1PTOC

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoC01
1LT5D 1TS2A 1PTOC 2AQ2B 4TSSA 1HXYD 2WV6D 1GOZA 1L0YB 3OWEB 1I4HA 1SE2A 1ENFA 1D5MC 1TS5A 1BCPD 1AN8A 3G4OA 1S5ED 2TSSA 1I4XA 4Z9CB 1L0XB 4RHSA 1JWMD 1LTID 3BVMA 1EEFD 2SEBD 1CHQD 1I4PA 3MFGA 1LTRD 1CHPD 1FD7D 4BWGB 1AW7A 1HQRD 4RGMA 1ET9A 5ELBA 1XXGA 1PTOB 1JR0D 1QILA 1LTGD 2RDGA 4C56C 1SE3A 1JWSD 1FNWA 1S5BD 4RGOS 2CHBD 1V1PB 1S5DD 2ICIA 1FGBD 1F77A 1EU3A 2O2LD 5ELCA 3BVZA 3BZDB 1RF2D 1B1ZA 1PTOD 4RGTA 1S5FD 1BCPF 3R8BA 3BYTB 3EFXD 3TSSA 1JCKB 1D6EC 1LTAD 1Z52A 3DWQA 1LT3D 1HTLD 1SE4A 1EEID 4K6LA 2NTTA 1KTKA 1STEA 1LT6D 2IPKD 1TY0A 1CQVA 1PRTF 3KLSX 1LTBD 2RDHA 1TS3A 2QEJC 5D3IB 1UNSA 5I4DA 1LO5D 3BVGA 2J4XA 1PTOH 1TS4A 1EU4A 1ET6A 5FKAC 3V05A 1BXTA 2AQ1B 1S5CD 1SEBD 1PREA 4UDUC 3SEBA 2R61A 3MC0B 5ELFA 3R2TA 1LT4D 1ESFA 3BYYB 4O1NA 1RCVD 1G8ZD 1RDPD 1SJED 2AQ3B 1V1PA 3GP7A 3EA6A 1EFID 1T5XD 1I4RA 1D5XC 1SXTA 1PZKD 2XNAC 1I4QA 1V1OA 2XN9C 5TSSA 2NTSA 2XRSD 5FK9C 1KLUD 1B44D 1KLGD 1TY2A 2Z8LA 3DWAA 4RH6A 1PYWD 1UUPA 1PZJD 5ELDA 1LTTD 4RCOA 3DWPA 2QILA 1D5ZC 1EWCA 1CT1D 1DYQA 3C0NA 2XRQD 4DXGA 3G4NA 1LLRD 5ELEA 1HA5A 1FNUA 1PZID 2G9HD 4ZYSA 1MD2D 1JQYD 1CK1A 1M4VA 1LTSD 1RD9D 1PTOF 1DJRD 1BCPC 1I4GA 1PRTB 1SJHD 3O13A 1JWUD 4RFBA 4RGNA 3CHBD 5D3DA 4DXFA 1XTCD 1FNVA 1SBBB 3C0OA 4L6TB 3URYA 1PRTC 1PRTD 4RHRA 4L63B 3R2IA 2IJ0A 3C0MA 4OHJA 1BCPB 3W2DA
chains in the Genus database with same CATH superfamily
2AUJD 2OEOA 5M3MB 3PO3H 1SMYD 4C2MH 5LMUQ 2WAQG 3T1HL 3I73A 4NXNL 5JEAG 1A0IA 2RA4A 4IUTA 1WJJA 3J7AV 1KDCA 5BN5A 3AU7A 1Q81C 1S3OA 2MUYA 4HJ8A 2B63B 2BDNA 2IW3A 4B08A 1ZKOA 2A6HD 2MFIA 3TMEA 1XMOQ 2WAQE 4MHEA 1VQBA 4A3LH 3KLRA 2PO4A 2ICIA 5EPLA 2PZUA 4JI2L 4L5QA 2H5XA 1GUSA 3OYYA 4DKAC 4ZQ3A 4GNXB 1F9SA 3DWQA 1HCZA 1PH2A 2DUDA 1BKBA 3KJPA 1TY0A 3I72A 4R8IA 4NW2A 2QEJC 3FDTA 1IKMA 2CFMA 4JBKA 5JJIA 1EL0A 5HURA 2ES2A 3A7AB 3ICEA 1RKNA 1EU4A 3HS0C 2EYOA 5IYBG 4CKEA 1W6KA 1Y1WB 1SEBD 2PI2E 3SK8A 3MHBA 4BY1B 3MEFA 1ESFA 2KCNA 2ZTCA 3GTGH 4KY7A 2FXQA 3OWFA 4ULLA 1QG7A 2UXBL 1D5XC 1LABA 1CKNA 4Y7NH 5I9OA 3GTQH 3H3VH 1Q7YC 2WFWA 1ENAA 4CBVA 1KLGD 4KJNA 1GUGA 1NUCA 2EXZA 4X64Q 2K03A 1GXDC 4DV2L 2HHHL 1ICFB 4P74A 1SFOB 4LFBQ 1DYQA 4A3BH 1KRSA 4JYAQ 4A76A 2MO0A 4ZYSA 2M9VA 4KK7A 2VUMB 1N9WA 3HFZB 4X3KA 1FYCA 3HKSA 4BY7B 1OXTA 1JMCA 2K4KA 1HTPA 3KUPA 4OELB 1M90C 1SBBB 3IKJA 2ALYB 3NBIA 4XT3B 1OXUA 2R6GA 2A19A 1U4MA 4LJZC 1II3A 2HIXA 3SE0A 4A3KB 5M3MG 4FP5D 1BNZA 2WKCA 1KXLA 2AWNA 3T4AC 4KKUA 2NVTH 3KK7A 3DLLA 3TS0A 3NEMA 1HXYD 5H1SE 1QB5D 1W6JA 4H13C 1B3QA 1SE2A 4YCUA 3MWYW 4HCEA 4Z9CB 1TR5A 1JB7A 1EEFD 1BBUA 1WTWA 2B63G 4NKLA 2I5HA 3QOLA 2RSOA 3MFGA 2VQEL 4LUZA 1FD7D 4ZKBB 2V4DA 4E6IA 3HRZC 5FJ8G 2QA4A 2LSSA 5IGCA 4FXKC 5EBDA 2A5HA 4IUNA 5KYLA 3GTOB 1PH9A 1SSOA 3GTJH 3K80C 3M85A 1ONLA 1VQ7A 1WFQA 3RMHA 3RLNA 1QVGA 4Q5VA 4LFAQ 2VQFQ 1Q3LA 3EFXD 1WOCA 5CORA 1ZYRC 1YIJA 1N32Q 5CV4A 1KD1C 3HOUH 1I3QH 1X56A 3ULLA 1O80A 5IODA 3C46A 4I7ZC 4RKBA 3VDYA 1PRTF 2FMMA 4KLKA 5D3IB 2YTYA 4YIJA 4OO1H 3GV3A 1YJNA 1LO5D 3CRLC 4O42A 3UI2A 2E2DC 3GV6A 4DV6L 3OIPA 4LUOA 5E3FA 1HZAA 1Y1WG 2IX0A 3TBIB 1ICWA 1O7ZA 4BY1G 2Z6KC 3DEPA 3MC0B 4KHZA 5E4WC 3T1YQ 1NJIC 1SNPA 3AYHB 1SJED 1E22A 1V1PA 3KBGA 3TDQA 1I4QA 5C6AA 4DV4L 1A3TA 2NTSA 4BXXG 1EZ6A 2QDBA 3NE5B 4IALA 1GM5A 3LGJA 1KDBA 1NAPA 5GROA 1PYWD 2J7ZA 4KD3A 4F7XA 1NBWA 3S2HH 1CT1D 4S3SA 3CCSA 3G4NA 2VUMG 4B9WA 1A2TA 1MD2D 2AUKA 1EUJA 1LTSD 1DJRD 2Z6KA 1WTQA 4BY7G 3W1GA 3R3OA 4GN5A 2UXDL 3OSOA 1STNA 4PMBA 3UDFA 2Z1CA 1EQQA 1C7YA 3E9IA 5IYDH 4CDDC 3RZDH 1SR3A 4QMGA 4M1UB 4BBSH 1PRTC 1GUTA 5JOBA 4DUYL 1EIYB 3R2IA 3C3LA 3AB9A 1JOOA 1PH7A 2O5IC 3D0FA 4B3ML 3IFDA 1PH5A 1PTOC 4DK0A 2K33A 3FKIH 3T53B 1XNRQ 4GS3A 1VQ4A 2F0UA 1EY9A 2RHQB 3ERQA 2L4NA 2TSSA 3G4OA 4FF2A 2SEBD 4IJLA 5DNFA 1Y8PB 3OHXC 1MBYA 4LF7L 2KHJA 2BH8A 1D1KA 3K58A 3DEOA 1O7LA 3QG1A 2PPBC 3E5SA 1TWCH 2CW0C 4DV0Q 1HNXQ 2N55A 2CKZB 1CKMA 3S1QH 2NN6I 5G3LF 2R92B 4P71A 3CPFA 1TWFH 3ZJYC 3GTGB 5IIFA 4A3JH 1KNAA 3STBD 2JA8B 1LTAD 1QJOA 1JJGA 2EYFA 3GTQB 2OXPA 3J81i 3HZXA 1STEA 4GLAC 4A93B 1G2SA 3J80i 3P7JA 3A55A 2MO1A 3T1HQ 2K5WA 4NXNQ 2D5DA 3OMGA 2F52A 4A3GH 3K7AB 1Z47A 1N33L 3VR5A 1L2FA 1HUNA 2BDOA 3PCOB 5HGQA 1F9QA 4OWTB 1VQ8A 1VQ9A 4N9PA 1NSNS 3I4OA 1NR2A 2F0PA 2K75A 3J81E 1YZ6A 1RDPD 2KQ3A 5EJWA 4QY7A 4DV7Q 4R8NA 1BBWA 2BOSA 2VL6A 3PO3G 2KVMA 4JI2Q 4GKJQ 2ENBA 5T1GA 2F3VA 5IWAQ 1EWCA 2CH4W 4LF6Q 1X55A 2A69C 3Q23A 2B8FA 1AEXA 4ABNA 5ELOA 2B2VC 2MHVA 1RJTA 4LF5L 1YITA 1GJXA 2KBNA 1KIXA 4HMJA 4MZ9A 4DR2L 4IUUA 4C3HB 1PH8A 3L7ZC 1U4PA 4ZKCB 2LY7A 4L6TB 1X3GA 2UUAQ 2YV5A 3A0JA 4K6DA 3D6WA 2PQAA 3E0JA 3SK6A 3W2DA 4IFDG 1I6HH 3SDZA 2F0FA 3RUZA 2B2VA 1UE5A 4X62Q 2UXBQ 3FP9A 3K5NA 3A8IE 4WJ3M 3HOUB 5CBEE 1RTNA 2F0NA 3DUZA 5CMDA 4JC0A 4H02A 3U9OA 2HHHQ 5DM63 3K0XA 3G4SA 1CHPD 3CCEA 1GHKA 1E2WA 2EYJA 2JEAI 1ET9A 1X3PA 3D8GA 2ICEC 5C3EB 3HOWH 1H95A 3SK5A 1DD2A 2R92G 2K05A 2K5QA 1HZCA 5NUCA 5E4XA 2JP1A 3CMEA 4IZ8A 1BOSA 3H6MA 4LW1A 4JI6L 2F0DA 2JA8G 1B1ZA 4H7BA 2F0TA 4KD4A 5DAUA 1EIGA 1B9NA 5D14A 1HTLD 4UP8A 1XPRA 4IPGA 4KHPL 1LACA 1I6VC 3HEJA 3P20A 4DV1L 3PV0A 4K2KA 1CQVA 2WACA 1L0WA 4A3BG 3TQYA 3S2HB 1EIFA 3NTHA 2AWOA 1H9SB 1XX8A 4EQNA 1S5CD 3S2DH 1QVFA 2RQXA 3OIQA 2VQEQ 1M1KC 4I7AA 3RZDB 3I70A 3PUXA 2AQ3B 4KTAA 3EROA 2XNAC 1J5EL 1V1OA 2F0QA 3UE0A 1EY0A 3HKZG 5CGKA 2F0MA 3DWAA 3WDNA 1TWAB 2A6ED 3TREA 1DZ1A 1YNNC 3Q22A 4J1MA 3FKIB 5ELEA 3MXNA 1B50A 4XQQA 4G7ZC 2HD3A 4UP9A 1WCMB 1WYDA 2EYLA 3VYUA 4C3JH 2HCIA 4C3HG 5EPKA 3VR3A 3A7LA 1IYVA 2KA7A 3MXPA 1EOTA 1GHJA 3HOZH 2QKIC 4DV6Q 4ALPA 3GTPB 5DEHA 1G291 1C4QA 1PRTD 3NQTA 4RHRA 5C5LA 2BCOA 2F0KA 2N8NA 1E1TA 3Q0AA 1EQVA 3TZUA 1TWFB 1SLJA 1PDQA 4KMUC 3HOUG 2AQ2B 4TSSA 1CKOA 4TRDA 5C0XG 4JK1C 1PVOA 4U68A 5I2XA 1VQMA 3AFQA 3ER0A 1G2TA 2MNAA 3RNUA 2L15A 2NVYB 2DNEA 4K8IA 4A3GB 4DAVA 5HGTA 5K36H 1R4PB 1HR0L 4HJ5A 4A3MB 5EPJA 1UE6A 1JWSD 2N3SA 1LYLA 3S17H 3CKIB 4LF4Q 3J81c 1FGBD 1EU3A 1CA5A 3I4LA 1JCKB 4QB4A 2F0OA 4DUYQ 2F0VA 4OONA 4DK1A 4DAYA 4A4IA 1OXVA 4B3MQ 5IP7H 2PMZB 4FYDA 3GTLB 2PI2A 1IXRA 2H4OA 3SXHA 3TP5A 2AQ1B 2EY6A 2BE5C 1JOKA 3EIVA 5IYDG 4LF7Q 2A68D 3TRZA 1IW7C 2JN4A 4ZRZA 4DAMA 5JJLA 1VQPA 1DCZA 3I2ZA 2ID0A 3NBHB 3CC4A 1Y1VB 3KDFB 3N52A 2O4XA 2Z4HA 4DNRB 1OTCA 1UUPA 1I6HB 4K5WA 2CVRA 2QILA 1D5ZC 3FKIG 3S9WA 3ERSX 3BG3A 1WVLA 4YCWA 5G3LD 3D3RA 1PZID 2G9HD 3MXGA 3KLSA 3RD4A 1WCMG 1CK1A 3D31A 3KF8A 4ZLTF 3S15H 4B3SL 1MIUA 1SJHD 1SRUA 1IL2A 2KUMA 5IGBA 1AZQA 2WB1B 4CDCC 3MA2B 2KOLA 1N33Q 1B2TA 3I4MH 1EQRA 3EJIA 4QUCA 3K57A 2FMCA 2C35B 1YI2A 2YU9H 1PFMA 2K5DA 3J81j 3I7FA 4MTNA 3BDLA 3CRKC 1PYSB 1VQHA 1ENFA 1BCPD 4NPSA 2NUCA 3KFUA 1SNCA 4CKBA 1UEBA 1K8AC 1EZ8A 2XSCA 3DXJC 1VQEA 4A3GG 2ZJRA 1HPCA 1A3UA 2PW7A 2ZTEA 1EYGA 1HZ9A 2L12A 4GNXC 3K8AA 4RGMA 4LF5Q 5ELBA 4A3MG 5D65A 2JEBI 1JR0D 1LTGD 1K3BC 1FNWA 1AH9A 2CHBD 4QCLA 2C5CA 3JAMi 4FF4A 4DR2Q 2NBFA 4HSVA 1TWHH 5ELCA 2WP8J 2NN6H 2EDGA 4NDXA 4X66L 3PF4A 4JI1L 4AH6A 2EY5A 1VQNA 4JG2A 4LNQA 1TT2A 3KOJA 1PV4A 5GADC 1EOVA 3CCRA 2ASBA 4GNXA 2JA7H 3S1RH 1WTOA 2F0HA 3MXUA 1TS4A 4C3JB 1IBKL 4K14A 1TWGH 3J7AF 1GUOA 3HOZB 1DM0B 1RCVD 2PMZE 1YNJD 1NNXA 1H9RA 4DR7L 3EA6A 4XYQA 2RCNA 3QB3A 5LHY1 1Y1VG 2N78A 3C1EA 4PNYA 2YTVA 4APVA 4R4CA 2D9UA 4G7OC 3AEVA 1TKWB 1K8MA 4YWMA 2JA9A 3L3OC 2R7ZH 2DJGC 1FNUA 4LF8Q 1X65A 4KHPQ 2HDLA 4DV1Q 3W1BA 2PYKA 1U9RA 2NWGA 3UDGA 4IO9A 3PO2H 4DGZA 2K5NA 2IT1A 4YHHL 3K0YA 2WB1G 5ELNA 3NQIA 4BBRB 5I6WA 1CZGA 1GD7A 1WTPA 3M3YH 3UDIA 4JI7L 5EGTA 1CI3M 5M9OA 1EY7A 3HOWG 3S14B 1DGSA 1V43A 2J0TD 4A3CH 4PQXA 4O0AA 2WB1E 5DM73 4B3RL 3VR2A 4JI5L 2D0OA 1J5EQ 3RLFA 1TS5A 3HP3A 3F2UA 1I4XA 1JJCB 4ME3A 4GLXA 3AMUA 1STBA 2UUCL 1PLFA 1HQRD 1QCBD 4WJWA 1BF4A 1A8VA 1KAWA 2Z4IA 1DOMA 1SYFA 1XPUA 3CCMA 3FPPA 4RGTA 1S5FD 3KLWA 3VYSA 4GZYC 2FFKB 1K9MC 4OL7A 2JA6H 1RIPA 5C4HA 1Z52A 1EEID 5IP9H 4K6LA 2QCPX 1KTKA 1LT6D 1M8AA 