 4HN7A 5JAVA 5EQ0A 2R92B 4Y7NB 1NR2A 2K01A 1LT3D 3IKJA 3VR4A 5D14A 3GTMB 3FDTA 1Y69U 5EPKA 3FMCA 3NHHA 1EY4A 1EIHA 1I50B 3KUPA 1S5CD 4K5XA 3NWTA 4KK7A 5I6YA 3H94A 1PTOF 2NN6G 2X69A 2E2DC 1D5MC 2JA8B 1DM0B 4N9TA 3CRKC 3FPPA 3OOCA 1GHJA 3OPOA 1TS5A 1MD2D 1TR5A 4KKSA 4OIJA 1J9OA 4FP5D 2ENBA 4LMQD 2B8FA 3A8JE 5IGEA 4A3FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENF A;  3TSS A;  1EWC A;  1JQY D;  1BCP D;  1LT6 D;  1TS3 A;  1QIL A;  1S5E D;  1CQV A;  1V1O A;  2AQ1 B;  1FD7 D;  4RGM A;  3G4N A;  1STE A;  4K6L A;  3W2D A;  1ET6 A;  1CT1 D;  1PTO D;  1UNS A;  1HQR D;  1L0Y B;  1S5B D;  1JWU D;  1PZI D;  1G8Z D;  1LTS D;  1TY0 A;  1HA5 A;  4DXG A;  5ELE A;  2Z8L A;  2SEB D;  1T5X D;  2G9H D;  5TSS A;  1SJE D;  4O1N A;  3R8B A;  1AW7 A;  5FK9 C;  3EFX D;  1EEF D;  1JR0 D;  1PZK D;  1FNW A;  2XNA C;  1SEB D;  4DXF A;  3DWP A;  4RGN A;  1RCV D;  1UUP A;  1B44 D;  1GOZ A;  2AQ2 B;  1LTA D;  1SE3 A;  1EU4 A;  1D6E C;  1L0X B;  1I4Q A;  2RDH A;  4RCO A;  1LTB D;  5ELC A;  3BVM A;  1I4R A;  1PTO H;  1PRT C;  3KLS X;  5ELD A;  1BCP C;  1DYQ A;  1LTR D;  2R61 A;  2XN9 C;  4RHR A;  3CHB D;  2WV6 D;  4RHS A;  3URY A;  4L6T B;  1RD9 D;  3V05 A;  1S5D D;  5D3I B;  1LO5 D;  4RH6 A;  3BYT B;  1LT5 D;  3BVZ A;  1JWS D;  3EA6 A;  4RGO S;  3BVG A;  2NTT A;  1V1P B;  1LTT D;  1V1P A;  1PYW D;  1S5F D;  1M4V A;  1JWM D;  4RGT A;  3G4O A;  1LTG D;  1RF2 D;  1FNU A;  2NTS A;  4BWG B;  2IJ0 A;  1EFI D;  3GP7 A;  5I4D A;  1DJR D;  1LT4 D;  2XRS D;  1CK1 A;  1B1Z A;  2ICI A;  1LT3 D;  1JCK B;  2QIL A;  5D3D A;  3R2T A;  1PZJ D;  1D5X C;  1CHQ D;  3O13 A;  4C56 C;  4ZYS A;  1TS4 A;  2J4X A;  4Z9C B;  1SBB B;  1FNV A;  4RFB A;  1LTI D;  3C0N A;  1I4G A;  1TY2 A;  1PRE A;  1KLG D;  1PTO C;  1XTC D;  3MC0 B;  1TS2 A;  1EEI D;  3DWQ A;  1XXG A;  4L63 B;  1F77 A;  1PRT F;  1PRT D;  1ESF A;  1BCP F;  1ET9 A;  1S5C D;  2AQ3 B;  1SE4 A;  4OHJ A;  1FGB D;  1LLR D;  1RDP D;  5ELB A;  1EU3 A;  4UDU C;  1Z52 A;  1PTO F;  1AN8 A;  1D5M C;  5ELF A;  1D5Z C;  2O2L D;  2RDG A;  1SXT A;  2IPK D;  3C0M A;  3BYY B;  1KLU D;  2CHB D;  5FKA C;  1KTK A;  1TS5 A;  1MD2 D;  1HXY D;  1I4X A;  1SJH D;  3BZD B;  3C0O A;  3DWA A;  1PRT B;  2TSS A;  1BCP B;  1I4H A;  1SE2 A;  1I4P A;  3OWE B;  3R2I A;  4TSS A;  2QEJ C;  1HTL D;  3MFG A;  3SEB A;  1CHP D;  2XRQ D;  1BXT A;  1PTO B; 
#chains in the Genus database with same CATH topology
 4GLA C;  5FO8 B;  3CCJ A;  4DR7 Q;  3CRL C;  1FD7 D;  1EIY B;  3W1B A;  2DGY A;  2UU9 Q;  2JA7 B;  4C3H H;  4M8A A;  2F0T A;  2WB1 G;  4GLX A;  4CGY B;  2Z4H A;  3FPU B;  4JI0 Q;  3I70 A;  4HJ9 A;  5ELN A;  2NVQ H;  1C7Y A;  3FEW X;  1U4R A;  1XMQ Q;  2K6A A;  4IPD A;  2L0C A;  4ME5 A;  4ULL A;  4RGN A;  4OXP A;  2JEA I;  1VQM A;  1B44 D;  4KJN A;  1E2W A;  4TRD A;  1EY8 A;  3B6Y A;  5C4J H;  1GXD C;  1MHW C;  3T56 B;  2YTV A;  5ELC A;  1IXR A;  2SOB A;  1Y1W H;  1SYF A;  1KDB A;  1TWC B;  3SK4 A;  4YCV A;  5JJK A;  1DYQ A;  2KQ3 A;  4XQQ A;  5C6A A;  3PO2 H;  5ISR A;  4HJ5 A;  5K36 H;  3S16 H;  4ZAI A;  3BVG A;  5C3W A;  3K58 A;  2B2T C;  2NZH A;  1K0R A;  4P71 A;  1M4V A;  1X9N A;  1OXT A;  2B29 A;  4IFD H;  3EJI A;  1J5E L;  4RKB A;  3I4N B;  1WJJ A;  1VQK A;  1EFI D;  4RAU C;  1GKH A;  1EWI A;  3MZ5 A;  1T5E A;  5E7N A;  2PW7 A;  4IQZ A;  1WTW A;  1P16 A;  4KY5 A;  2UUA Q;  1CHQ D;  1YNN C;  2QA4 A;  4OO1 G;  4DR5 Q;  1SBB B;  4PZ7 A;  2AWN A;  3C0N A;  2EY2 A;  1CKN B;  4QF4 A;  3PUZ A;  3S2D H;  1BR9 A;  2H1E A;  2GN5 A;  1EY5 A;  1NUC A;  4DNR B;  1RL2 A;  2GA4 B;  1TWG H;  1SE4 A;  4ABN A;  4WRD A;  1WTH A;  2K5Q A;  2QF7 A;  2MGS A;  2A73 B;  4JI3 L;  1VCI A;  3U9S A;  2RHS B;  3W5O A;  4MN3 A;  2WB1 E;  3D6C A;  5E3F A;  4DAY B;  2ICE C;  1VQ4 A;  2IT1 A;  1I4H A;  1YVC A;  1SE2 A;  3DM3 A;  1I4P A;  4TQU S;  4G7Z C;  2ZTE A;  3K8A A;  4GOP C;  1XNQ Q;  1GJX A;  2MQH A;  1EZ6 A;  2C5C A;  4GKK L;  1CQV A;  2K5H A;  3F2B A;  1JOQ A;  2KHI A;  1YNJ C;  5DLQ E;  4DR3 Q;  2BA0 A;  4A3D H;  1HQR D;  4N9P A;  2FHT A;  4JI4 Q;  3AFQ A;  1TY0 A;  1X56 A;  1XPO A;  1EQQ A;  1H9S A;  2VZA A;  4G57 A;  4X62 L;  4ZKC B;  2EZV A;  1XNR L;  4MTK A;  5I9O A;  5C5M A;  3VYT A;  2EY6 A;  2GVA A;  2CFM A;  4BY1 H;  4B3M Q;  3UE1 A;  4HIK A;  4H13 C;  2F0V A;  3KDF A;  1RTO A;  2QDL A;  4ALP A;  4DV0 L;  2K28 A;  1ROD A;  1I3Q B;  5ELD A;  4A3L G;  2YU9 B;  2R61 A;  1STB A;  3BZK A;  2DNC A;  3KLS A;  2ZXR A;  1Q8I A;  4KN4 C;  1SN8 A;  1GUN A;  3D3R A;  1N32 Q;  1QWY A;  3X3M A;  3ZJY C;  3M85 A;  4LF8 L;  3UDF A;  2FMM A;  4RGT A;  1RF2 D;  1DCZ A;  3K81 C;  3F2D A;  1HR0 L;  3TEH B;  1CK1 A;  2A69 D;  1K3R A;  4EQ5 A;  1X3Q A;  5FO7 B;  5IP7 G;  3CC7 A;  1JC7 A;  1NMF A;  2AKW B;  3T53 B;  3KFU A;  4LFC L;  1TWA B;  2VXW A;  4IUQ A;  5DM6 3;  1XTC D;  1TS2 A;  3MHB A;  3TBI B;  1CUK A;  1IKL A;  4JI7 Q;  4A3B G;  2PCF B;  4HMJ A;  5IP9 H;  2I5L X;  1LLR D;  5IGF A;  4DAM A;  1A3U A;  2F0L A;  3E9H A;  2UXC Q;  1HXY D;  4GKJ L;  4E6I A;  1I6H B;  5CYU A;  1HTP A;  1SJH D;  4A75 A;  3PUX A;  4F8M A;  1Q86 C;  1Q3L A;  2A6H D;  3R2I A;  3DMU A;  1GUW A;  1QNU A;  5IY0 A;  3FKI B;  4HSP A;  1X32 A;  3OMG A;  1A2U A;  1JQY D;  1YNN D;  4NW2 A;  3I90 A;  3EQL C;  2JA6 B;  3NP8 A;  3I56 A;  3L3O C;  2BA1 A;  3CU7 A;  1MJE A;  2O4X A;  1JWU D;  4RKL A;  5C0X I;  2SEB D;  1O78 A;  2JJQ A;  1CQF A;  4HJ7 A;  4DPG A;  1O7Z A;  3OSO A;  3ER0 A;  3CQZ B;  4JVZ A;  5M5W H;  4JI3 Q;  2IHE A;  3DWP A;  3VA7 A;  1BVS A;  2NWG A;  1PA6 A;  2B2W A;  1SND A;  4ZLT F;  3MWY W;  5HUR A;  4POG A;  3J81 c;  1WTR A;  2B63 B;  1DOK A;  1UE6 A;  3KBX A;  1DOL A;  2BDN A;  2F0F A;  2D62 A;  3CME A;  2HHH Q;  2N78 A;  5NUC A;  1PVO A;  4CDC C;  1YNJ D;  2EDG A;  4FYD A;  1WVL A;  2A68 D;  1S5F D;  4A3C H;  2BH2 A;  1MSG A;  2OTL A;  3HOW G;  1IKM A;  2CW0 C;  2CQA A;  2K03 A;  5M3F H;  4WOR A;  1Q81 C;  2ICI A;  3RR5 A;  2F0S A;  2M9V A;  4DR1 L;  4FDB A;  1PYS B;  2F0G A;  3HOV B;  5IOD A;  1Z9F A;  1U4L A;  1W3S A;  3E3X A;  2ZJR A;  3MA2 B;  4OL7 A;  1Z7T A;  4OX9 L;  4KLK A;  1WCM B;  1B3A A;  1ZYR C;  4A76 A;  1X54 A;  4DV2 Q;  1F77 A;  1EOT A;  3PUY A;  5FLX L;  1ESF A;  2L12 A;  4DV6 L;  1HH2 P;  1SSO A;  3I4M B;  5J1Z A;  1F9Q A;  1K83 B;  1IW7 C;  1HFG A;  3LNN A;  1L2F A;  3U4V A;  1KC8 C;  2KEC A;  3HOZ H;  1SXT A;  2IPK D;  1U4P A;  5C44 G;  4EX5 A;  4F7X A;  3HOX B;  3A8I E;  3GTG H;  4MZ9 A;  5I6W A;  2OF1 A;  4K8I A;  1S72 A;  2ZXP A;  3BZD B;  5C3E B;  4M1U B;  2EYJ A;  3J81 j;  1BCP B;  1UE5 A;  2JA5 G;  5CV7 A;  3NBH A;  4LK1 C;  4R8N A;  2K14 A;  2UUC L;  2PMZ B;  1QIL A;  3EVQ A;  3C1F A;  2L55 A;  2VB2 X;  3RN5 A;  4LFC Q;  2RHQ B;  4KD4 A;  4B9W A;  1HNX Q;  2EVB A;  4QIW E;  3M4O H;  2WAQ G;  4A93 H;  4BBR B;  2IX3 A;  4OON A;  5M5Y B;  4ZKB B;  3H3V H;  5C4X G;  3TME A;  5LL6 X;  1KDA A;  3K5N A;  1JOO A;  3PO3 H;  2F0W A;  1QVF A;  4NDX A;  2XNA C;  1STG A;  4DV1 L;  1XPR A;  1G2S A;  3PF4 A;  3U4Z A;  3HKZ E;  1EQV A;  2DY7 A;  1EU4 A;  1AZP A;  2A6E C;  4WJW A;  5FLX E;  3SDZ A;  3PIO A;  4GKJ Q;  2Y0S E;  3GD7 A;  4A3J H;  2EJG C;  2XN9 C;  1SR3 A;  3J7Y W;  1TWH H;  3IFD A;  3LX0 A;  1PH3 A;  4IFD I;  5JEA H;  3RZD H;  4Q5V A;  3HOY G;  3DHQ A;  3S1R B;  3URY A;  1S5D D;  4GLV B;  4C2M B;  1NSN S;  1LT5 D;  3EA6 A;  4DGZ A;  5KNB A;  3SR1 A;  4IUN A;  4BY7 G;  1XPU A;  1E0B A;  1F2Y A;  2MFI A;  3I55 A;  3FRP B;  4A3I H;  2B2Y C;  3TP8 A;  2E76 C;  1LT4 D;  1J8I A;  3PGZ A;  4A3E B;  1A2T A;  1EY7 A;  2B8G A;  3BS1 A;  1VQH A;  2D9U A;  1TS4 A;  2R92 G;  1QOH A;  5KEE A;  4X3K A;  3I8Z A;  3K80 C;  1CKN A;  1UEA B;  2PNR C;  4BXX G;  4NKL A;  4JOI A;  2DJF C;  2IL8 A;  3UDI A;  5T1I A;  3SXH A;  2KJX A;  5IGD A;  3K7U C;  1JIC A;  3NK9 A;  4PMB A;  3C46 A;  4K0K L;  1Q12 A;  1WTQ A;  2CCZ A;  4JC0 A;  5IGB A;  1EQT A;  1Y8O B;  4JCV E;  4S3S A;  3U9O A;  3CF5 A;  5IYB G;  3CPW A;  5M5X B;  3GTP H;  3BYY B;  2JA8 G;  3HFZ B;  4DAY A;  1BKB A;  1X3F A;  2M2L A;  3J7Z C;  1VQ8 A;  4ME3 A;  3U50 C;  5CBA E;  2F0M A;  4MTN A;  5AJ3 L;  2QEJ C;  1HTL D;  4IZ8 A;  4X3U A;  1B50 A;  3KLR A;  3HOU B;  2WAC A;  2Z1C A;  1TS3 A;  1BCP D;  4DR1 Q;  2PZW A;  3GTQ H;  1STE A;  3D4W A;  4B3R Q;  3ULJ A;  4A3F G;  4Y52 H;  5IOC A;  1S5B D;  5M3M H;  5CR3 A;  1G8Z D;  1B2T A;  2LXJ A;  3M4Q A;  2RQX A;  2BDO A;  3M4Y A;  1SRU A;  5KGU A;  2JA7 G;  2KCN A;  3Q23 A;  4R4T A;  1HNZ L;  2OQ0 A;  2UXB L;  1GUS A;  1T9H A;  1SNO A;  4DV6 Q;  2N3S A;  2TMP A;  4P2C B;  5FK9 C;  2R93 H;  1FNW A;  1SMX A;  3GTL B;  3H3V C;  1BNZ A;  4A3G B;  2F0H A;  1ZEQ X;  1PH2 A;  1QNK A;  1JMC A;  3ND8 A;  1YHQ A;  4ODG A;  4BBS H;  2N8N A;  2ZM6 L;  3LGJ A;  3BG3 A;  4H44 C;  3PMF A;  1N33 L;  4HR7 B;  2A1A A;  4A3M B;  1X3P A;  4FXG C;  1F2M A;  2Q8R E;  1ICF B;  2UUC Q;  1H9K A;  5I2Y A;  2XIW A;  2F0Q A;  4AYB B;  2R7Z B;  3A55 A;  5COY A;  3OWF A;  3K5L A;  5EPL A;  1TKW B;  4IJL A;  4PMC A;  4JI5 Q;  3W3A A;  4ZUI A;  4LF4 L;  2RCN A;  5COR A;  1F2L A;  3PUV A;  4A3K H;  4FF1 A;  2RSN A;  3I4N G;  2XTI A;  4DNT B;  4ZRZ A;  1KQS A;  1SLJ A;  2JA9 A;  3M4P A;  4TVA B;  3GTO H;  3NUC A;  3S1Q B;  1X65 A;  1LAC A;  1F9R A;  2MPM A;  2H4O A;  4H7B A;  1W2B A;  2KBN A;  3J81 E;  1VQN A;  1E1O A;  3S1M B;  1JOR A;  3N6R A;  5KRU A;  4DV7 L;  1G2T A;  1Y8P B;  1L0W A;  1K3B C;  4JYA Q;  2MJ8 A;  2WKD A;  1G29 1;  1H95 A;  4DR6 L;  2KEN A;  1IBK L;  1HJP A;  1HNW L;  5JEA J;  1BQQ T;  3KF8 A;  4NXM L;  3OWE B;  4DV3 L;  3GTJ B;  1R4P B;  2B2U C;  3KOJ A;  3TSS A;  2PI2 A;  4KV6 A;  2NVX B;  3CD6 A;  4UHV A;  3NSW A;  2YTY A;  3QWN A;  1UNS A;  2NN6 H;  1NBW A;  4L5T A;  2A8V A;  2IY5 B;  2CKZ B;  1T5X D;  3E0J A;  3H0G H;  4PG3 A;  2JSO A;  2NBF A;  4DK1 A;  2ID0 A;  3EFX D;  1ILP A;  2E2J B;  4HED A;  3MEF A;  4K0K Q;  3L9A X;  5JJZ A;  2VNU D;  3MXN B;  3RZO B;  1H9J A;  4YY3 L;  1GOZ A;  1D6E C;  2KCT