3H09A 2D2CC 2NVXH 5CBAE 5LMNW 1CA6A 2KJXA 1KC8C 2YYZA 1SROA 2KEEA 3BZKA 4HAEA 4YWLA 4C3JG 1MJCA 3S15B 5EBCA 2YTXA 3A54A 1Y14B 5M5XH 2DJFC 3HOZG 1N8RC 4UY8C 1IW7D 4DU9A 5CC4A 1HR0Q 3E0EA 3I4MB 3EQLC 2XN9C 1D8LA 3TZDA 1D2BA 2YU9B 4HMIA 3HOXH 4RH6A 3N6RA 5IGFA 3OTOL 1S4ZA 2V1CC 3M4PA 3CCQA 2JA5B 3C0NA 1Y8NB 3SVMA 4DXGA 3U9SA 1A62A 1HA5A 1VCIA 3S1NH 4IOAA 2EJFC 5FLMH 3PIPA 3S16B 1VQGA 1PTOF 4KI0A 4LF9L 3VYRA 4BBRG 2L11A 4BS9A 1N34Q 2DY8A 4WJ4A 1FNVA 3ND8A 2JXMB 1I5FA 2NVQB 3K81C 4JCVE 4PG3A 3C0MA 1VF7A 3F2DA 3PO3B 1VQAA 4C2MB 2MGSA 5E7NA 3NHHA 4XQNA 1SYEA 1S72A 5GAEC 3A5UA 4UHVA 2JYOA 5IT9E 1AN8A 4A75A 4J15A 4G7HC 4AQYL 5M5YH 1QOHA 3NXWA 1K3RA 1VQ6A 4CJ0B 4JOIC 5GAGC 3CP0A 3I56A 3J81L 4JV5L 2MPMA 4X65L 2F3WA 5COYA 4CDEC 1H9MA 4MTKA 2EJGC 3CF5A 4B3SQ 2LFNA 3HGBA 1V1PB 4ZAIA 1F9PA 1IHZA 4PZ8A 3I91A 2EYHA 3BZDB 1RF2D 2OCEA 1TU2B 1YHAA 2PNHA 5JAVA 3BYTB 5KEEA 2F0LA 4K5VA 1D7QA 2Z0SA 3GDEA 2ZT9C 3JC66 4DR4Q 4JOIA 5KYIA 3J7ZC 1YJ9A 1R9TH 2A74C 1H9JA 3NTKA 2R7ZB 3E3XA 2QEXA 1YBYA 2MP1A 4M8AA 1XNQL 3PO2B 2NB0A 2IWHA 3M3YB 4NMZA 1QUQB 5JEAJ 1SNDA 1ZEQX 3I4MG 3FVQA 4X3TA 4Y7NB 2GA4B 1PZKD 4G4KA 2ZXOA 2D62A 1KNEA 4MIUA 1KQSA 3U58A 3SK4A 4X6AH 1GKHA 4JI3L 3I55A 2JA5G 4A3BB 1PFSA 3DMUA 4X66Q 3PUYA 4C1NK 2EXDA 1LLRD 4JVZA 1F2YA 5M5WH 3H0GH 4JI1Q 3PSIA 4OWXB 1RD9D 4IUVA 5K5PA 1LM0A 1PRTB 3GTMH 4IOCA 2G9DA 3RN2A 3DM1A 4OX9L 4XDXA 1CZWA 4C1NI 2K01A 2ZM6L 3J80E 5IGEA 4KN4C 1D1IA 3HKZB 2XWBB 1IBKQ 5EQ0A 1SE8A 4R4OA 4EQOA 1V1QA 5FO8B 4IFDI 4HIDA 2NVTB 2QDLA 4DN4M 4RWSC 3F8TA 1LT5D 4DR7Q 4KKTA 2VB2X 2EJMA 1GOZA 3TP6A 1KDAA 1Z6HA 1OXXK 5JEAH 2F0GA 2PZWA 3LNNA 4RHSA 2KHSA 4NXML 4FXDA 1KRTA 1O7YA 4DV3L 3BDCA 5C3XA 1W2BA 2UXCL 1PYBA 4A3LG 1HJPA 3PIOA 5IOCA 2RDGA 4R4QA 3X3MA 3NK9A 4OIJA 3GTJB 2JJQA 5M5XB 4HEDA 3D6CA 4YHHQ 3BJUA 1HNWL 1S5DD 1HRJA 2O2LD 2E2HH 2NYZD 1RL2A 4JI7Q 4RMFA 1I3QB 1WD0A 4G57A 3K59A 4WFN3 4HIOA 2NTTA 3G48A 3I90A 4DV2Q 4OEMB 4GLVB 1WD1A 1SNOA 2R7ZG 4L5RC 3PF5A 1WI5A 4B3RQ 1JICA 1E7ZA 4JI5Q 5GQOA 4OWWB 2UU9L 2BH2A 3HOVH 2H1EA 1SNMA 2EE1A 4LFCL 3CCLA 3PO2G 1Q8IA 3K5OA 1STHA 4IPDA 1XPOA 5FO7B 2OTJA 2EVBA 4B3TL 4FXGC 3V2TA 3W3AA 5IYBH 2EY1A 2Q8IB 2UUCQ 4GN4B 2Y0SG 1H9SA 1ZYRD 4IUQA 1G8ZD 4TVAB 1T5XD 3OOCA 4GOPB 1NMFA 4HIKA 1UE1A 5TSSA 1KLUD 3Q24A 1JORA 4H44C 3OW7A 3KF6B 2CCZA 1K8OA 1SMYC 2XRQD 5IT9c 1X3FA 3RZOH 1XTDA 1HUMA 5C5MA 5M5YB 4EQPA 2HQEA 1Q1BA 4RGNA 3CHBD 2L55A 4BBSB 1MGSA 4FNFA 5J39A 5J3BA 4FVMA 2A6HC 3URYA 1NE3A 2R7DA 1G91A 2L0CA 3NUCA 1U5KA 2RHSB 4FF1A 1RODA 4OHJA 1BCPB 1X3EA 1F9RA 2OQKA 4QIWB 2IY5B 3RN5A 1DOKA 1HNZL 2EZVA 5IP9G 3IRBA 4POFA 5C0XI 3BDOA 3GTKH 1MSGA 1PXUA 1UAPA 1I94L 3HKZE 2IX3A 3OTOQ 1C9OA 1LTRD 4K0KL 2DNCA 1AW7A 1TWCB 1X32A 3QOJA 2ZTDA 3AQQA 4U673 3S1QB 4J6HA 3CCJA 4LF9Q 1E24A 3FEWX 5JPNC 4JPBW 4A3JB 3BVZA 4JI4L 1PTOD 1YJWA 4DV4Q 1A6XA 3D4WA 3HOXG 1N36L 3M4OH 4OO1G 3KLSX 1PH3A 1TS3A 1NR4A 1UNSA 4A3FH 1BVSA 1Z7TA 5M5WB 2CW0D 1X9NA 2UXDQ 3BZCA 4AQYQ 2K5VA 4F88A 1Y1WH 3GTMB 3R2TA 5AJ3L 4R1JA 3J80c 4JV5Q 4X65Q 4LK1C 4IN3A 1SXTA 1ASZA 2VQFL 2KHIA 1BQQT 2XRSD 5A2QL 4PMCA 1CM9A 1PZJD 1XMQL 2R7FA 3NBHA 1SFOH 3KDFA 1MSHA 4DR6L 3BS1A 4NP5A 4GKKL 2VUMH 1XWEA 4PV1C 4DNTB 3O13A 4ZUIA 1RHPA 4BBSG 3D4DA 4YCVA 1E0BA 2JQOA 3LX0A 2KCMA 3M7GA 5CYUA 1G6ZA 1VQDA 1XNQQ 2A1AA 4A3IH 1CSPA 1C8CA 3T13A 4A3KH 4Q0FA 2EY2A 2K50A 4KJOA 1PFNA 2SDFA 2A69D 1TS2A 4QJFA 5FOBB 5JJZA 3OWEB 4JW0A 5C4JH 3QIAA 4XIGS 4ZK9B 2OTLA 4V190 4JI3Q 2K5HA 1YHQA 4CDFC 3TN2A 4DR5L 3TS2A 4BWGB 2JE6I 4QIWE 3F2BA 2N88A 3CW2C 3HOWB 3HOVB 2VY3A 2I46A 2MQHA 3MVVA 5KNDA 4IQZA 2E5LL 4RGOS 3L9AX 3K5MA 1C48A 1B70B 1MI2A 4EQ5A 4A3JG 3CD6A 3WOFA 3GTOH 4OX9Q 1IZ6A 2D0PA 2NZOA 3EN2A 2ZM6Q 2LKVA 3MZ5A 5KNCA 1SYBA 3D4RA 5A2QE 5C3WA 4FO2A 4P72A 1CQFA 5M3FH 5KGUA 5IYCH 2E8GA 4RG1A 3T56B 2RDHA 3G7LA 2Q8TA 3J7YW 1ILPA 5I4DA 3H0GG 1ZXTA 2EQSA 2J4XA 2VB3X 2XWJB 3RZOB 4JBMA 2HT1A 4LWCA 3S2DB 2WKDA 3M9BA 5FKAC 4ODGA 1O78A 3FPUB 5C4ZA 4IFDJ 1G51A 3SEBA 3CU7A 4DV3Q 1IBLL 2Z9HA 3K7UC 4KV6A 4F8MA 4LMQD 2UXCQ 1L1OB 2X6GA 4L5TA 4O1NA 2MJ8A 4B9XA 1AP0A 5C44H 2ZJPA 3P75A 1X3QA 1CUKA 2SNMA 2I0QA 3ONAB 1IKLA 5CR3A 1TY2A 4DR1L 3WWVA 1QVCA 1G6PA 1SYCA 3NWTA 3JAME 2LXKA 1JQYD 1T9HA 1V8QA 2LMCB 3GTKB 3CC7A 4HN7A 3CMAA 1JOQA 1U4LA 4ILWA 4L8JA 5EAYA 2K52A 2L1BA 1XTCD 4FF3A 3C0OA 2UU9Q 1HH2P 3BU2A 5FLXL 4LFCQ 2F0IA 4DV7L 1X54A 4B3TQ 1YNND 5CV8A 4JI6Q 1J8IA 4A3EH 4ID6A 1SN8A 1GO3E 2F1MA 3VA5A 2XIWA 5IE8A 4QGUA 1DXMA 4GKJL 2F3IA 2WIIB 4IFDH 2FINB 5IWAL 3STBC 1L0YB 1I4HA 4EVOA 3RLOA 4LF6L 3M4OB 4DAPA 2RCFA 4CJ1B 1VQLA 1YNXA 5C4XH 2Z6BA 3T51B 1I4PA 4QUFA 1EQTA 1B8AA 1YVCA 4A3FB 4Y52H 3HOVG 2LS01 1IYUA 1ILQA 1Q12A 2RVLA 1NY4A 4KY5A 5BN4A 1QILA 3S17B 5I2YA 2UUAL 4DR3L 1S5BD 2F4VL 1TQOA 1QE6A 2XGTA 2F0WA 3IL8A 2R92H 1ESRA 2JA8H 4X62L 3ITPA 4A3DH 1F2ZA 2IHEA 3Q8DA 4CKCA 3S1MH 3LWUA 5CV9A 4A93H 3Q6SA 1HNZQ 4IPHA 1Z9FA 2R93H 4JBWA 2KENA 2SOBA 1PTOH 1I94Q 2F0SA 3K7AH 1STYA 1FJGL 3V05A 1PREA 4DK3C 1A15A 2WINB 1CKNB 2K04A 4N8FA 3M4QA 2E75C 4MN3A 4UAIA 4K0KQ 3HOYH 5FLXE 5L37A 1JT8A 3V96A 2EYPA 5C0XJ 2PZTA 2LXJA 5IT9L 1EYAA 2C9OA 4A3IB 4XTCS 2OT2A 1AZPA 1SAPA 1VMCA 4JI4Q 2EPBA 5IGDA 1J9OA 3RR5A 1NTGA 4C3IH 2KEDA 3PUZA 5C4JB 1ML0D 1N36Q 4CHTB 2O5JC 1IL8A 1JE5A 3A5ZB 2BE5D 3FHWA 1AFPA 1JWUD 4HCSA 4DV5L 1BO0A 3ULPA 3OPOA 4C3HH 3NPPA 1B7YB 1HQMC 2DGYA 3A74A 1TXYA 5BR8L 3S24A 4AYBB 3GD7A 1PFBA 2IJ0A 5LL6S 3G6JB 5AJ3Q 3H94A 3L0OA 1B53A 2AHOB 1J6QA 2EOTA 2TMPA 4WRDA 3G6EA 3VR6A 4QF4A 2WV6D 4HR7B 1RTOA 4KY6A 5M3FB 1HA6A 1JWMD 1LTID 1QNKA 1K83H 1CHQD 4YWKA 2VW9A 5C0XH 5LMNL 4A3FG 4EGVA 1VS0A 1XMQQ 2DY7A 5K36G 5DLQE 1OXSC 4KN7C 3PGZA 1ENCA 4DR6Q 1XXGA 2HQLA 3QWNA 3M4YA 3F1ZA 4MNOA 3K5LA 1SE3A 4OGQC 4GKKQ 5C3EH 1UEAB 1TWHB 4RAUC 1KL9A 1A2UA 3HG9A 1O7IA 2M2LA 2K6AA 5C44B 2RSNA 4GN3B 1BR9A 1Q8KA 3DM3A 4AIMA 1EIHA 3G71A 3GO5A 5IP7G 4I65A 1P16A 4H0LC 2JA7B 3S1RB 1Q90A 5JPMC 4JI0L 3JAMc 2A6EC 2ATWA 2K28A 1VMPA 4DF7A 2F03A 3H3VC 1WTHA 1VQFA 4XYOA 4ZUJA 4JI8L 3L2PA 1TIID 2B2TC 3J80L 3SHLA 4KKSA 5FO9B 2XVSA 2DN8A 1TWGB 5AFWA 3VA7A 1BXTA 3I3CA 3PMFA 3NP8A 4DUZL 3H15A 5ELFA 4DR5Q 3A8KE 2BA0A 4KHVA 1VQCA 1HZBA 4LF4L 3CQZH 1A63A 1P8LA 2OWOA 4J8QA 1I4RA 2CQOA 2K7VA 4A3IG 1LTLA 1SDFA 3U50C 1LUZA 2E5LQ 4A3KG 5FK9C 1QUQA 2VZAA 3I4NH 4A3EB 4DK6C 4OIKA 4ZCKA 1TWAH 5CV6A 1Y8OB 2B2TA 4DFAA 1IBML 1V9PA 1EYCA 3PUVA 4XT1B 2CQAA 1M4VA 2AKWB 5C4XB 1NMGA 2GVAA 1WCMH 5JJKA 3CPWA 2Y0SB 4DXFA 2QGQA 2R3ZA 2X6LA 4AYBG 3GTPH 5CV5A 1IBLQ 1XJVA 4POGA 4YY3L 1FR3A 4FDBA 2CH4A 4WORA 2E2IH 4N8X1 3NSWA 5M3FG 4A3DB 5IYCG 1EWHA 4IURA 4R4TA 3W5OA 4AYBE 2GVBA 4DR1Q 5F2DA 3S1MB 3CAMA 2X69A 2R93B 2KCCA 3IFTA 3PIP3 2NVYH 1PTOB 1FVIA 1BBXC 1E1OA 2JK8A 2B8GA 4QL5A 1HFGA 1F2LA 2K1BA 1GUWA 4A3MH 2NZ1D 2NN6G 3CCUA 5FLXc 1F77A 5C44G 3HOYB 2A68C 2HCCA 2Q8RE 1BCPF 2JA6B 3TSSA 4X3SA 1BUVT 3C2PA 3EVQA 5KIXA 3TEHB 1SE4A 2B2YC 2QW7A 2JA7G 2PCFB 2QF7A 2UUBL 2NVXB 1FGUA 1SNQA 2B2UC 1A3VA 1Q82C 2F4IA 3BVGA 4HTHA 4C3IB 1E2ZA 4GOPC 5JVG3 1I50H 2I07B 3MEHA 3GTLH 1QWYA 3QO2A 2Q2IA 2R61A 1QZHA 4DPGA 4N9TA 2HIVA 1EY6A 3H3VI 5LMUL 2B2YA 1SMXA 2F4VQ 4DR3Q 3HOXB 1Q86C 5T1IA 3MTSA 3PQIA 4A3EG 1WTVA 2Z8LA 3UE1A 2B2UA 1DONA 1UE7A 1Y1VH 5EKIA 2E74C 1Y69U 3F2CA 1VF5C 1LTTD 2FJ2A 3DWPA 4GOPA 3S1NB 4HJ7A 3SGIA 1JB3A 2AMCB 3TP7A 1XMOL 5EKLA 3H91A 5C4XG 2F0EA 3KF6A 2HUGA 1BCPC 2ZXPA 5KRUA 1K83B 1EYDA 2PQAB 5D3DA 1MKHA 2M00A 4X3UA 3M7NA 2IL8A 2RBMA 3KYHC 1K28A 2VXWA 1B9MA 4R4IA 1FJGQ 5JVH3 4A3CG 2N49A 2IPKD 2RDFA 1E2VA 4CJ2C 3E9HA 2B3GA 2Y0SE 1K0SA 1HFNA 3J7A5 3EBEA 3VYTA 1HHVA 4A3DG 2OF1A 1WTRA 5CV7A 1D5MC 4IUPA 1H9KA 2I5MX 2KCTA 2RKSA 1K73C 5IGGA 1L0XB 4LF8L 3BVMA 4A93G 1ASYA 2CWAA 1VQ5A 2R93G 1JJ2A 4LAAA 4ME5A 2EIFA 4HSPA 2E2JH 3MFYA 3LWEA 4C56C 1XYIA 1K8GA 1UWVA 4R9WA 2ZXRA 4RKLA 4DV5Q 3HOYG 2A73B 5M3MH 4X64L 2JA6G 3CQZB 1TVXA 2Q2HA 3R8BA 4LFBL 5BR8Q 4K5XA 1YNJC 4JYAL 1JE4A 3OW2A 3FMCA 3C1FA 4UPAA 4OO1I 2EYMA 