A;  4RCO A;  4HAE A;  1VQO A;  3A74 A;  5AJ3 Q;  4I65 A;  1RHP A;  5HY6 A;  2WV6 D;  3TN2 A;  2F0U A;  4FF2 A;  1AE2 A;  4L6T B;  4KHZ A;  4K5W A;  2N88 A;  5T1G A;  1TWF B;  3CMA A;  2XWJ B;  3BYT B;  1JE4 A;  1QVC A;  4K6D A;  2EXZ A;  2BH8 A;  3UDX A;  1LTT D;  2K04 A;  4Q0F A;  4NXN Q;  4HCE A;  1LV9 A;  2FIN B;  3K57 A;  4DK3 C;  2VB3 X;  3G4O A;  1B70 B;  1OXU A;  4YWL A;  2B2V C;  2XRS D;  1GVP A;  3GTK H;  2WP8 J;  2QIL A;  4CJ1 B;  4C3J B;  1QUQ B;  4LWC A;  3MVV A;  2PPB C;  1PHJ A;  4JBM A;  4EVO A;  3DWQ A;  2F0I A;  4LF9 Q;  4L63 B;  1H9R A;  2BCO A;  2E2I B;  3LWU A;  1CM9 A;  1BCP F;  2AQ3 B;  4FO2 A;  5GAH C;  2ZM6 Q;  3SE0 A;  3MXP A;  5I2X A;  1Z52 A;  2EY1 A;  4R4Q A;  3K0Y A;  1E2V A;  3NPP A;  5IYD G;  4JBJ A;  2RBM A;  3I73 A;  3WDN A;  3A5U A;  1DGS A;  2MO1 A;  4ZUJ A;  3KLW A;  4OO1 H;  4J6H A;  4OIK A;  3C0O A;  3K6O A;  2TSS A;  3ERO A;  1EYA A;  4LF4 Q;  3S17 B;  1N36 Q;  2PQA B;  1PLF A;  4OWT B;  5IT9 L;  5JPM C;  3NTH A;  5IWA Q;  3TQY A;  5CBE E;  1NNX A;  3H3V I;  1X3G A;  1A6X A;  3AEV A;  5C0X J;  3FKI G;  2HT1 A;  4GN5 A;  2FJ2 A;  2M00 A;  2XWB B;  3D31 A;  2JA6 G;  2K5D A;  1KRS A;  2IWH A;  1B9M A;  1HZB A;  4F88 A;  3AYH B;  1PZK D;  4IPG A;  4L8J A;  5LHY 1;  3P75 A;  1II3 A;  4DUY Q;  1VQ5 A;  1SE3 A;  2MUY A;  3G48 A;  4DR6 Q;  1L0X B;  1JB7 A;  3RLN A;  4OWX B;  1IBK Q;  2NVY B;  1BF4 A;  1PTO H;  4DNI A;  4LF7 L;  1PRT C;  3KLS X;  2QKI C;  1HNW Q;  1LTR D;  3Q8D A;  3BDL A;  4NXM Q;  2RVL A;  3J80 c;  4K2L A;  1D1I A;  4JK1 C;  2J7Z A;  1ILQ A;  3HGB A;  4RH6 A;  1YBY A;  2B63 G;  5GQO A;  2E8G A;  2K52 A;  1KNE A;  1PH9 A;  5IYC G;  3Q22 A;  2XGT A;  3ERQ A;  3NQI A;  4LFA L;  4CBV A;  2VUM B;  3DEO A;  1STA A;  2NTS A;  5JOB A;  5KNC A;  5IT9 E;  3CC4 A;  1O80 A;  1ZKO A;  2A5H A;  4GOP B;  1B3Q A;  4XT3 B;  2LS0 1;  5E1F A;  1SYD A;  1RJT A;  2BOS A;  3S1N B;  2JYO A;  1L1O C;  1HFN A;  4C3I B;  4HIM A;  4A3L H;  4X64 L;  1YNX A;  1ENC A;  2EYF A;  2KUM A;  3D6W A;  3S14 B;  1LUZ A;  4GNX C;  3AQQ A;  4YY3 Q;  3E9I A;  1HUN A;  1Y1V B;  2F3W A;  3T1Y L;  3HOV G;  3EN2 A;  4C3H B;  1EIG A;  3OIP A;  4FXK C;  2VQE L;  1ET9 A;  1EOV A;  1N9W A;  5JVH 3;  4DV4 L;  1WCM G;  3CCQ A;  3GO5 A;  3GQB A;  2OT2 A;  1SNM A;  4IPC A;  4FF4 A;  2JE6 I;  3G7L A;  2NVQ B;  3I4M G;  2F0N A;  3C0M A;  5CMD A;  1QVG A;  1E22 A;  1BOS A;  3P1H A;  1QE6 A;  1BBU A;  5IP7 H;  4CKE A;  3DUZ A;  1AFP A;  3ZYY X;  5C4J B;  1UE7 A;  3G6E A;  3HOX G;  1Y1W B;  4HCS A;  2MNA A;  1ONL A;  4TKO B;  1ENF A;  4HMI A;  5C3E G;  4A3B H;  3RNU A;  3STB C;  4DF7 A;  4ZK9 B;  1XWE A;  3PO2 B;  3W2D A;  3H91 A;  3FHW A;  1DXM A;  3K59 A;  3S16 B;  1KXL A;  1L0Y B;  1PZI D;  2CVR A;  4V0B A;  1LTL A;  3IRB A;  2PNH A;  5AFW A;  1TU2 B;  1Q82 C;  1IHZ A;  2EYL A;  1J5E Q;  4NB3 A;  1OXX K;  4BBR G;  3MAQ A;  4NP5 A;  3BDO A;  4LF5 L;  2NUC A;  4P75 A;  2UUB L;  3LWE A;  3D4D A;  3ULP A;  1X55 A;  2FFK B;  3OTO L;  1TXY A;  3C2P A;  3EBE A;  3K7A H;  5G3L D;  1WOC A;  1A3V A;  2HIX A;  3CKI B;  4IOC A;  4IFD J;  3S2D B;  1MSH A;  4DK0 A;  3Q0A A;  3HG9 A;  4IAL A;  3GDE A;  1C0A A;  1TWG B;  1VF5 C;  2HQL A;  3PQI A;  1S3O A;  2VY3 A;  2E75 C;  3SK5 A;  2F52 A;  3QJY A;  2Z0S A;  1R9T H;  5LMN L;  4ZCK A;  1YJW A;  5FLM G;  1EY6 A;  1OO9 B;  2NZO A;  4PZ6 A;  2WII B;  4JI6 L;  1JCK B;  1QG7 A;  1A0I A;  2OEO A;  4JPB W;  4XXE A;  2R7F A;  1NMG A;  4Z9C B;  3M9B A;  2V1C C;  4A3E G;  3NQT A;  3MXU A;  1LTI D;  1HHV A;  4LUZ A;  5FJ8 G;  1WD0 A;  1VQD A;  2D0P A;  3RN2 A;  4GKK Q;  2WFW A;  1W6J A;  3AFP A;  1VQB A;  2FMC A;  2F0E A;  3ERS X;  4A3D B;  1PRT D;  4JI8 L;  2I5M X;  3OIQ A;  1IBL L;  4GN4 B;  1AN8 A;  3QOL A;  3HOW H;  3I4L A;  1YJ9 A;  3WOE A;  4X62 Q;  1PH7 A;  4IUP A;  1XNR Q;  2LFN A;  4BA2 I;  1J6Q A;  1KTK A;  2PMZ E;  3HEJ A;  4NMZ A;  4UY8 C;  3L7Z C;  4N8F A;  3L2P A;  4LF6 L;  4BY1 B;  1Y14 B;  2P5Z X;  4LFA Q;  2KCM A;  4R4I A;  1I94 L;  2KHS A;  2NN6 I;  5HGT A;  1D2B A;  2C9O A;  2PQE A;  2EE1 A;  5JPN C;  2E2H H;  2YYZ A;  1V1O A;  4DV0 Q;  1WYD A;  3SK8 A;  4IPH A;  2XSC A;  2WKC A;  2NVT H;  2R6G A;  1SYE A;  3HOU G;  3M7G A;  5C44 H;  2FXQ A;  2F0D A;  3QO2 A;  4B3T L;  4UP7 A;  4LF8 Q;  1PDQ A;  4X3T A;  3HS0 C;  1PH8 A;  4DV4 Q;  3F2U A;  5GRO A;  4U67 3;  1STY A;  1HR0 W;  5J3B A;  1N34 L;  3CXC A;  1RTN A;  4XDX A;  1HR0 Q;  2JA5 H;  2UXD L;  3MXN A;  5CV8 A;  3JAM c;  2HCC A;  2F1M A;  1I4Q A;  4A3G G;  5EGT A;  4LJZ C;  4FVM A;  3TRZ A;  1KAA A;  4HIO A;  4LUV A;  3E0E A;  3STB D;  1RD9 D;  2EIF A;  3DEP A;  2Z6K A;  5C4X H;  3PIO 3;  4A3M G;  2A74 C;  2F4I A;  4PV1 C;  1OXV A;  1Z6H A;  1FVI A;  2Q2H A;  1JWM D;  4AYB G;  4APV A;  2K1B A;  2R7Z G;  2IX1 A;  1IL2 A;  1E24 A;  1DJR D;  2CWA A;  4RWS C;  1EYG A;  1FYC A;  4XYQ A;  3S15 H;  1D7Q A;  3J7A 5;  1PZJ D;  4LF5 Q;  1MI2 A;  1QUQ A;  4KD3 A;  4F87 A;  3J81 i;  2UUB Q;  4RFB