3I4NB 1R9TB 4IPCA 5BN3A 1LTBD 2BA1A 1VQKA 1PA6A 4C3IG 2B63H 3B6YA 4NB3A 4BA1I 4XQJA 2VNUD 3P1HA 3QJYA 4RCNA 1CSQA 5FJ8H 3K6OA 1LV9A 4F87A 3PUWA 5LMNQ 1HR0W 3A56A 2ZJQA 5IY0A 3T16A 1QZGA 3GP7A 3PIO3 5LL6X 4CGYB 1X6OA 2XTIA 1W3SA 2P5ZX 1B44D 3MXNB 3KJOA 1PMRA 1JC7A 3UDXA 5A35A 3CCVA 5FLMG 3H0GB 1U0LA 2E2IB 1EWIA 3NENA 4PZ7A 3SR1A 2E76C 5HY6A 3NWSA 4RA8A 1EFWA 4DA2A 2JSOA 4JI0Q 4BY1H 4OXPA 2B39A 1T5EA 3AFPA 1STAA 3U4ZA 1VQJA 4JI8Q 4BBRH 3DHQA 4LFAL 1N32L 1STGA 5C3EG 1S40A 3U4VA 3S14H 2OQ0A 2PNRC 4TKOB 3GQBA 1SYGA 4DUZQ 4BXXH 3ZYYX 1DOLA 1CTMA 2PQEA 1PH1A 3R93A 3CXCA 1EY5A 2WAQB 3OMCA 4PZ6A 1YHBA 1S5ED 1EY8A 1QNUA 2RF4A 4O2DA 4BY7H 3IAYA 1NCVA 4HJ9A 1FL0A 3T1YL 4K2LA 3X3NA 2FHTA 1IBMQ 1Q46A 2F0JA 1N34L 1IYJB 1VQIA 4K8JA 4HJAA 1I50B 1MJEA 2B2WC 2Q2UA 2E2HB 1VDZA 1GUNA 4DAYB 5KNBA 1PH4A 3ND9A 2A8VA 3JAML 1D6EC 1AE2A 4V0BA 2Q2TA 1PH6A 1LT3D 1EY4A 2B29A 3I4NG 4HIMA 5J1ZA 4XXEA 4PMWA 2PW5A 1F2MA 4LUVA 2IHFA 4YY3Q 1L1OC 4DNIA 2NZHA 5I9PA 1KAAA 3KBXA 1Q1EA 1AE3A 3I8ZA 2B2WA 1SYDA 2GN5A 3FRPB 2G5DA 1ET6A 1B4OA 3NELA 3WOEA 4UDUC 3E6ZX 2HDMA 1B3AA 5I6YA 1KABA 1LT4D 2CWPA 2K32A 4P73A 2L9HA 3BYYB 5GAHC 5ISRA 4L5SA 2IX1A 2VS1A 1EFID 2L5TA 1KHIA 3QR8A 1OO9B 1E3PA 1XNRL 1U4RA 4UP7A 1WTXA 3ULJA 1GVPA 1YEZA 1L1OA 4EX5A 1CFMA 5J22A 2I5LX 4DR4L 5ELDA 3KF8B 2KECA 4RCOA 1C0AA 3A8JE 3CC2A 1MHWC 3MAQA 2JA5H 1BDOA 4NXMQ 4QQBX 4TQUS 5EKKA 4DV0L 2SNSA 1I4GA 4P2CB 3VR4A 1PHJA 5E1FA 1HNXL 3S16H 2K14A 2UUBQ 4IJHA 4P75A 4RFBA 4BA2I 2E2JB 3TP8A 4L63B 1R4QB 1HNWQ 4JBJA 2NVQH 1VQOA 3NTIA 1K0RA
chains in the Genus database with same CATH topology
2AUJD 2OEOA 5M3MB 1SMYD 3I73A 5JEAG 2RA4A 4IUTA 3J7AV 1KDCA 5BN5A 3AU7A 2MUYA 2B63B 2BDNA 2IW3A 4B08A 1ZKOA 2A6HD 3TMEA 4MHEA 3KLRA 2PO4A 2ICIA 5EPLA 2PZUA 1GUSA 4ZQ3A 1F9SA 3DWQA 1HCZA 1TY0A 3I72A 4R8IA 4NW2A 2QEJC 3FDTA 1IKMA 1EL0A 5HURA 3A7AB 1RKNA 1EU4A 3HS0C 2EYOA 4CKEA 1W6KA 1Y1WB 1SEBD 3SK8A 3MHBA 4BY1B 1ESFA 2KCNA 4KY7A 3OWFA 4ULLA 1QG7A 1D5XC 1LABA 5I9OA 1ENAA 4CBVA 1KLGD 4KJNA 1GUGA 1NUCA 2EXZA 2K03A 1GXDC 1SFOB 1DYQA 4ZYSA 2M9VA 4KK7A 2VUMB 4X3KA 1FYCA 4BY7B 1OXTA 1HTPA 3KUPA 1SBBB 3IKJA 3NBIA 4XT3B 1OXUA 2R6GA 1U4MA 4LJZC 1II3A 4A3KB 3SE0A 4FP5D 1BNZA 2WKCA 2AWNA 3T4AC 4KKUA 3KK7A 1HXYD 1QB5D 1W6JA 4H13C 1SE2A 3MWYW 4HCEA 4Z9CB 1TR5A 1EEFD 1WTWA 4NKLA 3QOLA 2RSOA 3MFGA 1FD7D 4ZKBB 2V4DA 4E6IA 3HRZC 5IGCA 4FXKC 5EBDA 2A5HA 4IUNA 5KYLA 3GTOB 1SSOA 3M85A 1ONLA 3RMHA 4Q5VA 1Q3LA 3EFXD 5CORA 1ZYRC 5CV4A 1O80A 5IODA 3C46A 4I7ZC 4RKBA 1PRTF 2FMMA 5D3IB 4YIJA 4OO1H 3GV3A 1LO5D 3CRLC 4O42A 3UI2A 2E2DC 3GV6A 3OIPA 5E3FA 2IX0A 3TBIB 1ICWA 1O7ZA 3DEPA 3MC0B 4KHZA 5E4WC 1SNPA 1SJED 1V1PA 3KBGA 3TDQA 1I4QA 5C6AA 1A3TA 2NTSA 1EZ6A 2QDBA 3NE5B 4IALA 1KDBA 1NAPA 1PYWD 2J7ZA 4KD3A 4F7XA 1CT1D 4S3SA 3G4NA 4B9WA 1A2TA 1MD2D 2AUKA 1LTSD 1DJRD 1WTQA 3R3OA 3OSOA 1STNA 4PMBA 2Z1CA 4QMGA 4M1UB 1PRTC 1GUTA 5JOBA 3R2IA 3C3LA 3AB9A 1JOOA 2O5IC 3IFDA 1PTOC 4DK0A 2K33A 3T53B 2F0UA 1EY9A 3ERQA 3G4OA 2L4NA 2TSSA 4FF2A 2SEBD 5DNFA 1Y8PB 3OHXC 1MBYA 1D1KA 3K58A 3DEOA 1O7LA 3QG1A 2PPBC 3E5SA 2CW0C 2N55A 2NN6I 5G3LF 2R92B 3GTGB 5IIFA 1KNAA 2JA8B 1LTAD 1QJOA 2EYFA 3GTQB 2OXPA 3HZXA 1STEA 4A93B 1G2SA 3P7JA 3A55A 2K5WA 2D5DA 3OMGA 3K7AB 1Z47A 3VR5A 1HUNA 2BDOA 1F9QA 4N9PA 1NSNS 1NR2A 2F0PA 3J81E 1RDPD 2KQ3A 5EJWA 4R8NA 2BOSA 2KVMA 2ENBA 5T1GA 2F3VA 1EWCA 2A69C 3Q23A 2B8FA 1AEXA 4ABNA 2B2VC 2MHVA 1RJTA 1GJXA 4HMJA 4IUUA 4C3HB 3L7ZC 1U4PA 4ZKCB 2LY7A 4L6TB 4K6DA 3D6WA 3E0JA 3SK6A 3W2DA 4IFDG 3SDZA 2F0FA 3RUZA 2B2VA 3K5NA 3A8IE 3HOUB 5CBEE 1RTNA 2F0NA 3DUZA 5CMDA 3U9OA 5DM63 1CHPD 1GHKA 1E2WA 2EYJA 2JEAI 1ET9A 1X3PA 3D8GA 2ICEC 5C3EB 3SK5A 1DD2A 2K05A 2K5QA 5NUCA 5E4XA 2JP1A 4IZ8A 1BOSA 3H6MA 2F0DA 1B1ZA 4H7BA 2F0TA 4KD4A 5DAUA 1EIGA 1B9NA 5D14A 1HTLD 1LACA 1I6VC 3HEJA 3P20A 3PV0A 4K2KA 1CQVA 2WACA 3S2HB 3NTHA 2AWOA 1H9SB 1XX8A 4EQNA 1S5CD 2RQXA 3OIQA 3RZDB 3I70A 3PUXA 2AQ3B 4KTAA 3EROA 2XNAC 1V1OA 2F0QA 1EY0A 5CGKA 2F0MA 3DWAA 3WDNA 1TWAB 2A6ED 1DZ1A 1YNNC 3Q22A 4J1MA 3FKIB 5ELEA 3MXNA 1B50A 4XQQA 4G7ZC 1WCMB 2EYLA 3VYUA 2HCIA 4C3HG 5EPKA 3VR3A 3A7LA 1IYVA 2KA7A 3MXPA 1EOTA 1GHJA 2QKIC 3GTPB 5DEHA 1G291 1C4QA 1PRTD 3NQTA 4RHRA 5C5LA 2BCOA 2F0KA 3Q0AA 1EQVA 3TZUA 1TWFB 1PDQA 4KMUC 2AQ2B 4TSSA 4TRDA 5C0XG 4JK1C 4U68A 5I2XA 1G2TA 2NVYB 2DNEA 4K8IA 4A3GB 4DAVA 5HGTA 5K36H 1R4PB 4A3MB 5EPJA 1JWSD 3CKIB 1FGBD 1EU3A 1CA5A 3I4LA 1JCKB 4QB4A 2F0OA 2F0VA 4DK1A 4DAYA 1OXVA 2PMZB 4FYDA 3GTLB 2H4OA 3SXHA 3TP5A 2AQ1B 2EY6A 2BE5C 1JOKA 2A68D 1IW7C 4ZRZA 1DCZA 2ID0A 1Y1VB 3N52A 2O4XA 2Z4HA 4DNRB 1UUPA 1I6HB 4K5WA 2CVRA 2QILA 1D5ZC 3S9WA 3BG3A 1WVLA 5G3LD 3D3RA 1PZID 2G9HD 3MXGA 3KLSA 3RD4A 1CK1A 3D31A 3KF8A 4ZLTF 1SJHD 2KUMA 5IGBA 1AZQA 2WB1B 3MA2B 2KOLA 1B2TA 3EJIA 4QUCA 3K57A 2FMCA 1PFMA 2K5DA 3BDLA 3CRKC 1ENFA 1BCPD 2NUCA 1SNCA 4CKBA 1EZ8A 2XSCA 3DXJC 1HPCA 1A3UA 2PW7A 2L12A 4RGMA 5ELBA 5D65A 2JEBI 1JR0D 1LTGD 1FNWA 2CHBD 4QCLA 2C5CA 4FF4A 2NBFA 4HSVA 5ELCA 2WP8J 2NN6H 2EDGA 4NDXA 2EY5A 1TT2A 1WTOA 2F0HA 3MXUA 1TS4A 4C3JB 4K14A 3J7AF 1GUOA 3HOZB 1DM0B 1RCVD 1YNJD 1H9RA 3EA6A 4XYQA 3QB3A 5LHY1 3C1EA 4PNYA 2D9UA 4G7OC 1TKWB 1K8MA 3L3OC 1FNUA 2HDLA 2PYKA 1U9RA 2NWGA 4DGZA 2IT1A 3K0YA 4BBRB 5I6WA 3NQIA 1CZGA 1WTPA 5EGTA 1CI3M 5M9OA 1EY7A 3S14B 1V43A 2J0TD 4PQXA 5DM73 3VR2A 3RLFA 1TS5A 3F2UA 3HP3A 1I4XA 3AMUA 1STBA 1PLFA 1HQRD 1QCBD 4WJWA 1BF4A 2Z4IA 1DOMA 1SYFA 3FPPA 4RGTA 1S5FD 3VYSA 4GZYC 2FFKB 1Z52A 4OL7A 5C4HA 1EEID 4K6LA 2QCPX 1KTKA 1LT6D 1M8AA 3H09A 2D2CC 5CBAE 1CA6A 2KJXA 2YYZA 2KEEA 4HAEA 4C3JG 3S15B 5EBCA 3A54A 1IW7D 4DU9A 5CC4A 3I4MB 3EQLC 2XN9C 3TZDA 1D2BA 2YU9B 4HMIA 4RH6A 3N6RA 5IGFA 1S4ZA 2JA5B 3C0NA 1Y8NB 3SVMA 4DXGA 3U9SA 1HA5A 1VCIA 2EJFC 3S16B 1PTOF 4KI0A 3VYRA 2L11A 4BS9A 2DY8A 1FNVA 3ND8A 2JXMB 2NVQB 3C0MA 1VF7A 3PO3B 4C2MB 2MGSA 3NHHA 4XQNA 1SYEA 2JYOA 5IT9E 1AN8A 4G7HC 1QOHA 3NXWA 4CJ0B 3J81L 2MPMA 2F3WA 5COYA 1H9MA 2EJGC 2LFNA 3HGBA 1V1PB 4ZAIA 1F9PA 1IHZA 3I91A 2EYHA 3BZDB 1RF2D 1TU2B 5JAVA 3BYTB 5KEEA 2F0LA 4K5VA 2ZT9C 5KYIA 2A74C 1H9JA 3NTKA 2R7ZB 2MP1A 4M8AA 3PO2B 2NB0A 2IWHA 3M3YB 4NMZA 5JEAJ 1SNDA 1ZEQX 3FVQA 4X3TA 4Y7NB 2GA4B 1PZKD 4G4KA 2ZXOA 2D62A 1KNEA 4MIUA 3SK4A 4A3BB 3DMUA 3PUYA 4C1NK 1LLRD 1F2YA 1RD9D 4IUVA 5K5PA 1PRTB 2G9DA 3DM1A 4XDXA 1CZWA 4C1NI 2K01A 3J80E 5IGEA 4KN4C 1D1IA 3HKZB 2XWBB 5EQ0A 4EQOA 5FO8B 4IFDI 2NVTB 4DN4M 4RWSC 1LT5D 4KKTA 2VB2X 2EJMA 1GOZA 3TP6A 1KDAA 1Z6HA 1OXXK 5JEAH 2F0GA 2PZWA 3LNNA 4RHSA 2KHSA 4FXDA 1O7YA 3BDCA 5C3XA 5IOCA 2RDGA 3X3MA 3NK9A 4OIJA 3GTJB 5M5XB 4HEDA 3D6CA 1S5DD 1HRJA 2O2LD 2NYZD 1I3QB 1WD0A 4G57A 3K59A 4WFN3 2NTTA 3I90A 1WD1A 1SNOA 1JICA 2H1EA 1SNMA 2EE1A 1Q8IA 3K5OA 1STHA 5FO7B 2EVBA 4FXGC 3V2TA 3W3AA 2EY1A 2Q8IB 1H9SA 1ZYRD 4IUQA 1G8ZD 1T5XD 3OOCA 5TSSA 1KLUD 3Q24A 1JORA 4H44C 3OW7A 1K8OA 1SMYC 2XRQD 1HUMA 5C5MA 5M5YB 4EQPA 2HQEA 1Q1BA 4RGNA 3CHBD 2L55A 4BBSB 1MGSA 4FNFA 5J39A 4FVMA 2A6HC 3URYA 1G91A 2L0CA 3NUCA 4FF1A 1RODA 4OHJA 1BCPB 1F9RA 4QIWB 1DOKA 2EZVA 5C0XI 3BDOA 1MSGA 1PXUA 1UAPA 2IX3A 1LTRD 2DNCA 1AW7A 1TWCB 1X32A 3QOJA 4U673 3S1QB 4J6HA 3FEWX 5JPNC 4A3JB 3BVZA 1PTOD 1A6XA 3D4WA 4OO1G 3KLSX 1TS3A 1NR4A 1UNSA 1Z7TA 5M5WB 2CW0D 4F88A 3GTMB 3R2TA 4LK1C 4IN3A 1SXTA 1BQQT 2XRSD 5A2QL 4PMCA 1CM9A 1PZJD 3NBHA 1MSHA 3BS1A 4NP5A 1XWEA 4PV1C 4DNTB 3O13A 4ZUIA 1RHPA 3D4DA 1E0BA 3LX0A 3M7GA 5CYUA 1G6ZA 1C8CA 3T13A 4Q0FA 2EY2A 4KJOA 1PFNA 2SDFA 2A69D 1TS2A 5JJZA 5FOBB 3OWEB 3QIAA 4XIGS 4ZK9B 4V190 3TN2A 4BWGB 2JE6I 2N88A 3HOWB 3HOVB 2I46A 3MVVA 5KNDA 4IQZA 4RGOS 3L9AX 3K5MA 1C48A 1MI2A 3WOFA 2LKVA 3MZ5A 5KNCA 1SYBA 3D4RA 5A2QE 5C3WA 4FO2A 1CQFA 5KGUA 3T56B 2RDHA 3G7LA 2Q8TA 3J7YW 1ILPA 5I4DA 1ZXTA 2J4XA 2VB3X 2XWJB 3RZOB 3S2DB 2WKDA 5FKAC 4ODGA 1O78A 3FPUB 5C4ZA 4IFDJ 3SEBA 3CU7A 4KV6A 4F8MA 4LMQD 1AP0A 2X6GA 4B9XA 4O1NA 2MJ8A 3P75A 1X3QA 2SNMA 3ONAB 1IKLA 5CR3A 1TY2A 1SYCA 3NWTA 3JAME 1JQYD 1V8QA 