A;  1ENA A;  3HOY H;  3F8T A;  2QW7 A;  3M3Y H;  1BDO A;  2L9H A;  1CSP A;  5A2Q E;  1VQG A;  3EIV A;  1Q1B A;  1GUT A;  3J80 E;  1SFO H;  1TQO A;  3CPF A;  1JB3 A;  1GD7 A;  4OHJ A;  3VYS A;  4BY7 H;  4OO1 I;  4R1J A;  5LMU L;  3S1M H;  1K8A C;  4JBW A;  5ELF A;  2O2L D;  2LSS A;  2RDG A;  1C4Q A;  4BS9 A;  1XTD A;  3A5Z B;  5BR8 L;  1VS0 A;  3L0O A;  5FKA C;  4NPS A;  5M5W B;  3DM1 A;  3BJU A;  1I4X A;  2R92 H;  4Y7N H;  5LMN Q;  3J7A V;  2D2C C;  3T13 A;  1M8A A;  1VQF A;  1VQ9 A;  2RDF A;  3GTM H;  2PQA A;  4BXX H;  4R4O A;  4JI6 Q;  3KF6 B;  1CHP D;  1JE5 A;  3WWV A;  1S5E D;  5HGQ A;  5G3L F;  4K6L A;  5H1S E;  1CTM A;  1I50 H;  3GTJ H;  2ZTD A;  2B2T A;  2OCE A;  2RSO A;  3I4O A;  4X65 L;  5CV6 A;  3U58 A;  4PQX A;  5ELE A;  5IYB H;  5GAG C;  2G9H D;  1IYJ B;  3TDQ A;  4JI8 Q;  3E6Z X;  2JA8 H;  2WAQ E;  2Y0S B;  3R8B A;  2CW0 D;  1AW7 A;  1TII D;  4K2K A;  3A56 A;  5M3F B;  4MNO A;  2HDM A;  1SEB D;  3CCU A;  2VQF L;  4GS3 A;  5IIF A;  4DV5 L;  4HID A;  4AYB E;  4DA2 A;  4HJA A;  3AMU A;  4LF6 Q;  4A3F H;  2IW3 A;  1I94 Q;  3VYR A;  3BZC A;  4XIG S;  2AHO B;  1ZYR D;  4OX9 Q;  1EY9 A;  4RHR A;  4O2D A;  3T1H L;  4YWM A;  3J81 L;  5DEH A;  2JA7 H;  5D3I B;  1SRO A;  3V96 A;  1IW7 D;  3NWS A;  1JWS D;  3H15 A;  2B39 A;  3TZD A;  4DAP A;  1PYW D;  4IJH A;  3HOZ B;  3A0J A;  1WTP A;  1YI2 A;  1YJN A;  5I4D A;  2OWO A;  3GTG B;  1UWV A;  1MJC A;  2PW5 A;  1VQA A;  4A4I A;  4GOP A;  4C1N I;  5KYL A;  3F1Z A;  4C56 C;  4XT1 B;  2UXD Q;  1WTV A;  2RKS A;  2EQS A;  1N34 Q;  5DM7 3;  4CKB A;  4YIJ A;  4DR2 L;  1XMO L;  1TY2 A;  2JN4 A;  3W1G A;  1TWC H;  2B2W C;  4KMU C;  4C3J G;  1CA6 A;  3DLL A;  1JT8 A;  5EKL A;  4H0L C;  2I0Q A;  3M4O B;  4A93 B;  1MGS A;  4QGU A;  4UDU C;  1HRJ A;  2KCC A;  4UPA A;  1D5Z C;  2PZU A;  3PO3 B;  3I4N H;  1KLU D;  3RUZ A;  4WJ3 M;  4V19 0;  2RCF A;  4DV1 Q;  3VR3 A;  1SAP A;  3DWA A;  2MP1 A;  1ML0 D;  2VS1 A;  5EKK A;  2A6E D;  1VQC A;  1PH6 A;  3MFG A;  4XQN A;  1KNA A;  1BBW A;  1JJC B;  2XRQ D;  5C0X G;  1H9M A;  4A3J B;  4KHV A;  1LT6 D;  1TWH B;  4FF3 A;  3A8K E;  4IO9 A;  5CV4 A;  5EAY A;  2K5V A;  3NEL A;  1VQE A;  1B9N A;  1C48 A;  5TSS A;  1FL0 A;  4A3I B;  4JBK A;  4EQN A;  1X3E A;  3I2Z A;  1ESR A;  5FO9 B;  1QJO A;  2ALY B;  2EYM A;  4G4K A;  1GM5 A;  1BBX C;  1CZW A;  1U4M A;  4DU9 A;  5BR8 Q;  4G7O C;  5IGC A;  2RF4 A;  4RA8 A;  5DAU A;  1LTB D;  1PH5 A;  1XNQ L;  4DN4 M;  4KHP L;  3BVM A;  1STH A;  3VR2 A;  4HSV A;  1SNC A;  2JQO A;  2PO4 A;  4CJ2 C;  1QB5 D;  2GVB A;  2Z4I A;  2K75 A;  4FXD A;  4DR3 L;  2F3V A;  1E1T A;  4JI4 L;  2AUK A;  1LO5 D;  3VR5 A;  1KIX A;  1IL8 A;  1ASZ A;  4L5S A;  1QZG A;  1EL0 A;  1O7Y A;  3CAM A;  1V1P B;  1I5F A;  5C5L A;  1YIJ A;  3G6J B;  4OEM B;  1YIT A;  1AZQ A;  3M7N A;  3GTP B;  3MTS A;  2ASB A;  1EQR A;  1G51 A;  5L37 A;  4O0A A;  3K5M A;  1B1Z A;  3R93 A;  4WJ4 A;  1DZ1 A;  1K73 C;  2VUM G;  3JAM E;  3RMH A;  3BDC A;  1AH9 A;  4H02 A;  1RKN A;  3P7J A;  4QUC A;  1KLG D;  3MC0 B;  3GTQ B;  4C3I G;  1I3Q H;  4DV5 Q;  4KJO A;  2YU9 H;  3D0F A;  1V1Q A;  5M3M B;  3G4S A;  1Y1V G;  1Y1V H;  3NTI A;  2QCP X;  4CKC A;  2K5N A;  4U68 A;  1SDF A;  4C3H G;  1N32 L;  3T1H Q;  2L5T A;  1SE8 A;  1HNZ Q;  1ICW A;  2DY8 A;  2UXB Q;  1GUG A;  1LAB A;  1G6P A;  2RA4 A;  2R93 B;  5E4W C;  2CHB D;  4J8Q A;  1O7I A;  1VF7 A;  4EQP A;  1MBY A;  2KA7 A;  2A69 C;  3K0X A;  4DUZ L;  1SNP A;  1NCV A;  1KRT A;  1KAB A;  3SEB A;  4BBS B;  4PZ8 A;  4EGV A;  2RDH A;  1Q46 A;  4QJF A;  1EWC A;  1Y8N B;  2O5I C;  1TWA H;  3Q6S A;  2CH4 W;  2LXK A;  2EJF C;  1N33 Q;  1EYD A;  1K8M A;  4JI7 L;  4LFB L;  3SGI A;  1Y1W G;  3JC6 6;  4DR2 Q;  1XMO Q;  4DK6 C;  5IYD H;  3T16 A;  1DON A;  1PV4 A;  1B53 A;  1XX8 A;  4K14 A;  3PUW A;  1CZG A;  1LTS D;  2MHV A;  1HA5 A;  4JOI C;  3SVM A;  3PO2 G;  2Z8L A;  5K36 G;  2VW9 A;  4OWW B;  1SJE D;  4O1N A;  1EFW A;  3FVQ A;  2UXC L;  2ES2 A;  2EPB A;  3P20 A;  1K8O A;  5CV9 A;  4DXF A;  1UE1 A;  4FNF A;  4A3K B;  4IFD G;  3QG1 A;  1I6H H;  1LTA D;  1U0L A;  1BO0 A;  3S2H B;  2KHJ A;  2A6H C;  2K7V A;  3GTO B;  5ELO A;  3I7F A;  3FKI H;  3SHL A;  4HTH A;  2R7D A;  2N55 A;  5BN3 A;  2JA6 H;  1FGU A;  5CV5 A;  2Q8T A;  1TT2 A;  2EYP A;  4J15 A;  2HUG A;  4DV7 Q;  3PF5 A;  1EWH A;  4KY6 A;  3QR8 A;  1OXS C;  3KYH C;  3GV3 A;  4N8X 1;  3TRE A;  1FR3 A;  2F0P A;  1C9O A;  5J22 A;  2F4V L;  1HZA A;  4CHT B;  2IX0 A;  4BWG B;  2EYO A;  4C1N K;  3BU2 A;  3UDG A;  1P8L A;  1C8C A;  3CQZ H;  2ZXO A;  3A7L A;  3IL8 A;  2JEB I;  3R2T A;  3RLO A;  4QUF A;  4OEL B;  4DFA A;  5I9P A;  4DV3 Q;  5D65 A;  2HQE A;  4RG1 A;  1NAP A;  2EOT A;  3KBG A;  1HZ9 A;  5FLX c;  4JI1 L;  2B63 H;  1PMR A;  4YHH L;  4ZQ3 A;  5KYI A;  4KHP Q;  1A3T A;  3RLF A;  5IYC H;  2HHH L;  4B9X A;  5ELB A;  4PNY A;  1ASY A;  3H0G B;  2BE5 C;  4A3D G;  2A68 C;  4IUV A;  4L5Q A;  2R3Z A;  1R4Q B;  2KEE A;  2JP1 A;  3OHX C;  1PRT