3GTKB 2LMCB 4HN7A 1JOQA 1U4LA 4ILWA 4L8JA 2L1BA 1XTCD 4FF3A 3C0OA 5FLXL 2F0IA 1YNND 5CV8A 1J8IA 4ID6A 2F1MA 3VA5A 2XIWA 1DXMA 2WIIB 4IFDH 2FINB 1L0YB 1I4HA 4EVOA 3M4OB 4DAPA 4CJ1B 3T51B 1I4PA 4QUFA 1EQTA 4A3FB 2LS01 1IYUA 1ILQA 1Q12A 2RVLA 4KY5A 5BN4A 1QILA 3S17B 5I2YA 1S5BD 1TQOA 1QE6A 2F0WA 3IL8A 1ESRA 3ITPA 1F2ZA 4CKCA 3LWUA 5CV9A 3Q6SA 4JBWA 2SOBA 1PTOH 2F0SA 1STYA 3V05A 1PREA 1A15A 2WINB 2K04A 2E75C 4MN3A 4UAIA 5FLXE 3V96A 2EYPA 5C0XJ 2PZTA 5IT9L 1EYAA 2C9OA 4A3IB 4XTCS 2OT2A 1AZPA 1SAPA 1VMCA 2EPBA 5IGDA 1J9OA 2KEDA 3PUZA 5C4JB 1ML0D 4CHTB 2O5JC 1IL8A 2BE5D 1AFPA 1JWUD 4HCSA 1BO0A 3OPOA 3NPPA 1HQMC 4AYBB 3GD7A 1PFBA 2IJ0A 5LL6S 3G6JB 3H94A 1B53A 2EOTA 2TMPA 4WRDA 3VR6A 4QF4A 2WV6D 4HR7B 1RTOA 4KY6A 5M3FB 1HA6A 1JWMD 1LTID 1QNKA 1CHQD 5C0XH 4EGVA 2DY7A 5K36G 1OXSC 4KN7C 1ENCA 1XXGA 3QWNA 3M4YA 3K5LA 1SE3A 4OGQC 1UEAB 1TWHB 4RAUC 1A2UA 3HG9A 2M2LA 2K6AA 5C44B 2RSNA 1BR9A 1EIHA 3GO5A 4I65A 4H0LC 2JA7B 3S1RB 1Q90A 5JPMC 2A6EC 2K28A 1VMPA 4DF7A 2F03A 3H3VC 4XYOA 4ZUJA 1TIID 2B2TC 3J80L 3SHLA 4KKSA 5FO9B 2XVSA 2DN8A 1TWGB 5AFWA 3VA7A 1BXTA 3I3CA 3PMFA 3NP8A 5ELFA 3A8KE 2BA0A 4KHVA 4J8QA 1I4RA 2K7VA 1SDFA 5FK9C 4A3EB 4OIKA 5CV6A 1Y8OB 2B2TA 4DFAA 1EYCA 3PUVA 4XT1B 2CQAA 1M4VA 5C4XB 2Y0SB 4DXFA 2R3ZA 2X6LA 5CV5A 1FR3A 4WORA 3NSWA 4A3DB 1EWHA 4IURA 5F2DA 3S1MB 2X69A 2R93B 2KCCA 3IFTA 3PIP3 1PTOB 1BBXC 2B8GA 1HFGA 1F2LA 2K1BA 1GUWA 2NZ1D 2NN6G 1F77A 3HOYB 2A68C 2HCCA 2Q8RE 1BCPF 2JA6B 3TSSA 4X3SA 1BUVT 3C2PA 3EVQA 5KIXA 1SE4A 2B2YC 2PCFB 2QF7A 2NVXB 1SNQA 2B2UC 1A3VA 2F4IA 3BVGA 4HTHA 4C3IB 1E2ZA 5JVG3 2I07B 3MEHA 1QWYA 3QO2A 2R61A 4N9TA 1EY6A 2B2YA 3HOXB 5T1IA 3MTSA 1WTVA 2Z8LA 2B2UA 1DONA 5EKIA 2E74C 1Y69U 1VF5C 1LTTD 2FJ2A 3DWPA 3S1NB 1JB3A 3TP7A 5EKLA 3H91A 2F0EA 2HUGA 1BCPC 2ZXPA 5KRUA 1K83B 1EYDA 5D3DA 2M00A 4X3UA 3M7NA 2IL8A 2RBMA 2VXWA 1B9MA 5JVH3 2IPKD 2RDFA 1E2VA 4CJ2C 1HFNA 3VYTA 1HHVA 2OF1A 1WTRA 5CV7A 1D5MC 4IUPA 1H9KA 2RKSA 5IGGA 1L0XB 3BVMA 4LAAA 4ME5A 4HSPA 3MFYA 3LWEA 4C56C 1XYIA 4R9WA 2ZXRA 4RKLA 2A73B 3CQZB 1TVXA 3R8BA 4K5XA 1YNJC 1JE4A 3FMCA 3C1FA 4OO1I 2EYMA 3I4NB 1R9TB 5BN3A 1LTBD 2BA1A 4C3IG 4BA1I 4XQJA 2VNUD 3P1HA 3QJYA 4RCNA 3K6OA 1LV9A 4F87A 3PUWA 3A56A 3T16A 3GP7A 3PIO3 5LL6X 4CGYB 1B44D 1PMRA 1JC7A 5A35A 3H0GB 2E2IB 3SR1A 2E76C 3NWSA 4RA8A 4DA2A 2JSOA 2B39A 1T5EA 1STAA 3DHQA 1STGA 2PNRC 4TKOB 3GQBA 1SYGA 3ZYYX 1DOLA 1CTMA 2PQEA 3R93A 1EY5A 2WAQB 3OMCA 1S5ED 1EY8A 1QNUA 3IAYA 1NCVA 4K2LA 3X3NA 2FHTA 2F0JA 4K8JA 1I50B 2B2WC 2E2HB 1VDZA 1GUNA 5KNBA 3ND9A 3JAML 1D6EC 4V0BA 1LT3D 1EY4A 5J1ZA 4XXEA 4PMWA 2PW5A 1F2MA 5I9PA 1KAAA 3KBXA 1Q1EA 3I8ZA 2B2WA 1SYDA 3FRPB 1ET6A 1B4OA 3WOEA 4UDUC 3E6ZX 2HDMA 1B3AA 5I6YA 1KABA 1LT4D 2K32A 2L9HA 3BYYB 5ISRA 2IX1A 1EFID 2L5TA 1OO9B 1U4RA 1WTXA 1CFMA 5J22A 5ELDA 2KECA 4RCOA 3A8JE 3MAQA 1BDOA 4TQUS 5EKKA 2SNSA 1I4GA 4P2CB 3VR4A 5E1FA 4RFBA 4BA2I 2E2JB 3TP8A 4L63B 1R4QB 3NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT5 D;  1TS2 A;  1PTO C;  2AQ2 B;  4TSS A;  1HXY D;  2WV6 D;  1GOZ A;  1L0Y B;  3OWE B;  1I4H A;  1SE2 A;  1ENF A;  1D5M C;  1TS5 A;  1BCP D;  1AN8 A;  3G4O A;  1S5E D;  2TSS A;  1I4X A;  4Z9C B;  1L0X B;  4RHS A;  1JWM D;  1LTI D;  3BVM A;  1EEF D;  2SEB D;  1CHQ D;  1I4P A;  3MFG A;  1LTR D;  1CHP D;  1FD7 D;  4BWG B;  1AW7 A;  1HQR D;  4RGM A;  1ET9 A;  5ELB A;  1XXG A;  1PTO B;  1JR0 D;  1QIL A;  1LTG D;  2RDG A;  4C56 C;  1SE3 A;  1JWS D;  1FNW A;  1S5B D;  4RGO S;  2CHB D;  1V1P B;  1S5D D;  2ICI A;  1FGB D;  1F77 A;  1EU3 A;  2O2L D;  5ELC A;  3BVZ A;  3BZD B;  1RF2 D;  1B1Z A;  1PTO D;  4RGT A;  1S5F D;  1BCP F;  3R8B A;  3BYT B;  3EFX D;  3TSS A;  1JCK B;  1D6E C;  1LTA D;  1Z52 A;  3DWQ A;  1LT3 D;  1HTL D;  1SE4 A;  1EEI D;  4K6L A;  2NTT A;  1KTK A;  1STE A;  1LT6 D;  2IPK D;  1TY0 A;  1CQV A;  1PRT F;  3KLS X;  1LTB D;  2RDH A;  1TS3 A;  2QEJ C;  5D3I B;  1UNS A;  5I4D A;  1LO5 D;  3BVG A;  2J4X A;  1PTO H;  1TS4 A;  1EU4 A;  1ET6 A;  5FKA C;  3V05 A;  1BXT A;  2AQ1 B;  1S5C D;  1SEB D;  1PRE A;  4UDU C;  3SEB A;  2R61 A;  3MC0 B;  5ELF A;  3R2T A;  1LT4 D;  1ESF A;  3BYY B;  4O1N A;  1RCV D;  1G8Z D;  1RDP D;  1SJE D;  2AQ3 B;  1V1P A;  3GP7 A;  3EA6 A;  1EFI D;  1T5X D;  1I4R A;  1D5X C;  1SXT A;  1PZK D;  2XNA C;  1I4Q A;  1V1O A;  2XN9 C;  5TSS A;  2NTS A;  2XRS D;  5FK9 C;  1KLU D;  1B44 D;  1KLG D;  1TY2 A;  2Z8L A;  3DWA A;  4RH6 A;  1PYW D;  1UUP A;  1PZJ D;  5ELD A;  1LTT D;  4RCO A;  3DWP A;  2QIL A;  1D5Z C;  1EWC A;  1CT1 D;  1DYQ A;  3C0N A;  2XRQ D;  4DXG A;  3G4N A;  1LLR D;  5ELE A;  1HA5 A;  1FNU A;  1PZI D;  2G9H D;  4ZYS A;  1MD2 D;  1JQY D;  1CK1 A;  1M4V A;  1LTS D;  1RD9 D;  1PTO F;  1DJR D;  1BCP C;  1I4G A;  1PRT B;  1SJH D;  3O13 A;  1JWU D;  4RFB A;  4RGN A;  3CHB D;  5D3D A;  4DXF A;  1XTC D;  1FNV A;  1SBB B;  3C0O A;  4L6T B;  3URY A;  1PRT C;  1PRT D;  4RHR A;  4L63 B;  3R2I A;  2IJ0 A;  3C0M A;  4OHJ A;  1BCP B;  3W2D A; 
#chains in the Genus database with same CATH topology
 2AUJ D;  2OEO A;  5M3M B;  3PO3 H;  1SMY D;  4C2M H;  5LMU Q;  2WAQ G;  3T1H L;  3I73 A;  4NXN L;  5JEA G;  1A0I A;  2RA4 A;  4IUT A;  1WJJ A;  3J7A V;  1KDC A;  5BN5 A;  3AU7 A;  1Q81 C;  1S3O A;  2MUY A;  4HJ8 A;  2B63 B;  2BDN A;  2IW3 A;  4B08 A;  1ZKO A;  2A6H D;  2MFI A;  3TME A;  1XMO Q;  2WAQ E;  4MHE A;  1VQB A;  4A3L H;  3KLR A;  2PO4 A;  2ICI A;  5EPL A;  2PZU A;  4JI2 L;  4L5Q A;  2H5X A;  1GUS A;  3OYY A;  4DKA C;  4ZQ3 A;  4GNX B;  1F9S A;  3DWQ A;  1HCZ A;  1PH2 A;  2DUD A;  1BKB A;  3KJP A;  1TY0 A;  3I72 A;  4R8I A;  4NW2 A;  2QEJ C;  3FDT A;  1IKM A;  2CFM A;  4JBK A;  5JJI A;  1EL0 A;  5HUR A;  2ES2 A;  3A7A B;  3ICE A;  1RKN A;  1EU4 A;  3HS0 C;  2EYO A;  5IYB G;  4CKE A;  1W6K A;  1Y1W B;  1SEB D;  2PI2 E;  3SK8 A;  3MHB A;  4BY1 B;  3MEF A;  1ESF A;  2KCN A;  2ZTC A;  3GTG H;  4KY7 A;  2FXQ A;  3OWF A;  4ULL A;  1QG7 A;  2UXB L;  1D5X C;  1LAB A;  1CKN A;  4Y7N H;  5I9O A;  3GTQ H;  3H3V H;  1Q7Y C;  2WFW A;  1ENA A;  4CBV A;  1KLG D;  4KJN A;  1GUG A;  1NUC A;  2EXZ A;  4X64 Q;  2K03 A;  1GXD C;  4DV2 L;  2HHH L;  1ICF B;  4P74 A;  1SFO B;  4LFB Q;  1DYQ A;  4A3B H;  1KRS A;  4JYA Q;  4A76 A;  2MO0 A;  4ZYS A;  2M9V A;  4KK7 A;  2VUM B;  1N9W A;  3HFZ B;  4X3K A;  1FYC A;  3HKS A;  4BY7 B;  1OXT A;  1JMC A;  2K4K A;  1HTP A;  3KUP A;  4OEL B;  1M90 C;  1SBB B;  3IKJ A;  2ALY B;  3NBI A;  4XT3 B;  1OXU A;  2R6G A;  2A19 A;  1U4M A;  4LJZ C;  1II3 A;  2HIX A;  3SE0 A;  4A3K B;  5M3M G;  4FP5 D;  1BNZ A;  2WKC A;  1KXL A;  2AWN A;  3T4A C;  4KKU A;  2NVT H;  3KK7 A;  3DLL A;  3TS0 A;  3NEM A;  1HXY D;  5H1S E;  1QB5 D;  1W6J A;  4H13 C;  1B3Q A;  1SE2 A;  4YCU A;  3MWY W;  4HCE A;  4Z9C B;  1TR5 A;  1JB7 A;  1EEF D;  1BBU A;  1WTW A;  2B63 G;  4NKL A;  2I5H A;  3QOL A;  2RSO A;  3MFG A;  2VQE L;  4LUZ A;  1FD7 D;  4ZKB B;  2V4D A;  4E6I A;  3HRZ C;  5FJ8 G;  2QA4 A;  2LSS A;  5IGC A;  4FXK C;  5EBD A;  2A5H A;  4IUN A;  5KYL A;  3GTO B;  1PH9 A;  1SSO A;  3GTJ H;  3K80 C;  3M85 A;  1ONL A;  1VQ7 A;  1WFQ A;  3RMH A;  3RLN A;  1QVG A;  4Q5V A;  4LFA Q;  2VQF Q;  1Q3L A;  3EFX D;  1WOC A;  5COR A;  1ZYR C;  1YIJ A;  1N32 Q;  5CV4 A;  1KD1 C;  3HOU H;  1I3Q H;  1X56 A;  3ULL A;  1O80 A;  5IOD A;  3C46 A;  4I7Z C;  4RKB A;  3VDY A;  1PRT F;  2FMM A;  4KLK A;  5D3I B;  2YTY A;  4YIJ A;  4OO1 H;  3GV3 A;  1YJN A;  1LO5 D;  3CRL C;  4O42 A;  3UI2 A;  2E2D C;  3GV6 A;  4DV6 L;  3OIP A;  4LUO A;  5E3F A;  1HZA A;  1Y1W G;  2IX0 A;  3TBI B;  1ICW A;  1O7Z A;  4BY1 G;  2Z6K C;  3DEP A;  3MC0 B;  4KHZ A;  5E4W C;  3T1Y Q;  1NJI C;  1SNP A;  3AYH B;  1SJE D;  1E22 A;  1V1P A;  3KBG A;  3TDQ A;  1I4Q A;  5C6A A;  4DV4 L;  1A3T A;  2NTS A;  4BXX G;  1EZ6 A;  2QDB A;  3NE5 B;  4IAL A;  1GM5 A;  3LGJ A;  1KDB A;  1NAP A;  5GRO A;  1PYW D;  2J7Z A;  