B;  4XYO A;  2I46 A;  3ITP A;  4B3S L;  3HOV H;  3AB9 A;  3H09 A;  3KF6 A;  4BY1 G;  2WB1 B;  1PFN A;  3CCR A;  3QOJ A;  2NB0 A;  1WCM H;  1GUO A;  4DV2 L;  2K50 A;  3NXW A;  1VQ6 A;  2EXD A;  1D8L A;  5JJL A;  3I4M H;  3V2T A;  2B2Y A;  4X6A H;  1K83 H;  4KY7 A;  2PI2 E;  2L1B A;  2E74 C;  2B3G A;  5LL6 S;  1L1O B;  1HUM A;  2HIV A;  5BN5 A;  4IUT A;  3GTK B;  1IZ6 A;  5GAE C;  3HOX H;  1Q7Y C;  3X3N A;  4GNX B;  3J7A F;  1RCV D;  5C3E H;  1PFM A;  2HD3 A;  2Q8I B;  3T4A C;  1I4R A;  4DUZ Q;  4G7H C;  1V8Q A;  4K5V A;  2D5D A;  4IN3 A;  2AWO A;  1S40 A;  1K8G A;  1HNX L;  3S9W A;  2Q2U A;  4KKT A;  3DXJ C;  4LFB Q;  4BBR H;  2NTT A;  5IP9 G;  2DN8 A;  5M5Y H;  3Q24 A;  3K5O A;  5EKI A;  3VR6 A;  3TP5 A;  4DR4 L;  2L4N A;  4KTA A;  3SK6 A;  1HPC A;  4MHE A;  1QZH A;  3MFY A;  2I07 B;  1FNV A;  3J80 i;  4PMW A;  1I4G A;  4CJ0 B;  5CGK A;  4JI2 L;  1PTO C;  4ID6 A;  3KF8 B;  2ATW A;  3A54 A;  5GAD C;  4P72 A;  3S1R H;  2K32 A;  3NEN A;  2DNE A;  1U9R A;  1KDC A;  2DJG C;  4R8I A;  4C2M H;  5FLM H;  2ZJP A;  4UP8 A;  3OW7 A;  4P74 A;  2YTX A;  1SYG A;  1B8A A;  1SNQ A;  1F2Z A;  2V4D A;  3PIP 3;  1WTO A;  3G71 A;  4A3E H;  2F4V Q;  4DKA C;  5FJ8 H;  1CKM A;  4LNQ A;  3VA5 A;  1NR4 A;  1VQJ A;  4TSS A;  2LKV A;  4CDE C;  1UAP A;  2AMC B;  1CKO A;  1PTO B;  4LF7 Q;  1FJG L;  1E2Z A;  3PIP A;  4YCW A;  4JV5 L;  1ET6 A;  1DOM A;  5EBD A;  3T51 B;  2HDL A;  2F03 A;  2EY5 A;  1A63 A;  4AQY L;  2K5W A;  4JI1 Q;  3CCV A;  4QMG A;  4YHH Q;  3NBI A;  4DXG A;  2Z6B A;  1G6Z A;  2CQO A;  2X6G A;  3PV0 A;  2IHF A;  3HKZ G;  2BE5 D;  1EEF D;  5M5X H;  4A3C G;  1W6K A;  4MIU A;  1WTX A;  4QB4 A;  1K9M C;  3VYU A;  2Y0S G;  2AQ2 B;  5M3F G;  4X64 Q;  1PYB A;  3TP6 A;  2K4K A;  1G91 A;  1WD1 A;  4B3S Q;  3HOU H;  1A62 A;  1BCP C;  2ZT9 C;  3T1Y Q;  5BN4 A;  4R9W A;  4B3R L;  2N49 A;  4IUU A;  5A2Q L;  1GHK A;  4O42 A;  2VQE Q;  2VL6 A;  3J80 L;  4I7Z C;  4J1M A;  4LUO A;  4POF A;  5FOB B;  1V1P A;  3ND9 A;  1STN A;  1LTG D;  2KVM A;  1ZXT A;  1KD1 C;  1FNU A;  2IJ0 A;  4BA1 I;  3GP7 A;  1MIU A;  1Z47 A;  1F9P A;  1IYV A;  3NE5 B;  3HOZ G;  3GTL H;  4A3G H;  2B2U A;  2SNS A;  3O13 A;  1XJV A;  4ZYS A;  2J4X A;  1HCZ A;  1CFM A;  1QCB D;  3PCO B;  2F0K A;  4LAA A;  3S24 A;  1Q1E A;  4A3B B;  1PRE A;  1EIF A;  1YHA A;  1NE3 A;  3TP7 A;  5K5P A;  3C1E A;  2F3I A;  1XXG A;  1A15 A;  3UI2 A;  4A3M H;  1SMY C;  3FP9 A;  2SDF A;  1M90 C;  1WI5 A;  2JK8 A;  1RDP D;  3F2C A;  4R4C A;  4UP9 A;  2O5J C;  2R7Z H;  2CH4 A;  1EU3 A;  3WOF A;  2LY7 A;  1YZ6 A;  4I7A A;  3N52 A;  4KKU A;  4JI5 L;  3H6M A;  4A93 G;  4CDF C;  4QCL A;  1AP0 A;  4QQB X;  4JG2 A;  4UAI A;  5C3X A;  1U5K A;  3OTO Q;  3PO3 G;  3IFT A;  3OW2 A;  3I3C A;  4DR4 Q;  1V9P A;  3K7A B;  4X66 L;  2I5H A;  4WFN 3;  1VQL A;  1D1K A;  5J39 A;  3GV6 A;  1Q90 A;  2G5D A;  2J0T D;  3S1Q H;  3KK7 A;  2AQ1 B;  4RGM A;  2KED A;  1SYB A;  5F2D A;  3ONA B;  1CT1 D;  1PTO D;  4JI2 Q;  3CCM A;  2PYK A;  4A3J G;  1PFS A;  3OMC A;  1JOK A;  5JEA G;  3E5S A;  1KL9 A;  2HCI A;  5C4H A;  1R9T B;  1H9S B;  2SNM A;  1JJG A;  2B2V A;  2LMC B;  3CCS A;  4JYA L;  5LMN W;  1K28 A;  2A19 A;  1IYU A;  1JR0 D;  2E5L L;  4QIW B;  2OQK A;  1S4Z A;  4A3I G;  1XYI A;  4KN7 C;  1UUP A;  1TVX A;  2XVS A;  2D0O A;  2AUJ D;  1I6V C;  3KDF B;  1DD2 A;  2OTJ A;  4DAV A;  3OYY A;  4QL5 A;  1PXU A;  3NTK A;  2EYH A;  2Z9H A;  3I91 A;  2YV5 A;  2NVX H;  3HKZ B;  1IBM L;  3A7A B;  4RHS A;  3HZX A;  5JJI A;  1SYC A;  1AE3 A;  2X6L A;  2C35 B;  1FJG Q;  2L11 A;  1IBL Q;  4JV5 Q;  3HOW B;  1B4O A;  1E7Z A;  1AEX A;  4RGO S;  1WFQ A;  2QDB A;  3HRZ C;  4GN3 B;  1EUJ A;  2K33 A;  3IAY A;  1VDZ A;  4AQY Q;  1HA6 A;  1CI3 M;  3CCE A;  2ZTC A;  2QGQ A;  3JAM i;  2H5X A;  1E3P A;  2MO0 A;  1CSQ A;  4P73 A;  4XTC S;  4XQJ A;  2E2J H;  5IGG A;  4OGQ C;  4B08 A;  3TZU A;  3TS0 A;  5D3D A;  3ICE A;  1VQP A;  1KHI A;  2OXP A;  3RZO H;  5C4Z A;  1D5X C;  1VMP A;  4DR7 L;  1HZC A;  2UU9 L;  2E2H B;  4ILW A;  2PZT A;  3AU7 A;  2G9D A;  1EZ8 A;  2NYZ D;  4LW1 A;  5KIX A;  1CA5 A;  1EEI D;  2F0J A;  3MXG A;  4EQO A;  2NVT B;  1PRT F;  4JI0 L;  2KOL A;  5EJW A;  3QIA A;  1Q8K A;  1FGB D;  4IOA A;  1TWF H;  4KI0 A;  1NY4 A;  3CW2 C;  5C44 B;  3KJP A;  1PH1 A;  1XMQ L;  4B3T Q;  4NXN L;  5M3M G;  1NTG A;  1LM0 A;  1M1K C;  2F0O A;  3VDY A;  2JA5 B;  1LYL A;  1F9S A;  3HP3 A;  1A8V A;  5EPJ A;  1YHB A;  5IT9 c;  2JXM B;  4CDD C;  2R93 G;  4AH6 A;  3CC2 A;  4C3J H;  5KND A;  5IE8 A;  3D8G A;  1EYC A;  3C3L A;  1BXT A;  4YCU A;  2ZJQ A;  5M9O A;  1MKH A;  4L5R C;  2WAQ B;  3ULL A;  3G4N A;  4LF9 L;  5E4X A;  3UE0 A;  1HQM C;  3I72 A;  4BBS G;  4RCN A;  3RD4 A;  3PSI A;  1V43 A;  2E2I H;  5DNF A;  2EJM A;  5C4X B;  1BUV T;  1SMY D;  1O7L A;  1PFB A;  1EY0 A;  4GZY C;  4IUR A;  5EBC A;  3D4R A;  5JVG 3;  2UUA L;  1L1O A;  4DR5 L;  3S15 B;  5C0X H;  4GNX A;  1GO3 E;  1JJ2 A;  1N36 L;  2DUD A;  3S17 H;  3RZD B;  3HOY B;  3JAM L;  2NZ1 D;  4A3K G;  1X6O A;  1UEB A;  2WIN B;  3QB3 A;  5IWA L;  3M3Y B;  5CC4 A;  2Q2I A;  1RIP A;  3S2H H;  4X66 Q;  3CHB D;  1PH4 A;  1KAW A;  1B7Y B;  4HJ8 A;  1SFO B;  4AIM A;  3HKS A;  4BY7 B;  3V05 A;  4K8J A;  3MEH A;  4X3S A;  3BVZ A;  2K05 A;  5LMU Q;  1VQ7 A;  3R3O A;  5A35 A;  2QEX A;  1VMC A;  4HN7 A;  1N8R C;  5JAV A;  5EQ0 A;  2R92 B;  4Y7N B;  1NJI C;  1NR2 A;  2K01 A;  1LT3 D;  4DUY L;  3IKJ A;  3VR4 A;  1VQI A;  5D14 A;  3KJO A;  3CCL A;  3GTM B;  2E5L Q;  4YWK A;  3FDT A;  1Y69 U;  5EPK A;  2Q2T A;  2CWP A;  4RMF A;  3FMC A;  2NVY H;  3NHH A;  1EY4 A;  1YEZ A;  3CP0 A;  1EIH A;  1I50 B;  1K0S A;  4JW0 A;  3KUP A;  1S5C D;  4K5X A;  3NWT A;  4X65 Q;  4KK7 A;  5I6Y A;  3H94 A;  1IBM Q;  1PTO F;  2NN6 G;  2X69 A;  2E2D C;  1D5M C;  2JA8 B;  1DM0 B;  4N9T A;  2Z6K C;  1OTC A;  4B3M L;  3CRK C;  3FPP A;  2VUM H;  3OOC A;  1GHJ A;  3H0G G;  3OPO A;  1TS5 A;  1MD2 D;  1TR5 A;  4KKS A;  4QY7 A;  4OIJ A;  1J9O A;  2VQF Q;  3S1N H;  3TS2 A;  4C3I H;  4FP5 D;  2ENB A;  4LMQ D;  3NBH B;  2B8F A;  2L15 A;  3A8J E;  5IGE A;  3S14 H;  3NEM A;  4A3F B; 
#chains in the Genus database with same CATH homology
 5FO8 B;  3CRL C;  1FD7 D;  2JA7 B;  4M8A A;  2F0T A;  4CGY B;  2Z4H A;  3FPU B;  3I70 A;  3FEW X;  1U4R A;  2K6A A;  2L0C A;  4ME5 A;  4ULL A;  4RGN A;  2JEA I;  1B44 D;  4KJN A;  1E2W A;  4TRD A;  1EY8 A;  1GXD C;  3T56 B;  5ELC A;  2SOB A;  1SYF A;  1KDB A;  1TWC B;  3SK4 A;  1DYQ A;  2KQ3 A;  4XQQ A;  5C6A A;  5ISR A;  5K36 H;  4ZAI A;  3BVG A;  5C3W A;  3K58 A;  2B2T C;  1M4V A;  1OXT A;  4IFD H;  3EJI A;  4RKB A;  3I4N B;  1EFI D;  4RAU C;  3MZ5 A;  1T5E A;  2PW7 A;  4IQZ A;  1WTW A;  4KY5 A;  1CHQ D;  1YNN C;  4OO1 G;  1SBB B;  2AWN A;  3C0N A;  2EY2 A;  4QF4 A;  3PUZ A;  1BR9 A;  2H1E A;  1EY5 A;  1NUC A;  4DNR B;  2GA4 B;  1SE4 A;  4ABN A;  4WRD A;  2K5Q A;  2QF7 A;  2MGS A;  2A73 B;  1VCI A;  3U9S A;  4MN3 A;  3D6C A;  5E3F A;  2ICE C;  2IT1 A;  1I4H A;  1SE2 A;  1I4P A;  4TQU S;  4G7Z C;  1GJX A;  1EZ6 A;  2C5C A;  1CQV A;  1JOQ A;  1YNJ C;  2BA0 A;  1HQR D;  4N9P A;  2FHT A;  1TY0 A;  1H9S A;  4G57 A;  4ZKC B;  2EZV A;  5I9O A;  5C5M A;  3VYT A;  2EY6 A;  4H13 C;  2F0V A;  1RTO A;  2K28 A;  1ROD A;  1I3Q B;  5ELD A;  2YU9 B;  2R61 A;  1STB A;  2DNC A;  3KLS A;  2ZXR A;  1Q8I A;  4KN4 C;  1GUN A;  3D3R A;  1QWY A;  3X3M A;  3M85 A;  2FMM A;  4RGT A;  1RF2 D;  1DCZ A;  1CK1 A;  2A69 D;  1X3Q A;  5FO7 B;  1JC7 A;  3T53 B;  1TWA B;  2VXW A;  4IUQ A;  5DM6 3;  1XTC D;  1TS2 A;  3MHB A;  3TBI B;  1IKL A;  2PCF B;  4HMJ A;  1LLR D;  5IGF A;  1A3U A;  2F0L A;  1HXY D;  4E6I A;  1I6H B;  5CYU A;  1HTP A;  1SJH D;  3PUX A;  4F8M A;  1Q3L A;  2A6H D;  3R2I A;  3DMU A;  1GUW A;  1QNU A;  3FKI B;  4HSP A;  1X32 A;  3OMG A;  1A2U A;  1JQY D;  1YNN D;  4NW2 A;  3I90 A;  3EQL C;  2JA6 B;  3NP8 A;  3L3O C;  2BA1 A;  3CU7 A;  2O4X A;  1JWU D;  4RKL A;  5C0X I;  2SEB D;  1O78 A;  1CQF A;  1O7Z A;  3OSO A;  3CQZ B;  3DWP A;  3VA7 A;  2NWG A;  2B2W A;  1SND A;  4ZLT F;  3MWY W;  5HUR A;  2B63 B;  1WTR A;  1DOK A;  3KBX A;  1DOL A;  2BDN A;  2F0F A;  2D62 A;  5NUC A;  1YNJ D;  2EDG A;  4FYD A;  1WVL A;  2A68 D;  1S5F D;  1MSG A;  1IKM A;  2CW0 C;  2CQA A;  2K03 A;  4WOR A;  2ICI A;  2F0S A;  2M9V A;  2F0G A;  3HOV B;  5IOD A;  1U4L A;  3MA2 B;  4OL7 A;  1Z7T A;  1WCM B;  1B3A A;  1ZYR C;  1F77 A;  1EOT A;  3PUY A;  5FLX L;  1ESF A;  2L12 A;  1SSO A;  3I4M B;  5J1Z A;  1F9Q A;  1K83 B;  1IW7 C;  1HFG A;  3LNN A;  2KEC A;  1SXT A;  2IPK D;  1U4P A;  4F7X A;  3HOX B;  3A8I E;  5I6W A;  2OF1 A;  4K8I A;  2ZXP A;  3BZD B;  5C3E B;  4M1U B;  2EYJ A;  1BCP B;  5CV7 A;  3NBH A;  4LK1 C;  4R8N A;  2PMZ B;  1QIL A;  3EVQ A;  3C1F A;  2L55 A;  2VB2 X;  4KD4 A;  4B9W A;  2EVB A;  4BBR B;  2IX3 A;  5M5Y B;  4ZKB B;  3TME A;  5LL6 X;  1KDA A;  3K5N A;  1JOO A;  2F0W A;  4NDX A;  2XNA C;  1STG A;  1G2S A;  1EQV A;  2DY7 A;  1EU4 A;  1AZP A;  2A6E C;  4WJW A;  5FLX E;  3SDZ A;  3GD7 A;  2EJG C;  2XN9 C;  3J7Y W;  3IFD A;  3LX0 A;  4IFD I;  5JEA H;  4Q5V A;  3DHQ A;  3S1R B;  3URY A;  1S5D D;  4C2M B;  1NSN S;  4DGZ A;  1LT5 D;  3EA6 A;  5KNB A;  3SR1 A;  4IUN A;  1E0B A;  1F2Y A;  3FRP B;  2B2Y C;  3TP8 A;  2E76 C;  1LT4 D;  1J8I A;  4A3E B;  1A2T A;  1EY7 A;  2B8G A;  3BS1 A;  2D9U A;  1TS4 A;  1QOH A;  5KEE A;  4X3K A;  3I8Z A;  1UEA B;  2PNR C;  4NKL A;  2IL8 A;  5T1I A;  3SXH A;  2KJX A;  5IGD A;  1JIC A;  3NK9 A;  4PMB A;  3C46 A;  1Q12 A;  1WTQ A;  5IGB A;  1EQT A;  1Y8O B;  4S3S A;  3U9O A;  5M5X B;  3BYY B;  4DAY A;  2M2L A;  5CBA E;  2F0M A;  2QEJ C;  1HTL D;  4IZ8 A;  4X3U A;  1B50 A;  3KLR A;  3HOU B;  2WAC A;  2Z1C A;  1TS3 A;  1BCP D;  2PZW A;  1STE A;  3D4W A;  5IOC A;  1S5B D;  5CR3 A;  1G8Z D;  1B2T A;  2RQX A;  2BDO A;  3M4Y A;  5KGU A;  2KCN A;  3Q23 A;  1GUS A;  1SNO A;  2TMP A;  4P2C B;  5FK9 C;  1FNW A;  3GTL B;  3H3V C;  1BNZ A;  4A3G B;  2F0H A;  