4KD3 A;  4F7X A;  1NBW A;  3S2H H;  1CT1 D;  4S3S A;  3CCS A;  3G4N A;  2VUM G;  4B9W A;  1A2T A;  1MD2 D;  2AUK A;  1EUJ A;  1LTS D;  1DJR D;  2Z6K A;  1WTQ A;  4BY7 G;  3W1G A;  3R3O A;  4GN5 A;  2UXD L;  3OSO A;  1STN A;  4PMB A;  3UDF A;  2Z1C A;  1EQQ A;  1C7Y A;  3E9I A;  5IYD H;  4CDD C;  3RZD H;  1SR3 A;  4QMG A;  4M1U B;  4BBS H;  1PRT C;  1GUT A;  5JOB A;  4DUY L;  1EIY B;  3R2I A;  3C3L A;  3AB9 A;  1JOO A;  1PH7 A;  2O5I C;  3D0F A;  4B3M L;  3IFD A;  1PH5 A;  1PTO C;  4DK0 A;  2K33 A;  3FKI H;  3T53 B;  1XNR Q;  4GS3 A;  1VQ4 A;  2F0U A;  1EY9 A;  2RHQ B;  3ERQ A;  2L4N A;  2TSS A;  3G4O A;  4FF2 A;  2SEB D;  4IJL A;  5DNF A;  1Y8P B;  3OHX C;  1MBY A;  4LF7 L;  2KHJ A;  2BH8 A;  1D1K A;  3K58 A;  3DEO A;  1O7L A;  3QG1 A;  2PPB C;  3E5S A;  1TWC H;  2CW0 C;  4DV0 Q;  1HNX Q;  2N55 A;  2CKZ B;  1CKM A;  3S1Q H;  2NN6 I;  5G3L F;  2R92 B;  4P71 A;  3CPF A;  1TWF H;  3ZJY C;  3GTG B;  5IIF A;  4A3J H;  1KNA A;  3STB D;  2JA8 B;  1LTA D;  1QJO A;  1JJG A;  2EYF A;  3GTQ B;  2OXP A;  3J81 i;  3HZX A;  1STE A;  4GLA C;  4A93 B;  1G2S A;  3J80 i;  3P7J A;  3A55 A;  2MO1 A;  3T1H Q;  2K5W A;  4NXN Q;  2D5D A;  3OMG A;  2F52 A;  4A3G H;  3K7A B;  1Z47 A;  1N33 L;  3VR5 A;  1L2F A;  1HUN A;  2BDO A;  3PCO B;  5HGQ A;  1F9Q A;  4OWT B;  1VQ8 A;  1VQ9 A;  4N9P A;  1NSN S;  3I4O A;  1NR2 A;  2F0P A;  2K75 A;  3J81 E;  1YZ6 A;  1RDP D;  2KQ3 A;  5EJW A;  4QY7 A;  4DV7 Q;  4R8N A;  1BBW A;  2BOS A;  2VL6 A;  3PO3 G;  2KVM A;  4JI2 Q;  4GKJ Q;  2ENB A;  5T1G A;  2F3V A;  5IWA Q;  1EWC A;  2CH4 W;  4LF6 Q;  1X55 A;  2A69 C;  3Q23 A;  2B8F A;  1AEX A;  4ABN A;  5ELO A;  2B2V C;  2MHV A;  1RJT A;  4LF5 L;  1YIT A;  1GJX A;  2KBN A;  1KIX A;  4HMJ A;  4MZ9 A;  4DR2 L;  4IUU A;  4C3H B;  1PH8 A;  3L7Z C;  1U4P A;  4ZKC B;  2LY7 A;  4L6T B;  1X3G A;  2UUA Q;  2YV5 A;  3A0J A;  4K6D A;  3D6W A;  2PQA A;  3E0J A;  3SK6 A;  3W2D A;  4IFD G;  1I6H H;  3SDZ A;  2F0F A;  3RUZ A;  2B2V A;  1UE5 A;  4X62 Q;  2UXB Q;  3FP9 A;  3K5N A;  3A8I E;  4WJ3 M;  3HOU B;  5CBE E;  1RTN A;  2F0N A;  3DUZ A;  5CMD A;  4JC0 A;  4H02 A;  3U9O A;  2HHH Q;  5DM6 3;  3K0X A;  3G4S A;  1CHP D;  3CCE A;  1GHK A;  1E2W A;  2EYJ A;  2JEA I;  1ET9 A;  1X3P A;  3D8G A;  2ICE C;  5C3E B;  3HOW H;  1H95 A;  3SK5 A;  1DD2 A;  2R92 G;  2K05 A;  2K5Q A;  1HZC A;  5NUC A;  5E4X A;  2JP1 A;  3CME A;  4IZ8 A;  1BOS A;  3H6M A;  4LW1 A;  4JI6 L;  2F0D A;  2JA8 G;  1B1Z A;  4H7B A;  2F0T A;  4KD4 A;  5DAU A;  1EIG A;  1B9N A;  5D14 A;  1HTL D;  4UP8 A;  1XPR A;  4IPG A;  4KHP L;  1LAC A;  1I6V C;  3HEJ A;  3P20 A;  4DV1 L;  3PV0 A;  4K2K A;  1CQV A;  2WAC A;  1L0W A;  4A3B G;  3TQY A;  3S2H B;  1EIF A;  3NTH A;  2AWO A;  1H9S B;  1XX8 A;  4EQN A;  1S5C D;  3S2D H;  1QVF A;  2RQX A;  3OIQ A;  2VQE Q;  1M1K C;  4I7A A;  3RZD B;  3I70 A;  3PUX A;  2AQ3 B;  4KTA A;  3ERO A;  2XNA C;  1J5E L;  1V1O A;  2F0Q A;  3UE0 A;  1EY0 A;  3HKZ G;  5CGK A;  2F0M A;  3DWA A;  3WDN A;  1TWA B;  2A6E D;  3TRE A;  1DZ1 A;  1YNN C;  3Q22 A;  4J1M A;  3FKI B;  5ELE A;  3MXN A;  1B50 A;  4XQQ A;  4G7Z C;  2HD3 A;  4UP9 A;  1WCM B;  1WYD A;  2EYL A;  3VYU A;  4C3J H;  2HCI A;  4C3H G;  5EPK A;  3VR3 A;  3A7L A;  1IYV A;  2KA7 A;  3MXP A;  1EOT A;  1GHJ A;  3HOZ H;  2QKI C;  4DV6 Q;  4ALP A;  3GTP B;  5DEH A;  1G29 1;  1C4Q A;  1PRT D;  3NQT A;  4RHR A;  5C5L A;  2BCO A;  2F0K A;  2N8N A;  1E1T A;  3Q0A A;  1EQV A;  3TZU A;  1TWF B;  1SLJ A;  1PDQ A;  4KMU C;  3HOU G;  2AQ2 B;  4TSS A;  1CKO A;  4TRD A;  5C0X G;  4JK1 C;  1PVO A;  4U68 A;  5I2X A;  1VQM A;  3AFQ A;  3ER0 A;  1G2T A;  2MNA A;  3RNU A;  2L15 A;  2NVY B;  2DNE A;  4K8I A;  4A3G B;  4DAV A;  5HGT A;  5K36 H;  1R4P B;  1HR0 L;  4HJ5 A;  4A3M B;  5EPJ A;  1UE6 A;  1JWS D;  2N3S A;  1LYL A;  3S17 H;  3CKI B;  4LF4 Q;  3J81 c;  1FGB D;  1EU3 A;  1CA5 A;  3I4L A;  1JCK B;  4QB4 A;  2F0O A;  4DUY Q;  2F0V A;  4OON A;  4DK1 A;  4DAY A;  4A4I A;  1OXV A;  4B3M Q;  5IP7 H;  2PMZ B;  4FYD A;  3GTL B;  2PI2 A;  1IXR A;  2H4O A;  3SXH A;  3TP5 A;  2AQ1 B;  2EY6 A;  2BE5 C;  1JOK A;  3EIV A;  5IYD G;  4LF7 Q;  2A68 D;  3TRZ A;  1IW7 C;  2JN4 A;  4ZRZ A;  4DAM A;  5JJL A;  1VQP A;  1DCZ A;  3I2Z A;  2ID0 A;  3NBH B;  3CC4 A;  1Y1V B;  3KDF B;  3N52 A;  2O4X A;  2Z4H A;  4DNR B;  1OTC A;  1UUP A;  1I6H B;  4K5W A;  2CVR A;  2QIL A;  1D5Z C;  3FKI G;  3S9W A;  3ERS X;  3BG3 A;  1WVL A;  4YCW A;  5G3L D;  3D3R A;  1PZI D;  2G9H D;  3MXG A;  3KLS A;  3RD4 A;  1WCM G;  1CK1 A;  3D31 A;  3KF8 A;  4ZLT F;  3S15 H;  4B3S L;  1MIU A;  1SJH D;  1SRU A;  1IL2 A;  2KUM A;  5IGB A;  1AZQ A;  2WB1 B;  4CDC C;  3MA2 B;  2KOL A;  1N33 Q;  1B2T A;  3I4M H;  1EQR A;  3EJI A;  4QUC A;  3K57 A;  2FMC A;  2C35 B;  1YI2 A;  2YU9 H;  1PFM A;  2K5D A;  3J81 j;  3I7F A;  4MTN A;  3BDL A;  3CRK C;  1PYS B;  1VQH A;  1ENF A;  1BCP D;  4NPS A;  2NUC A;  3KFU A;  1SNC A;  4CKB A;  1UEB A;  1K8A C;  1EZ8 A;  2XSC A;  3DXJ C;  1VQE A;  4A3G G;  2ZJR A;  1HPC A;  1A3U A;  2PW7 A;  2ZTE A;  1EYG A;  1HZ9 A;  2L12 A;  4GNX C;  3K8A A;  4RGM A;  4LF5 Q;  5ELB A;  4A3M G;  5D65 A;  2JEB I;  1JR0 D;  1LTG D;  1K3B C;  1FNW A;  1AH9 A;  2CHB D;  4QCL A;  2C5C A;  3JAM i;  4FF4 A;  4DR2 Q;  2NBF A;  4HSV A;  1TWH H;  5ELC A;  2WP8 J;  2NN6 H;  2EDG A;  4NDX A;  4X66 L;  3PF4 A;  4JI1 L;  4AH6 A;  2EY5 A;  1VQN A;  4JG2 A;  4LNQ A;  1TT2 A;  3KOJ A;  1PV4 A;  5GAD C;  1EOV A;  3CCR A;  2ASB A;  4GNX A;  2JA7 H;  3S1R H;  1WTO A;  2F0H A;  3MXU A;  1TS4 A;  4C3J B;  1IBK L;  4K14 A;  1TWG H;  3J7A F;  1GUO A;  3HOZ B;  1DM0 B;  1RCV D;  2PMZ E;  1YNJ D;  1NNX A;  1H9R A;  4DR7 L;  3EA6 A;  4XYQ A;  2RCN A;  3QB3 A;  5LHY 1;  1Y1V G;  2N78 A;  3C1E A;  4PNY A;  2YTV A;  4APV A;  4R4C A;  2D9U A;  4G7O C;  3AEV A;  1TKW B;  1K8M A;  4YWM A;  2JA9 A;  3L3O C;  2R7Z H;  2DJG C;  1FNU A;  4LF8 Q;  1X65 A;  4KHP Q;  2HDL A;  4DV1 Q;  3W1B A;  2PYK A;  1U9R A;  2NWG A;  3UDG A;  4IO9 A;  3PO2 H;  4DGZ A;  2K5N A;  2IT1 A;  4YHH L;  3K0Y A;  2WB1 G;  5ELN A;  3NQI A;  4BBR B;  5I6W A;  1CZG A;  1GD7 A;  1WTP A;  3M3Y H;  3UDI A;  4JI7 L;  5EGT A;  1CI3 M;  5M9O A;  1EY7 A;  3HOW G;  3S14 B;  1DGS A;  1V43 A;  2J0T D;  4A3C H;  4PQX A;  4O0A A;  2WB1 E;  5DM7 3;  4B3R L;  3VR2 A;  4JI5 L;  2D0O A;  1J5E Q;  3RLF A;  1TS5 A;  3HP3 A;  3F2U A;  1I4X A;  1JJC B;  4ME3 A;  4GLX A;  3AMU A;  1STB A;  2UUC L;  1PLF A;  1HQR D;  1QCB D;  4WJW A;  1BF4 A;  1A8V A;  1KAW A;  2Z4I A;  1DOM A;  1SYF A;  1XPU A;  3CCM A;  3FPP A;  4RGT A;  1S5F D;  3KLW A;  3VYS A;  4GZY C;  2FFK B;  1K9M C;  4OL7 A;  2JA6 H;  1RIP A;  5C4H A;  1Z52 A;  1EEI D;  5IP9 H;  4K6L A;  2QCP X;  1KTK A;  1LT6 D;  1M8A A;  3H09 A;  2D2C C;  2NVX H;  5CBA E;  5LMN W;  1CA6 A;  2KJX A;  1KC8 C;  2YYZ A;  1SRO A;  2KEE A;  3BZK A;  4HAE A;  4YWL A;  4C3J G;  1MJC A;  3S15 B;  5EBC A;  2YTX A;  3A54 A;  1Y14 B;  5M5X H;  2DJF C;  3HOZ G;  1N8R C;  4UY8 C;  1IW7 D;  4DU9 A;  5CC4 A;  1HR0 Q;  3E0E A;  3I4M B;  3EQL C;  2XN9 C;  1D8L A;  3TZD A;  1D2B A;  2YU9 B;  4HMI A;  3HOX H;  4RH6 A;  3N6R A;  5IGF A;  3OTO L;  1S4Z A;  2V1C C;  3M4P A;  3CCQ A;  2JA5 B;  3C0N A;  1Y8N B;  3SVM A;  4DXG A;  3U9S A;  1A62 A;  1HA5 A;  1VCI A;  3S1N H;  4IOA A;  2EJF C;  5FLM H;  3PIP A;  3S16 B;  1VQG A;  1PTO F;  4KI0 A;  4LF9 L;  3VYR A;  4BBR G;  2L11 A;  4BS9 A;  1N34 Q;  2DY8 A;  4WJ4 A;  1FNV A;  3ND8 A;  2JXM B;  1I5F A;  2NVQ B;  3K81 C;  4JCV E;  4PG3 A;  3C0M A;  1VF7 A;  3F2D A;  3PO3 B;  1VQA A;  4C2M B;  2MGS A;  5E7N A;  3NHH A;  4XQN A;  1SYE A;  1S72 A;  5GAE C;  3A5U A;  4UHV A;  2JYO A;  5IT9 E;  1AN8 A;  4A75 A;  4J15 A;  4G7H C;  4AQY L;  5M5Y H;  1QOH A;  3NXW A;  1K3R A;  1VQ6 A;  4CJ0 B;  4JOI C;  5GAG C;  3CP0 A;  3I56 A;  3J81 L;  4JV5 