1ZEQ X;  1QNK A;  3ND8 A;  4ODG A;  3BG3 A;  4H44 C;  3PMF A;  4HR7 B;  4A3M B;  1X3P A;  4FXG C;  1F2M A;  2Q8R E;  1H9K A;  5I2Y A;  2XIW A;  2F0Q A;  4AYB B;  2R7Z B;  3A55 A;  5COY A;  3OWF A;  3K5L A;  5EPL A;  1TKW B;  4PMC A;  3W3A A;  4ZUI A;  5COR A;  1F2L A;  3PUV A;  4FF1 A;  2RSN A;  4DNT B;  4ZRZ A;  3NUC A;  3S1Q B;  1LAC A;  1F9R A;  2MPM A;  2H4O A;  4H7B A;  3J81 E;  3S1M B;  1JOR A;  3N6R A;  5KRU A;  1G2T A;  1Y8P B;  2MJ8 A;  2WKD A;  1G29 1;  5JEA J;  1BQQ T;  3KF8 A;  3OWE B;  3GTJ B;  1R4P B;  2B2U C;  3TSS A;  2NVX B;  4KV6 A;  3NSW A;  3QWN A;  1UNS A;  2NN6 H;  1T5X D;  3E0J A;  2JSO A;  2NBF A;  4DK1 A;  2ID0 A;  3EFX D;  1ILP A;  2E2J B;  4HED A;  3L9A X;  5JJZ A;  2VNU D;  3RZO B;  1H9J A;  1GOZ A;  1D6E C;  4RCO A;  4HAE A;  4I65 A;  1RHP A;  2WV6 D;  3TN2 A;  2F0U A;  4FF2 A;  4L6T B;  4KHZ A;  4K5W A;  2N88 A;  5T1G A;  1TWF B;  2XWJ B;  3BYT B;  1JE4 A;  4K6D A;  2EXZ A;  1LTT D;  2K04 A;  4Q0F A;  4HCE A;  1LV9 A;  2FIN B;  3K57 A;  3G4O A;  2VB3 X;  1OXU A;  2B2V C;  2XRS D;  2WP8 J;  2QIL A;  4CJ1 B;  4C3J B;  3MVV A;  2PPB C;  4EVO A;  3DWQ A;  2F0I A;  4L63 B;  1H9R A;  2BCO A;  2E2I B;  3LWU A;  1CM9 A;  1BCP F;  2AQ3 B;  4FO2 A;  3SE0 A;  3MXP A;  5I2X A;  1Z52 A;  2EY1 A;  3K0Y A;  1E2V A;  3NPP A;  2RBM A;  3I73 A;  3WDN A;  4ZUJ A;  4OO1 H;  4J6H A;  4OIK A;  3C0O A;  3K6O A;  2TSS A;  3ERO A;  1EYA A;  3S17 B;  1PLF A;  5IT9 L;  5JPM C;  3NTH A;  5CBE E;  1A6X A;  5C0X J;  2FJ2 A;  2M00 A;  2XWB B;  3D31 A;  2K5D A;  2IWH A;  1B9M A;  4F88 A;  1PZK D;  4L8J A;  5LHY 1;  3P75 A;  1II3 A;  1SE3 A;  2MUY A;  1L0X B;  1BF4 A;  2NVY B;  1PTO H;  1PRT C;  3KLS X;  2QKI C;  1LTR D;  3BDL A;  2RVL A;  4K2L A;  1D1I A;  4JK1 C;  2J7Z A;  1ILQ A;  3HGB A;  4RH6 A;  1KNE A;  3Q22 A;  3ERQ A;  3NQI A;  4CBV A;  2VUM B;  3DEO A;  1STA A;  2NTS A;  5JOB A;  5KNC A;  5IT9 E;  1O80 A;  1ZKO A;  2A5H A;  4XT3 B;  2LS0 1;  5E1F A;  1SYD A;  1RJT A;  2BOS A;  3S1N B;  2JYO A;  1HFN A;  4C3I B;  2EYF A;  1ENC A;  3S14 B;  2KUM A;  3D6W A;  1HUN A;  1Y1V B;  2F3W A;  4C3H B;  1EIG A;  3OIP A;  4FXK C;  1ET9 A;  5JVH 3;  3GO5 A;  3GQB A;  2OT2 A;  1SNM A;  4FF4 A;  2JE6 I;  3G7L A;  2NVQ B;  2F0N A;  3C0M A;  5CMD A;  1BOS A;  3P1H A;  1QE6 A;  4CKE A;  3DUZ A;  1AFP A;  3ZYY X;  5C4J B;  1Y1W B;  4HCS A;  1ONL A;  4TKO B;  1ENF A;  4HMI A;  4DF7 A;  4ZK9 B;  1XWE A;  3PO2 B;  3W2D A;  3H91 A;  1DXM A;  3K59 A;  3S16 B;  1L0Y B;  1PZI D;  2CVR A;  4V0B A;  5AFW A;  1TU2 B;  1IHZ A;  2EYL A;  1OXX K;  3MAQ A;  4NP5 A;  3BDO A;  2NUC A;  3LWE A;  3D4D A;  2FFK B;  3C2P A;  5G3L D;  1A3V A;  3CKI B;  4IFD J;  3S2D B;  1MSH A;  4DK0 A;  3Q0A A;  3HG9 A;  4IAL A;  1TWG B;  1VF5 C;  2E75 C;  3SK5 A;  3QJY A;  1EY6 A;  1OO9 B;  2WII B;  1JCK B;  1QG7 A;  2OEO A;  4XXE A;  4Z9C B;  3NQT A;  3MXU A;  1LTI D;  1HHV A;  1WD0 A;  1W6J A;  2FMC A;  2F0E A;  4A3D B;  1PRT D;  3OIQ A;  1AN8 A;  3QOL A;  3I4L A;  3WOE A;  4IUP A;  2LFN A;  4BA2 I;  1KTK A;  3HEJ A;  4NMZ A;  3L7Z C;  4BY1 B;  2KHS A;  2NN6 I;  5HGT A;  1D2B A;  2C9O A;  2PQE A;  2EE1 A;  5JPN C;  2YYZ A;  1V1O A;  3SK8 A;  2XSC A;  2WKC A;  2R6G A;  1SYE A;  3M7G A;  2F0D A;  3QO2 A;  1PDQ A;  4X3T A;  3HS0 C;  3F2U A;  4U67 3;  1STY A;  1RTN A;  4XDX A;  3MXN A;  5CV8 A;  2HCC A;  2F1M A;  1I4Q A;  5EGT A;  4LJZ C;  4FVM A;  1KAA A;  1RD9 D;  3DEP A;  3PIO 3;  2A74 C;  2F4I A;  4PV1 C;  1OXV A;  1Z6H A;  1JWM D;  2K1B A;  2IX1 A;  1DJR D;  4RWS C;  1FYC A;  4XYQ A;  1PZJ D;  1MI2 A;  4KD3 A;  4F87 A;  4RFB A;  1ENA A;  1BDO A;  2L9H A;  5A2Q E;  1Q1B A;  1GUT A;  3J80 E;  1TQO A;  1JB3 A;  3VYS A;  4OHJ A;  4OO1 I;  4JBW A;  5ELF A;  2O2L D;  2RDG A;  1C4Q A;  4BS9 A;  5FKA C;  5M5W B;  3DM1 A;  1I4X A;  3J7A V;  2D2C C;  3T13 A;  1M8A A;  2RDF A;  1CHP D;  1S5E D;  5G3L F;  4K6L A;  1CTM A;  2B2T A;  2RSO A;  5CV6 A;  4PQX A;  5ELE A;  2G9H D;  3TDQ A;  3E6Z X;  2Y0S B;  3R8B A;  2CW0 D;  1AW7 A;  1TII D;  4K2K A;  3A56 A;  5M3F B;  2HDM A;  1SEB D;  5IIF A;  4DA2 A;  3AMU A;  2IW3 A;  3VYR A;  4XIG S;  1ZYR D;  1EY9 A;  4RHR A;  3J81 L;  5DEH A;  5D3I B;  3V96 A;  1IW7 D;  3NWS A;  1JWS D;  2B39 A;  3TZD A;  4DAP A;  1PYW D;  3HOZ B;  1WTP A;  5I4D A;  3GTG B;  2PW5 A;  4C1N I;  5KYL A;  4C56 C;  4XT1 B;  1WTV A;  2RKS A;  5DM7 3;  4CKB A;  4YIJ A;  1TY2 A;  4C3J G;  2B2W C;  4KMU C;  1CA6 A;  5EKL A;  4H0L C;  3M4O B;  4A93 B;  1MGS A;  1HRJ A;  4UDU C;  2KCC A;  1D5Z C;  2PZU A;  3PO3 B;  1KLU D;  3RUZ A;  4V19 0;  3VR3 A;  1SAP A;  3DWA A;  2MP1 A;  1ML0 D;  5EKK A;  2A6E D;  3MFG A;  4XQN A;  1KNA A;  2XRQ D;  5C0X G;  1H9M A;  4A3J B;  4KHV A;  1LT6 D;  1TWH B;  4FF3 A;  3A8K E;  5CV4 A;  1B9N A;  1C48 A;  5TSS A;  4A3I B;  4EQN A;  5FO9 B;  1ESR A;  1QJO A;  2EYM A;  4G4K A;  1BBX C;  1CZW A;  1U4M A;  4DU9 A;  4G7O C;  5IGC A;  4RA8 A;  5DAU A;  1LTB D;  4DN4 M;  3BVM A;  1STH A;  3VR2 A;  