L;  2MPM A;  4X65 L;  2F3W A;  5COY A;  4CDE C;  1H9M A;  4MTK A;  2EJG C;  3CF5 A;  4B3S Q;  2LFN A;  3HGB A;  1V1P B;  4ZAI A;  1F9P A;  1IHZ A;  4PZ8 A;  3I91 A;  2EYH A;  3BZD B;  1RF2 D;  2OCE A;  1TU2 B;  1YHA A;  2PNH A;  5JAV A;  3BYT B;  5KEE A;  2F0L A;  4K5V A;  1D7Q A;  2Z0S A;  3GDE A;  2ZT9 C;  3JC6 6;  4DR4 Q;  4JOI A;  5KYI A;  3J7Z C;  1YJ9 A;  1R9T H;  2A74 C;  1H9J A;  3NTK A;  2R7Z B;  3E3X A;  2QEX A;  1YBY A;  2MP1 A;  4M8A A;  1XNQ L;  3PO2 B;  2NB0 A;  2IWH A;  3M3Y B;  4NMZ A;  1QUQ B;  5JEA J;  1SND A;  1ZEQ X;  3I4M G;  3FVQ A;  4X3T A;  4Y7N B;  2GA4 B;  1PZK D;  4G4K A;  2ZXO A;  2D62 A;  1KNE A;  4MIU A;  1KQS A;  3U58 A;  3SK4 A;  4X6A H;  1GKH A;  4JI3 L;  3I55 A;  2JA5 G;  4A3B B;  1PFS A;  3DMU A;  4X66 Q;  3PUY A;  4C1N K;  2EXD A;  1LLR D;  4JVZ A;  1F2Y A;  5M5W H;  3H0G H;  4JI1 Q;  3PSI A;  4OWX B;  1RD9 D;  4IUV A;  5K5P A;  1LM0 A;  1PRT B;  3GTM H;  4IOC A;  2G9D A;  3RN2 A;  3DM1 A;  4OX9 L;  4XDX A;  1CZW A;  4C1N I;  2K01 A;  2ZM6 L;  3J80 E;  5IGE A;  4KN4 C;  1D1I A;  3HKZ B;  2XWB B;  1IBK Q;  5EQ0 A;  1SE8 A;  4R4O A;  4EQO A;  1V1Q A;  5FO8 B;  4IFD I;  4HID A;  2NVT B;  2QDL A;  4DN4 M;  4RWS C;  3F8T A;  1LT5 D;  4DR7 Q;  4KKT A;  2VB2 X;  2EJM A;  1GOZ A;  3TP6 A;  1KDA A;  1Z6H A;  1OXX K;  5JEA H;  2F0G A;  2PZW A;  3LNN A;  4RHS A;  2KHS A;  4NXM L;  4FXD A;  1KRT A;  1O7Y A;  4DV3 L;  3BDC A;  5C3X A;  1W2B A;  2UXC L;  1PYB A;  4A3L G;  1HJP A;  3PIO A;  5IOC A;  2RDG A;  4R4Q A;  3X3M A;  3NK9 A;  4OIJ A;  3GTJ B;  2JJQ A;  5M5X B;  4HED A;  3D6C A;  4YHH Q;  3BJU A;  1HNW L;  1S5D D;  1HRJ A;  2O2L D;  2E2H H;  2NYZ D;  1RL2 A;  4JI7 Q;  4RMF A;  1I3Q B;  1WD0 A;  4G57 A;  3K59 A;  4WFN 3;  4HIO A;  2NTT A;  3G48 A;  3I90 A;  4DV2 Q;  4OEM B;  4GLV B;  1WD1 A;  1SNO A;  2R7Z G;  4L5R C;  3PF5 A;  1WI5 A;  4B3R Q;  1JIC A;  1E7Z A;  4JI5 Q;  5GQO A;  4OWW B;  2UU9 L;  2BH2 A;  3HOV H;  2H1E A;  1SNM A;  2EE1 A;  4LFC L;  3CCL A;  3PO2 G;  1Q8I A;  3K5O A;  1STH A;  4IPD A;  1XPO A;  5FO7 B;  2OTJ A;  2EVB A;  4B3T L;  4FXG C;  3V2T A;  3W3A A;  5IYB H;  2EY1 A;  2Q8I B;  2UUC Q;  4GN4 B;  2Y0S G;  1H9S A;  1ZYR D;  4IUQ A;  1G8Z D;  4TVA B;  1T5X D;  3OOC A;  4GOP B;  1NMF A;  4HIK A;  1UE1 A;  5TSS A;  1KLU D;  3Q24 A;  1JOR A;  4H44 C;  3OW7 A;  3KF6 B;  2CCZ A;  1K8O A;  1SMY C;  2XRQ D;  5IT9 c;  1X3F A;  3RZO H;  1XTD A;  1HUM A;  5C5M A;  5M5Y B;  4EQP A;  2HQE A;  1Q1B A;  4RGN A;  3CHB D;  2L55 A;  4BBS B;  1MGS A;  4FNF A;  5J39 A;  5J3B A;  4FVM A;  2A6H C;  3URY A;  1NE3 A;  2R7D A;  1G91 A;  2L0C A;  3NUC A;  1U5K A;  2RHS B;  4FF1 A;  1ROD A;  4OHJ A;  1BCP B;  1X3E A;  1F9R A;  2OQK A;  4QIW B;  2IY5 B;  3RN5 A;  1DOK A;  1HNZ L;  2EZV A;  5IP9 G;  3IRB A;  4POF A;  5C0X I;  3BDO A;  3GTK H;  1MSG A;  1PXU A;  1UAP A;  1I94 L;  3HKZ E;  2IX3 A;  3OTO Q;  1C9O A;  1LTR D;  4K0K L;  2DNC A;  1AW7 A;  1TWC B;  1X32 A;  3QOJ A;  2ZTD A;  3AQQ A;  4U67 3;  3S1Q B;  4J6H A;  3CCJ A;  4LF9 Q;  1E24 A;  3FEW X;  5JPN C;  4JPB W;  4A3J B;  3BVZ A;  4JI4 L;  1PTO D;  1YJW A;  4DV4 Q;  1A6X A;  3D4W A;  3HOX G;  1N36 L;  3M4O H;  4OO1 G;  3KLS X;  1PH3 A;  1TS3 A;  1NR4 A;  1UNS A;  4A3F H;  1BVS A;  1Z7T A;  5M5W B;  2CW0 D;  1X9N A;  2UXD Q;  3BZC A;  4AQY Q;  2K5V A;  4F88 A;  1Y1W H;  3GTM B;  3R2T A;  5AJ3 L;  4R1J A;  3J80 c;  4JV5 Q;  4X65 Q;  4LK1 C;  4IN3 A;  1SXT A;  1ASZ A;  2VQF L;  2KHI A;  1BQQ T;  2XRS D;  5A2Q L;  4PMC A;  1CM9 A;  1PZJ D;  1XMQ L;  2R7F A;  3NBH A;  1SFO H;  3KDF A;  1MSH A;  4DR6 L;  3BS1 A;  4NP5 A;  4GKK L;  2VUM H;  1XWE A;  4PV1 C;  4DNT B;  3O13 A;  4ZUI A;  1RHP A;  4BBS G;  3D4D A;  4YCV A;  1E0B A;  2JQO A;  3LX0 A;  2KCM A;  3M7G A;  5CYU A;  1G6Z A;  1VQD A;  1XNQ Q;  2A1A A;  4A3I H;  1CSP A;  1C8C A;  3T13 A;  4A3K H;  4Q0F A;  2EY2 A;  2K50 A;  4KJO A;  1PFN A;  2SDF A;  2A69 D;  1TS2 A;  4QJF A;  5FOB B;  5JJZ A;  3OWE B;  4JW0 A;  5C4J H;  3QIA A;  4XIG S;  4ZK9 B;  2OTL A;  4V19 0;  4JI3 Q;  2K5H A;  1YHQ A;  4CDF C;  3TN2 A;  4DR5 L;  3TS2 A;  4BWG B;  2JE6 I;  4QIW E;  3F2B A;  2N88 A;  3CW2 C;  3HOW B;  3HOV B;  2VY3 A;  2I46 A;  2MQH A;  3MVV A;  5KND A;  4IQZ A;  2E5L L;  4RGO S;  3L9A X;  3K5M A;  1C48 A;  1B70 B;  1MI2 A;  4EQ5 A;  4A3J G;  3CD6 A;  3WOF A;  3GTO H;  4OX9 Q;  1IZ6 A;  2D0P A;  2NZO A;  3EN2 A;  2ZM6 Q;  2LKV A;  3MZ5 A;  5KNC A;  1SYB A;  3D4R A;  5A2Q E;  5C3W A;  4FO2 A;  4P72 A;  1CQF A;  5M3F H;  5KGU A;  5IYC H;  2E8G A;  4RG1 A;  3T56 B;  2RDH A;  3G7L A;  2Q8T A;  3J7Y W;  1ILP A;  5I4D A;  3H0G G;  1ZXT A;  2EQS A;  2J4X A;  2VB3 X;  2XWJ B;  3RZO B;  4JBM A;  2HT1 A;  4LWC A;  3S2D B;  2WKD A;  3M9B A;  5FKA C;  4ODG A;  1O78 A;  3FPU B;  5C4Z A;  4IFD J;  1G51 A;  3SEB A;  3CU7 A;  4DV3 Q;  1IBL L;  2Z9H A;  3K7U C;  4KV6 A;  4F8M A;  4LMQ D;  2UXC Q;  1L1O B;  2X6G A;  4L5T A;  4O1N A;  2MJ8 A;  4B9X A;  1AP0 A;  5C44 H;  2ZJP A;  3P75 A;  1X3Q A;  1CUK A;  2SNM A;  2I0Q A;  3ONA B;  1IKL A;  5CR3 A;  1TY2 A;  4DR1 L;  3WWV A;  1QVC A;  1G6P A;  1SYC A;  3NWT A;  3JAM E;  2LXK A;  1JQY D;  1T9H A;  1V8Q A;  2LMC B;  3GTK B;  3CC7 A;  4HN7 A;  3CMA A;  1JOQ A;  1U4L A;  4ILW A;  4L8J A;  5EAY A;  2K52 A;  2L1B A;  1XTC D;  4FF3 A;  3C0O A;  2UU9 Q;  1HH2 P;  3BU2 A;  5FLX L;  4LFC Q;  2F0I A;  4DV7 L;  1X54 A;  4B3T Q;  1YNN D;  5CV8 A;  4JI6 Q;  1J8I A;  4A3E H;  4ID6 A;  1SN8 A;  1GO3 E;  2F1M A;  3VA5 A;  2XIW A;  5IE8 A;  4QGU A;  1DXM A;  4GKJ L;  2F3I A;  2WII B;  4IFD H;  2FIN B;  5IWA L;  3STB C;  1L0Y B;  1I4H A;  4EVO A;  3RLO A;  4LF6 L;  3M4O B;  4DAP A;  2RCF A;  4CJ1 B;  1VQL A;  1YNX A;  5C4X H;  2Z6B A;  3T51 B;  1I4P A;  4QUF A;  1EQT A;  1B8A A;  1YVC A;  4A3F B;  4Y52 H;  3HOV G;  2LS0 1;  1IYU A;  1ILQ A;  1Q12 A;  2RVL A;  1NY4 A;  4KY5 A;  5BN4 A;  1QIL A;  3S17 B;  5I2Y A;  2UUA L;  4DR3 L;  1S5B D;  2F4V L;  1TQO A;  1QE6 A;  2XGT A;  2F0W A;  3IL8 A;  2R92 H;  1ESR A;  2JA8 H;  4X62 L;  3ITP A;  4A3D H;  1F2Z A;  2IHE A;  3Q8D A;  4CKC A;  3S1M H;  3LWU A;  5CV9 A;  4A93 H;  3Q6S A;  1HNZ Q;  4IPH A;  1Z9F A;  2R93 H;  4JBW A;  2KEN A;  2SOB A;  1PTO H;  1I94 Q;  2F0S A;  3K7A H;  1STY A;  1FJG L;  3V05 A;  1PRE A;  4DK3 C;  1A15 A;  2WIN B;  1CKN B;  2K04 A;  4N8F A;  3M4Q A;  2E75 C;  4MN3 A;  4UAI A;  4K0K Q;  3HOY H;  5FLX E;  5L37 A;  1JT8 A;  3V96 A;  2EYP A;  5C0X J;  2PZT A;  2LXJ A;  5IT9 L;  1EYA A;  2C9O A;  4A3I B;  4XTC S;  2OT2 A;  1AZP A;  1SAP A;  1VMC A;  4JI4 Q;  2EPB A;  5IGD A;  1J9O A;  3RR5 A;  1NTG A;  4C3I H;  2KED A;  3PUZ A;  5C4J B;  1ML0 D;  1N36 Q;  4CHT B;  2O5J C;  1IL8 A;  1JE5 A;  3A5Z B;  2BE5 D;  3FHW A;  1AFP A;  1JWU D;  4HCS A;  4DV5 L;  1BO0 A;  3ULP A;  3OPO A;  4C3H H;  3NPP A;  1B7Y B;  1HQM C;  2DGY A;  3A74 A;  1TXY A;  5BR8 L;  3S24 A;  4AYB B;  3GD7 A;  1PFB A;  2IJ0 A;  5LL6 S;  3G6J B;  5AJ3 Q;  3H94 A;  3L0O A;  1B53 A;  2AHO B;  1J6Q A;  2EOT A;  2TMP A;  4WRD A;  3G6E A;  3VR6 A;  4QF4 A;  2WV6 D;  4HR7 B;  1RTO A;  4KY6 A;  5M3F B;  1HA6 A;  1JWM D;  1LTI D;  1QNK A;  1K83 H;  1CHQ D;  4YWK A;  2VW9 A;  5C0X H;  5LMN L;  4A3F G;  4EGV A;  1VS0 A;  1XMQ Q;  2DY7 A;  5K36 G;  5DLQ E;  1OXS C;  4KN7 C;  3PGZ A;  1ENC A;  4DR6 Q;  1XXG A;  2HQL A;  3QWN A;  3M4Y A;  3F1Z A;  4MNO A;  3K5L A;  1SE3 A;  4OGQ C;  4GKK Q;  5C3E H;  1UEA B;  1TWH B;  4RAU C;  1KL9 A;  1A2U A;  3HG9 A;  1O7I A;  2M2L A;  2K6A A;  5C44 B;  2RSN A;  4GN3 B;  1BR9 A;  1Q8K A;  3DM3 A;  4AIM A;  1EIH A;  3G71 A;  3GO5 A;  5IP7 G;  4I65 A;  1P16 A;  4H0L C;  2JA7 B;  3S1R B;  1Q90 A;  5JPM C;  4JI0 L;  3JAM c;  2A6E C;  2ATW A;  2K28 A;  1VMP A;  4DF7 A;  2F03 A;  3H3V C;  1WTH A;  1VQF A;  4XYO A;  4ZUJ A;  4JI8 L;  3L2P A;  1TII D;  2B2T C;  3J80 