4HSV A;  1SNC A;  2PO4 A;  4CJ2 C;  1QB5 D;  2Z4I A;  4FXD A;  2F3V A;  2AUK A;  1LO5 D;  3VR5 A;  1IL8 A;  1EL0 A;  1O7Y A;  1V1P B;  5C5L A;  3G6J B;  1AZQ A;  3M7N A;  3GTP B;  3MTS A;  3K5M A;  1B1Z A;  3R93 A;  1DZ1 A;  3JAM E;  3RMH A;  3BDC A;  1RKN A;  3P7J A;  4QUC A;  1KLG D;  3MC0 B;  3GTQ B;  4C3I G;  4KJO A;  5M3M B;  3NTI A;  2QCP X;  4CKC A;  4U68 A;  1SDF A;  4C3H G;  2L5T A;  1ICW A;  2DY8 A;  1GUG A;  1LAB A;  2RA4 A;  2R93 B;  5E4W C;  2CHB D;  4J8Q A;  1VF7 A;  4EQP A;  1MBY A;  2KA7 A;  2A69 C;  1SNP A;  1NCV A;  1KAB A;  3SEB A;  4BBS B;  4EGV A;  2RDH A;  1EWC A;  1Y8N B;  2O5I C;  3Q6S A;  2EJF C;  1EYD A;  1K8M A;  3T16 A;  1DON A;  1B53 A;  1XX8 A;  4K14 A;  3PUW A;  1CZG A;  1LTS D;  2MHV A;  1HA5 A;  3SVM A;  2Z8L A;  5K36 G;  1SJE D;  4O1N A;  3FVQ A;  2EPB A;  3P20 A;  1K8O A;  5CV9 A;  4DXF A;  4FNF A;  4A3K B;  4IFD G;  3QG1 A;  1LTA D;  1BO0 A;  3S2H B;  2A6H C;  2K7V A;  3GTO B;  3SHL A;  4HTH A;  2N55 A;  5BN3 A;  5CV5 A;  2Q8T A;  1TT2 A;  2EYP A;  2HUG A;  1EWH A;  4KY6 A;  1OXS C;  3GV3 A;  1FR3 A;  2F0P A;  5J22 A;  4CHT B;  2IX0 A;  4BWG B;  2EYO A;  4C1N K;  1C8C A;  2ZXO A;  3A7L A;  3IL8 A;  2JEB I;  3R2T A;  4QUF A;  4DFA A;  5I9P A;  5D65 A;  2HQE A;  1NAP A;  2EOT A;  3KBG A;  1PMR A;  4ZQ3 A;  5KYI A;  1A3T A;  3RLF A;  4B9X A;  5ELB A;  4PNY A;  3H0G B;  2BE5 C;  2A68 C;  4IUV A;  2R3Z A;  1R4Q B;  2KEE A;  2JP1 A;  3OHX C;  1PRT B;  4XYO A;  2I46 A;  3ITP A;  3AB9 A;  3H09 A;  2WB1 B;  1PFN A;  3QOJ A;  2NB0 A;  1GUO A;  3NXW A;  3V2T A;  2B2Y A;  4KY7 A;  2L1B A;  2E74 C;  5LL6 S;  1HUM A;  5BN5 A;  4IUT A;  3GTK B;  3X3N A;  3J7A F;  1RCV D;  1PFM A;  2Q8I B;  3T4A C;  1I4R A;  4G7H C;  1V8Q A;  4K5V A;  2D5D A;  4IN3 A;  2AWO A;  3S9W A;  4KKT A;  3DXJ C;  2NTT A;  2DN8 A;  3Q24 A;  3K5O A;  5EKI A;  3VR6 A;  3TP5 A;  2L4N A;  4KTA A;  3SK6 A;  1HPC A;  4MHE A;  3MFY A;  2I07 B;  1FNV A;  4PMW A;  1I4G A;  4CJ0 B;  5CGK A;  1PTO C;  4ID6 A;  3A54 A;  2K32 A;  2DNE A;  1U9R A;  1KDC A;  4R8I A;  3OW7 A;  1SYG A;  1SNQ A;  1F2Z A;  2V4D A;  3PIP 3;  1WTO A;  3VA5 A;  1NR4 A;  4TSS A;  2LKV A;  1UAP A;  1PTO B;  1E2Z A;  1ET6 A;  1DOM A;  5EBD A;  3T51 B;  2HDL A;  2F03 A;  2EY5 A;  2K5W A;  4QMG A;  3NBI A;  4DXG A;  1G6Z A;  2X6G A;  3PV0 A;  2BE5 D;  1EEF D;  1W6K A;  4MIU A;  1WTX A;  4QB4 A;  3VYU A;  2AQ2 B;  3TP6 A;  1G91 A;  1WD1 A;  1BCP C;  2ZT9 C;  5BN4 A;  4R9W A;  4IUU A;  5A2Q L;  1GHK A;  4O42 A;  3J80 L;  4I7Z C;  4J1M A;  5FOB B;  1V1P A;  3ND9 A;  1STN A;  1LTG D;  2KVM A;  1ZXT A;  1FNU A;  2IJ0 A;  4BA1 I;  3GP7 A;  1Z47 A;  1F9P A;  1IYV A;  3NE5 B;  2B2U A;  2SNS A;  3O13 A;  4ZYS A;  2J4X A;  1HCZ A;  1CFM A;  1QCB D;  2F0K A;  4LAA A;  1Q1E A;  4A3B B;  1PRE A;  3TP7 A;  5K5P A;  3C1E A;  1XXG A;  1A15 A;  3UI2 A;  1SMY C;  2SDF A;  1RDP D;  2O5J C;  1EU3 A;  3WOF A;  2LY7 A;  3N52 A;  4KKU A;  3H6M A;  4QCL A;  1AP0 A;  4UAI A;  5C3X A;  3IFT A;  3I3C A;  3K7A B;  4WFN 3;  1D1K A;  5J39 A;  3GV6 A;  1Q90 A;  2J0T D;  3KK7 A;  2AQ1 B;  4RGM A;  2KED A;  1SYB A;  5F2D A;  3ONA B;  1CT1 D;  1PTO D;  2PYK A;  3OMC A;  1JOK A;  5JEA G;  3E5S A;  2HCI A;  5C4H A;  1R9T B;  1H9S B;  2SNM A;  2B2V A;  2LMC B;  1IYU A;  1JR0 D;  4QIW B;  1S4Z A;  1XYI A;  4KN7 C;  1UUP A;  1TVX A;  2XVS A;  2AUJ D;  1I6V C;  1DD2 A;  4DAV A;  1PXU A;  3NTK A;  2EYH A;  3I91 A;  3HKZ B;  3A7A B;  4RHS A;  3HZX A;  1SYC A;  2X6L A;  2L11 A;  3HOW B;  1B4O A;  4RGO S;  1AEX A;  2QDB A;  3HRZ C;  3IAY A;  2K33 A;  1VDZ A;  1HA6 A;  1CI3 M;  4XTC S;  4XQJ A;  5IGG A;  4OGQ C;  4B08 A;  3TZU A;  5D3D A;  2OXP A;  5C4Z A;  1D5X C;  1VMP A;  2E2H B;  4ILW A;  2PZT A;  3AU7 A;  2G9D A;  1EZ8 A;  2NYZ D;  5KIX A;  1CA5 A;  1EEI D;  2F0J A;  3MXG A;  4EQO A;  2NVT B;  1PRT F;  2KOL A;  5EJW A;  3QIA A;  1FGB D;  4KI0 A;  5C44 B;  2F0O A;  2JA5 B;  1F9S A;  3HP3 A;  5EPJ A;  2JXM B;  5KND A;  3D8G A;  1EYC A;  3C3L A;  1BXT A;  5M9O A;  2WAQ B;  3G4N A;  5E4X A;  1HQM C;  3I72 A;  4RCN A;  3RD4 A;  1V43 A;  5DNF A;  2EJM A;  5C4X B;  1BUV T;  1SMY D;  1O7L A;  1PFB A;  1EY0 A;  4GZY C;  4IUR A;  5EBC A;  3D4R A;  5JVG 3;  3S15 B;  5C0X H;  3RZD B;  3HOY B;  3JAM L;  2NZ1 D;  2WIN B;  3QB3 A;  3M3Y B;  5CC4 A;  3CHB D;  1SFO B;  4BY7 B;  3V05 A;  4K8J A;  3MEH A;  4X3S A;  3BVZ A;  2K05 A;  3R3O A;  5A35 A;  1VMC A;  4HN7 A;  5JAV A;  5EQ0 A;  2R92 B;  4Y7N B;  1NR2 A;  2K01 A;  1LT3 D;  3IKJ A;  3VR4 A;  5D14 A;  3GTM B;  3FDT A;  1Y69 U;  5EPK A;  3FMC A;  3NHH A;  1EY4 A;  1EIH A;  1I50 B;  3KUP A;  1S5C D;  4K5X A;  3NWT A;  4KK7 A;  5I6Y A;  3H94 A;  1PTO F;  2NN6 G;  2X69 A;  2E2D C;  1D5M C;  2JA8 B;  1DM0 B;  4N9T A;  3CRK C;  3FPP A;  3OOC A;  1GHJ A;  3OPO A;  1TS5 A;  1MD2 D;  1TR5 A;  4KKS A;  4OIJ A;  1J9O A;  4FP5 D;  2ENB A;  4LMQ D;  2B8F A;  3A8J E;  5IGE A;  4A3F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...