L;  3SHL A;  4KKS A;  5FO9 B;  2XVS A;  2DN8 A;  1TWG B;  5AFW A;  3VA7 A;  1BXT A;  3I3C A;  3PMF A;  3NP8 A;  4DUZ L;  3H15 A;  5ELF A;  4DR5 Q;  3A8K E;  2BA0 A;  4KHV A;  1VQC A;  1HZB A;  4LF4 L;  3CQZ H;  1A63 A;  1P8L A;  2OWO A;  4J8Q A;  1I4R A;  2CQO A;  2K7V A;  4A3I G;  1LTL A;  1SDF A;  3U50 C;  1LUZ A;  2E5L Q;  4A3K G;  5FK9 C;  1QUQ A;  2VZA A;  3I4N H;  4A3E B;  4DK6 C;  4OIK A;  4ZCK A;  1TWA H;  5CV6 A;  1Y8O B;  2B2T A;  4DFA A;  1IBM L;  1V9P A;  1EYC A;  3PUV A;  4XT1 B;  2CQA A;  1M4V A;  2AKW B;  5C4X B;  1NMG A;  2GVA A;  1WCM H;  5JJK A;  3CPW A;  2Y0S B;  4DXF A;  2QGQ A;  2R3Z A;  2X6L A;  4AYB G;  3GTP H;  5CV5 A;  1IBL Q;  1XJV A;  4POG A;  4YY3 L;  1FR3 A;  4FDB A;  2CH4 A;  4WOR A;  2E2I H;  4N8X 1;  3NSW A;  5M3F G;  4A3D B;  5IYC G;  1EWH A;  4IUR A;  4R4T A;  3W5O A;  4AYB E;  2GVB A;  4DR1 Q;  5F2D A;  3S1M B;  3CAM A;  2X69 A;  2R93 B;  2KCC A;  3IFT A;  3PIP 3;  2NVY H;  1PTO B;  1FVI A;  1BBX C;  1E1O A;  2JK8 A;  2B8G A;  4QL5 A;  1HFG A;  1F2L A;  2K1B A;  1GUW A;  4A3M H;  2NZ1 D;  2NN6 G;  3CCU A;  5FLX c;  1F77 A;  5C44 G;  3HOY B;  2A68 C;  2HCC A;  2Q8R E;  1BCP F;  2JA6 B;  3TSS A;  4X3S A;  1BUV T;  3C2P A;  3EVQ A;  5KIX A;  3TEH B;  1SE4 A;  2B2Y C;  2QW7 A;  2JA7 G;  2PCF B;  2QF7 A;  2UUB L;  2NVX B;  1FGU A;  1SNQ A;  2B2U C;  1A3V A;  1Q82 C;  2F4I A;  3BVG A;  4HTH A;  4C3I B;  1E2Z A;  4GOP C;  5JVG 3;  1I50 H;  2I07 B;  3MEH A;  3GTL H;  1QWY A;  3QO2 A;  2Q2I A;  2R61 A;  1QZH A;  4DPG A;  4N9T A;  2HIV A;  1EY6 A;  3H3V I;  5LMU L;  2B2Y A;  1SMX A;  2F4V Q;  4DR3 Q;  3HOX B;  1Q86 C;  5T1I A;  3MTS A;  3PQI A;  4A3E G;  1WTV A;  2Z8L A;  3UE1 A;  2B2U A;  1DON A;  1UE7 A;  1Y1V H;  5EKI A;  2E74 C;  1Y69 U;  3F2C A;  1VF5 C;  1LTT D;  2FJ2 A;  3DWP A;  4GOP A;  3S1N B;  4HJ7 A;  3SGI A;  1JB3 A;  2AMC B;  3TP7 A;  1XMO L;  5EKL A;  3H91 A;  5C4X G;  2F0E A;  3KF6 A;  2HUG A;  1BCP C;  2ZXP A;  5KRU A;  1K83 B;  1EYD A;  2PQA B;  5D3D A;  1MKH A;  2M00 A;  4X3U A;  3M7N A;  2IL8 A;  2RBM A;  3KYH C;  1K28 A;  2VXW A;  1B9M A;  4R4I A;  1FJG Q;  5JVH 3;  4A3C G;  2N49 A;  2IPK D;  2RDF A;  1E2V A;  4CJ2 C;  3E9H A;  2B3G A;  2Y0S E;  1K0S A;  1HFN A;  3J7A 5;  3EBE A;  3VYT A;  1HHV A;  4A3D G;  2OF1 A;  1WTR A;  5CV7 A;  1D5M C;  4IUP A;  1H9K A;  2I5M X;  2KCT A;  2RKS A;  1K73 C;  5IGG A;  1L0X B;  4LF8 L;  3BVM A;  4A93 G;  1ASY A;  2CWA A;  1VQ5 A;  2R93 G;  1JJ2 A;  4LAA A;  4ME5 A;  2EIF A;  4HSP A;  2E2J H;  3MFY A;  3LWE A;  4C56 C;  1XYI A;  1K8G A;  1UWV A;  4R9W A;  2ZXR A;  4RKL A;  4DV5 Q;  3HOY G;  2A73 B;  5M3M H;  4X64 L;  2JA6 G;  3CQZ B;  1TVX A;  2Q2H A;  3R8B A;  4LFB L;  5BR8 Q;  4K5X A;  1YNJ C;  4JYA L;  1JE4 A;  3OW2 A;  3FMC A;  3C1F A;  4UPA A;  4OO1 I;  2EYM A;  3I4N B;  1R9T B;  4IPC A;  5BN3 A;  1LTB D;  2BA1 A;  1VQK A;  1PA6 A;  4C3I G;  2B63 H;  3B6Y A;  4NB3 A;  4BA1 I;  4XQJ A;  2VNU D;  3P1H A;  3QJY A;  4RCN A;  1CSQ A;  5FJ8 H;  3K6O A;  1LV9 A;  4F87 A;  3PUW A;  5LMN Q;  1HR0 W;  3A56 A;  2ZJQ A;  5IY0 A;  3T16 A;  1QZG A;  3GP7 A;  3PIO 3;  5LL6 X;  4CGY B;  1X6O A;  2XTI A;  1W3S A;  2P5Z X;  1B44 D;  3MXN B;  3KJO A;  1PMR A;  1JC7 A;  3UDX A;  5A35 A;  3CCV A;  5FLM G;  3H0G B;  1U0L A;  2E2I B;  1EWI A;  3NEN A;  4PZ7 A;  3SR1 A;  2E76 C;  5HY6 A;  3NWS A;  4RA8 A;  1EFW A;  4DA2 A;  2JSO A;  4JI0 Q;  4BY1 H;  4OXP A;  2B39 A;  1T5E A;  3AFP A;  1STA A;  3U4Z A;  1VQJ A;  4JI8 Q;  4BBR H;  3DHQ A;  4LFA L;  1N32 L;  1STG A;  5C3E G;  1S40 A;  3U4V A;  3S14 H;  2OQ0 A;  2PNR C;  4TKO B;  3GQB A;  1SYG A;  4DUZ Q;  4BXX H;  3ZYY X;  1DOL A;  1CTM A;  2PQE A;  1PH1 A;  3R93 A;  3CXC A;  1EY5 A;  2WAQ B;  3OMC A;  4PZ6 A;  1YHB A;  1S5E D;  1EY8 A;  1QNU A;  2RF4 A;  4O2D A;  4BY7 H;  3IAY A;  1NCV A;  4HJ9 A;  1FL0 A;  3T1Y L;  4K2L A;  3X3N A;  2FHT A;  1IBM Q;  1Q46 A;  2F0J A;  1N34 L;  1IYJ B;  1VQI A;  4K8J A;  4HJA A;  1I50 B;  1MJE A;  2B2W C;  2Q2U A;  2E2H B;  1VDZ A;  1GUN A;  4DAY B;  5KNB A;  1PH4 A;  3ND9 A;  2A8V A;  3JAM L;  1D6E C;  1AE2 A;  4V0B A;  2Q2T A;  1PH6 A;  1LT3 D;  1EY4 A;  2B29 A;  3I4N G;  4HIM A;  5J1Z A;  4XXE A;  4PMW A;  2PW5 A;  1F2M A;  4LUV A;  2IHF A;  4YY3 Q;  1L1O C;  4DNI A;  2NZH A;  5I9P A;  1KAA A;  3KBX A;  1Q1E A;  1AE3 A;  3I8Z A;  2B2W A;  1SYD A;  2GN5 A;  3FRP B;  2G5D A;  1ET6 A;  1B4O A;  3NEL A;  3WOE A;  4UDU C;  3E6Z X;  2HDM A;  1B3A A;  5I6Y A;  1KAB A;  1LT4 D;  2CWP A;  2K32 A;  4P73 A;  2L9H A;  3BYY B;  5GAH C;  5ISR A;  4L5S A;  2IX1 A;  2VS1 A;  1EFI D;  2L5T A;  1KHI A;  3QR8 A;  1OO9 B;  1E3P A;  1XNR L;  1U4R A;  4UP7 A;  1WTX A;  3ULJ A;  1GVP A;  1YEZ A;  1L1O A;  4EX5 A;  1CFM A;  5J22 A;  2I5L X;  4DR4 L;  5ELD A;  3KF8 B;  2KEC A;  4RCO A;  1C0A A;  3A8J E;  3CC2 A;  1MHW C;  3MAQ A;  2JA5 H;  1BDO A;  4NXM Q;  4QQB X;  4TQU S;  5EKK A;  4DV0 L;  2SNS A;  1I4G A;  4P2C B;  3VR4 A;  1PHJ A;  5E1F A;  1HNX L;  3S16 H;  2K14 A;  2UUB Q;  4IJH A;  4P75 A;  4RFB A;  4BA2 I;  2E2J B;  3TP8 A;  4L63 B;  1R4Q B;  1HNW Q;  4JBJ A;  2NVQ H;  1VQO A;  3NTI A;  1K0R A; 
#chains in the Genus database with same CATH homology
 2AUJ D;  2OEO A;  5M3M B;  1SMY D;  3I73 A;  5JEA G;  2RA4 A;  4IUT A;  3J7A V;  1KDC A;  5BN5 A;  3AU7 A;  2MUY A;  2B63 B;  2BDN A;  2IW3 A;  4B08 A;  1ZKO A;  2A6H D;  3TME A;  4MHE A;  3KLR A;  2PO4 A;  2ICI A;  5EPL A;  2PZU A;  1GUS A;  4ZQ3 A;  1F9S A;  3DWQ A;  1HCZ A;  1TY0 A;  3I72 A;  4R8I A;  4NW2 A;  2QEJ C;  3FDT A;  1IKM A;  1EL0 A;  5HUR A;  3A7A B;  1RKN A;  1EU4 A;  3HS0 C;  2EYO A;  4CKE A;  1W6K A;  1Y1W B;  1SEB D;  3SK8 A;  3MHB A;  4BY1 B;  1ESF A;  2KCN A;  4KY7 A;  3OWF A;  4ULL A;  1QG7 A;  1D5X C;  1LAB A;  5I9O A;  1ENA A;  4CBV A;  1KLG D;  4KJN A;  1GUG A;  1NUC A;  2EXZ A;  2K03 A;  1GXD C;  1SFO B;  1DYQ A;  4ZYS A;  2M9V A;  4KK7 A;  2VUM B;  4X3K A;  1FYC A;  4BY7 B;  1OXT A;  1HTP A;  3KUP A;  1SBB B;  3IKJ A;  3NBI A;  4XT3 B;  1OXU A;  2R6G A;  1U4M A;  4LJZ C;  1II3 A;  4A3K B;  3SE0 A;  4FP5 D;  1BNZ A;  2WKC A;  2AWN A;  3T4A C;  4KKU A;  3KK7 A;  1HXY D;  1QB5 D;  1W6J A;  4H13 C;  1SE2 A;  3MWY W;  4HCE A;  4Z9C B;  1TR5 A;  1EEF D;  1WTW A;  4NKL A;  3QOL A;  2RSO A;  3MFG A;  1FD7 D;  4ZKB B;  2V4D A;  4E6I A;  3HRZ C;  5IGC A;  4FXK C;  5EBD A;  2A5H A;  4IUN A;  5KYL A;  3GTO B;  1SSO A;  3M85 A;  1ONL A;  3RMH A;  4Q5V A;  1Q3L A;  3EFX D;  5COR A;  1ZYR C;  5CV4 A;  1O80 A;  5IOD A;  3C46 A;  4I7Z C;  4RKB A;  1PRT F;  2FMM A;  5D3I B;  4YIJ A;  4OO1 H;  3GV3 A;  1LO5 D;  3CRL C;  4O42 A;  3UI2 A;  2E2D C;  3GV6 A;  3OIP A;  5E3F A;  2IX0 A;  3TBI B;  1ICW A;  1O7Z A;  3DEP A;  3MC0 B;  4KHZ A;  5E4W C;  1SNP A;  1SJE D;  1V1P A;  3KBG A;  3TDQ A;  1I4Q A;  5C6A A;  1A3T A;  2NTS A;  1EZ6 A;  2QDB A;  3NE5 B;  4IAL A;  1KDB A;  1NAP A;  1PYW D;  2J7Z A;  4KD3 A;  4F7X A;  1CT1 D;  4S3S A;  3G4N A;  4B9W A;  1A2T A;  1MD2 D;  2AUK A;  1LTS D;  1DJR D;  1WTQ A;  3R3O A;  3OSO A;  1STN A;  4PMB A;  2Z1C A;  4QMG A;  4M1U B;  1PRT C;  1GUT A;  5JOB A;  3R2I A;  3C3L A;  3AB9 A;  1JOO A;  2O5I C;  3IFD A;  1PTO C;  4DK0 A;  2K33 A;  3T53 B;  2F0U A;  1EY9 A;  3ERQ A;  3G4O A;  2L4N A;  2TSS A;  4FF2 A;  2SEB D;  5DNF A;  1Y8P B;  3OHX C;  1MBY A;  1D1K A;  3K58 A;  3DEO A;  1O7L A;  3QG1 A;  2PPB C;  3E5S A;  2CW0 C;  2N55 A;  2NN6 I;  5G3L F;  2R92 B;  3GTG B;  5IIF A;  1KNA A;  2JA8 B;  1LTA D;  1QJO A;  2EYF A;  3GTQ B;  2OXP A;  3HZX A;  1STE A;  4A93 B;  1G2S A;  3P7J A;  3A55 A;  2K5W A;  2D5D A;  3OMG A;  3K7A B;  1Z47 A;  3VR5 A;  1HUN A;  2BDO A;  1F9Q A;  4N9P A;  1NSN S;  1NR2 A;  2F0P A;  3J81 E;  1RDP D;  2KQ3 A;  5EJW A;  4R8N A;  2BOS A;  2KVM A;  2ENB A;  5T1G A;  2F3V A;  1EWC A;  2A69 C;  3Q23 A;  2B8F A;  1AEX A;  4ABN A;  2B2V C;  2MHV A;  1RJT A;  1GJX A;  4HMJ A;  4IUU A;  4C3H B;  3L7Z C;  1U4P A;  4ZKC B;  2LY7 A;  4L6T B;  4K6D A;  3D6W A;  3E0J A;  3SK6 A;  3W2D A;  4IFD G;  3SDZ A;  2F0F A;  3RUZ A;  2B2V A;  3K5N A;  3A8I E;  3HOU B;  5CBE E;  1RTN A;  2F0N A;  3DUZ A;  5CMD A;  3U9O A;  5DM6 3;  1CHP D;  1GHK A;  1E2W A;  2EYJ A;  2JEA I;  1ET9 A;  1X3P A;  3D8G A;  2ICE C;  5C3E B;  3SK5 A;  1DD2 A;  2K05 A;  2K5Q A;  5NUC A;  5E4X A;  2JP1 A;  4IZ8 A;  1BOS A;  3H6M A;  2F0D A;  1B1Z A;  4H7B A;  2F0T A;  4KD4 A;  5DAU A;  1EIG A;  1B9N A;  5D14 A;  1HTL D;  1LAC A;  1I6V C;  3HEJ A;  3P20 A;  3PV0 A;  4K2K A;  1CQV A;  2WAC A;  3S2H B;  3NTH A;  2AWO A;  1H9S B;  1XX8 A;  4EQN A;  1S5C D;  2RQX A;  3OIQ A;  3RZD B;  3I70 A;  3PUX A;  2AQ3 B;  4KTA A;  3ERO A;  2XNA C;  1V1O A;  2F0Q A;  1EY0 A;  5CGK A;  2F0M A;  3DWA A;  3WDN A;  1TWA B;  2A6E D;  1DZ1 A;  1YNN C;  3Q22 A;  4J1M A;  3FKI B;  5ELE A;  3MXN A;  1B50 A;  4XQQ A;  4G7Z C;  1WCM B;  2EYL A;  3VYU A;  2HCI A;  4C3H G;  5EPK A;  3VR3 A;  3A7L A;  1IYV A;  2KA7 A;  3MXP A;  1EOT A;  1GHJ A;  2QKI C;  3GTP B;  5DEH A;  1G29 1;  1C4Q A;  1PRT D;  3NQT A;  4RHR A;  5C5L A;  2BCO A;  2F0K A;  3Q0A A;  1EQV A;  3TZU A;  1TWF B;  1PDQ A;  4KMU C;  2AQ2 B;  4TSS A;  4TRD A;  5C0X G;  4JK1 C;  4U68 A;  5I2X A;  1G2T A;  2NVY B;  2DNE A;  4K8I A;  4A3G B;  4DAV A;  5HGT A;  5K36 H;  1R4P B;  4A3M B;  5EPJ A;  1JWS D;  3CKI B;  1FGB D;  1EU3 A;  1CA5 A;  3I4L A;  1JCK B;  4QB4 A;  2F0O A;  2F0V A;  4DK1 A;  4DAY A;  1OXV A;  2PMZ B;  4FYD A;  3GTL B;  2H4O A;  3SXH A;  3TP5 A;  2AQ1 B;  2EY6 A;  2BE5 C;  1JOK A;  2A68 D;  1IW7 C;  4ZRZ A;  1DCZ A;  2ID0 A;  1Y1V B;  3N52 A;  2O4X A;  2Z4H A;  4DNR B;  1UUP A;  1I6H B;  4K5W A;  2CVR A;  2QIL A;  1D5Z C;  3S9W A;  3BG3 A;  1WVL A;  5G3L D;  3D3R A;  1PZI D;  2G9H D;  3MXG A;  3KLS A;  3RD4 A;  1CK1 A;  3D31 A;  3KF8 A;  4ZLT F;  1SJH D;  2KUM A;  5IGB A;  1AZQ A;  2WB1 B;  3MA2 B;  2KOL A;  1B2T A;  3EJI A;  4QUC A;  3K57 A;  2FMC A;  1PFM A;  2K5D A;  3BDL A;  3CRK C;  1ENF A;  1BCP D;  2NUC A;  1SNC A;  4CKB A;  1EZ8 A;  2XSC A;  3DXJ C;  1HPC A;  1A3U A;  2PW7 A;  2L12 A;  4RGM A;  5ELB A;  5D65 A;  2JEB I;  1JR0 D;  1LTG D;  1FNW A;  2CHB D;  4QCL A;  2C5C A;  4FF4 A;  2NBF A;  4HSV A;  5ELC A;  2WP8 J;  2NN6 H;  2EDG A;  4NDX A;  2EY5 A;  1TT2 A;  1WTO A;  2F0H A;  3MXU A;  1TS4 A;  4C3J B;  4K14 A;  3J7A F;  1GUO A;  3HOZ B;  1DM0 B;  1RCV D;  1YNJ D;  1H9R A;  3EA6 A;  4XYQ A;  3QB3 A;  5LHY 1;  3C1E A;  4PNY A;  2D9U A;  4G7O C;  1TKW B;  1K8M A;  3L3O C;  1FNU A;  2HDL A;  2PYK A;  1U9R A;  2NWG A;  4DGZ A;  2IT1 A;  3K0Y A;  4BBR B;  5I6W A;  3NQI A;  1CZG A;  1WTP A;  5EGT A;  1CI3 M;  5M9O A;  1EY7 A;  3S14 B;  1V43 A;  2J0T D;  4PQX A;  5DM7 3;  3VR2 A;  3RLF A;  1TS5 A;  3F2U A;  3HP3 A;  1I4X A;  3AMU A;  1STB A;  1PLF A;  1HQR D;  1QCB D;  4WJW A;  1BF4 A;  2Z4I A;  1DOM A;  1SYF A;  3FPP A;  4RGT A;  1S5F D;  3VYS A;  4GZY C;  2FFK B;  1Z52 A;  4OL7 A;  5C4H A;  1EEI D;  4K6L A;  2QCP X;  1KTK A;  1LT6 D;  1M8A A;  3H09 A;  2D2C C;  5CBA E;  1CA6 A;  2KJX A;  2YYZ A;  2KEE A;  4HAE A;  4C3J G;  3S15 B;  5EBC A;  3A54 A;  1IW7 D;  4DU9 A;  5CC4 A;  3I4M B;  3EQL C;  2XN9 C;  3TZD A;  1D2B A;  2YU9 B;  4HMI A;  4RH6 A;  3N6R A;  5IGF A;  1S4Z A;  2JA5 B;  3C0N A;  1Y8N B;  3SVM A;  4DXG A;  3U9S A;  1HA5 A;  1VCI A;  2EJF C;  3S16 B;  1PTO F;  4KI0 A;  3VYR A;  2L11 A;  4BS9 A;  2DY8 A;  1FNV A;  3ND8 A;  2JXM B;  2NVQ B;  3C0M A;  1VF7 A;  3PO3 B;  4C2M B;  2MGS A;  3NHH A;  4XQN A;  1SYE A;  2JYO A;  5IT9 E;  1AN8 A;  4G7H C;  1QOH A;  3NXW A;  4CJ0 B;  3J81 L;  2MPM A;  2F3W A;  5COY A;  1H9M A;  2EJG C;  2LFN A;  3HGB A;  1V1P B;  4ZAI A;  1F9P A;  1IHZ A;  3I91 A;  2EYH A;  3BZD B;  1RF2 D;  1TU2 B;  5JAV A;  3BYT B;  5KEE A;  2F0L A;  4K5V A;  2ZT9 C;  5KYI A;  2A74 C;  1H9J A;  3NTK A;  2R7Z B;  2MP1 A;  4M8A A;  3PO2 B;  2NB0 A;  2IWH A;  3M3Y B;  4NMZ A;  5JEA J;  1SND A;  1ZEQ X;  3FVQ A;  4X3T A;  4Y7N B;  2GA4 B;  1PZK D;  4G4K A;  2ZXO A;  2D62 A;  1KNE A;  4MIU A;  3SK4 A;  4A3B B;  3DMU A;  3PUY A;  4C1N K;  1LLR D;  1F2Y A;  1RD9 D;  4IUV A;  5K5P A;  1PRT B;  2G9D A;  3DM1 A;  4XDX A;  1CZW A;  4C1N I;  2K01 A;  3J80 E;  5IGE A;  4KN4 C;  1D1I A;  3HKZ B;  2XWB B;  5EQ0 A;  4EQO A;  5FO8 B;  4IFD I;  2NVT B;  4DN4 M;  4RWS C;  1LT5 D;  4KKT A;  2VB2 X;  2EJM A;  1GOZ A;  3TP6 A;  1KDA A;  1Z6H A;  1OXX K;  5JEA H;  2F0G A;  2PZW A;  3LNN A;  4RHS A;  2KHS A;  4FXD A;  1O7Y A;  3BDC A;  5C3X A;  5IOC A;  2RDG A;  3X3M A;  3NK9 A;  4OIJ A;  3GTJ B;  5M5X B;  4HED A;  3D6C A;  1S5D D;  1HRJ A;  2O2L D;  2NYZ D;  1I3Q B;  1WD0 A;  4G57 A;  3K59 A;  4WFN 3;  2NTT A;  3I90 A;  1WD1 A;  1SNO A;  1JIC A;  2H1E A;  1SNM A;  2EE1 A;  1Q8I A;  3K5O A;  1STH A;  5FO7 B;  2EVB A;  4FXG C;  3V2T A;  3W3A A;  2EY1 A;  2Q8I B;  1H9S A;  1ZYR D;  4IUQ A;  1G8Z D;  1T5X D;  3OOC A;  5TSS A;  1KLU D;  3Q24 A;  1JOR A;  4H44 C;  3OW7 A;  1K8O A;  1SMY C;  2XRQ D;  1HUM A;  5C5M A;  5M5Y B;  4EQP A;  2HQE A;  1Q1B A;  4RGN A;  3CHB D;  2L55 A;  4BBS B;  1MGS A;  4FNF A;  5J39 A;  4FVM A;  2A6H C;  3URY A;  1G91 A;  2L0C A;  3NUC A;  4FF1 A;  1ROD A;  4OHJ A;  1BCP B;  1F9R A;  4QIW B;  1DOK A;  2EZV A;  5C0X I;  3BDO A;  1MSG A;  1PXU A;  1UAP A;  2IX3 A;  1LTR D;  2DNC A;  1AW7 A;  1TWC B;  1X32 A;  3QOJ A;  4U67 3;  3S1Q B;  4J6H A;  3FEW X;  5JPN C;  4A3J B;  3BVZ A;  1PTO D;  1A6X A;  3D4W A;  4OO1 G;  3KLS X;  1TS3 A;  1NR4 A;  1UNS A;  1Z7T A;  5M5W B;  2CW0 D;  4F88 A;  3GTM B;  3R2T A;  4LK1 C;  4IN3 A;  1SXT A;  1BQQ T;  2XRS D;  5A2Q L;  4PMC A;  1CM9 A;  1PZJ D;  3NBH A;  1MSH A;  3BS1 A;  4NP5 A;  1XWE A;  4PV1 C;  4DNT B;  3O13 A;  4ZUI A;  1RHP A;  3D4D A;  1E0B A;  3LX0 A;  3M7G A;  5CYU A;  1G6Z A;  1C8C A;  3T13 A;  4Q0F A;  2EY2 A;  4KJO A;  1PFN A;  2SDF A;  2A69 D;  1TS2 A;  5JJZ A;  5FOB B;  3OWE B;  3QIA A;  4XIG S;  4ZK9 B;  4V19 0;  3TN2 A;  4BWG B;  2JE6 I;  2N88 A;  3HOW B;  3HOV B;  2I46 A;  3MVV A;  5KND A;  4IQZ A;  4RGO S;  3L9A X;  3K5M A;  1C48 A;  1MI2 A;  3WOF A;  2LKV A;  3MZ5 A;  5KNC A;  1SYB A;  3D4R A;  5A2Q E;  5C3W A;  4FO2 A;  1CQF A;  5KGU A;  3T56 B;  2RDH A;  3G7L A;  2Q8T A;  3J7Y W;  1ILP A;  5I4D A;  1ZXT A;  2J4X A;  2VB3 X;  2XWJ B;  3RZO B;  3S2D B;  2WKD A;  5FKA C;  4ODG A;  1O78 A;  3FPU B;  5C4Z A;  4IFD J;  3SEB A;  3CU7 A;  4KV6 A;  4F8M A;  4LMQ D;  1AP0 A;  2X6G A;  4B9X A;  4O1N A;  2MJ8 A;  3P75 A;  1X3Q A;  2SNM A;  3ONA B;  1IKL A;  5CR3 A;  1TY2 A;  1SYC A;  3NWT A;  3JAM E;  1JQY D;  1V8Q A;  3GTK B;  2LMC B;  4HN7 A;  1JOQ A;  1U4L A;  4ILW A;  4L8J A;  2L1B A;  1XTC D;  4FF3 A;  3C0O A;  5FLX L;  2F0I A;  1YNN D;  5CV8 A;  1J8I A;  4ID6 A;  2F1M A;  3VA5 A;  2XIW A;  1DXM A;  2WII B;  4IFD H;  2FIN B;  1L0Y B;  1I4H A;  4EVO A;  3M4O B;  4DAP A;  4CJ1 B;  3T51 B;  1I4P A;  4QUF A;  1EQT A;  4A3F B;  2LS0 1;  1IYU A;  1ILQ A;  1Q12 A;  2RVL A;  4KY5 A;  5BN4 A;  1QIL A;  3S17 B;  5I2Y A;  1S5B D;  1TQO A;  1QE6 A;  2F0W A;  3IL8 A;  1ESR A;  3ITP A;  1F2Z A;  4CKC A;  3LWU A;  5CV9 A;  3Q6S A;  4JBW A;  2SOB A;  1PTO H;  2F0S A;  1STY A;  3V05 A;  1PRE A;  1A15 A;  2WIN B;  2K04 A;  2E75 C;  4MN3 A;  4UAI A;  5FLX E;  3V96 A;  2EYP A;  5C0X J;  2PZT A;  5IT9 L;  1EYA A;  2C9O A;  4A3I B;  4XTC S;  2OT2 A;  1AZP A;  1SAP A;  1VMC A;  2EPB A;  5IGD A;  1J9O A;  2KED A;  3PUZ A;  5C4J B;  1ML0 D;  4CHT B;  2O5J C;  1IL8 A;  2BE5 D;  1AFP A;  1JWU D;  4HCS A;  1BO0 A;  3OPO A;  3NPP A;  1HQM C;  4AYB B;  3GD7 A;  1PFB A;  2IJ0 A;  5LL6 S;  3G6J B;  3H94 A;  1B53 A;  2EOT A;  2TMP A;  4WRD A;  3VR6 A;  4QF4 A;  2WV6 D;  4HR7 B;  1RTO A;  4KY6 A;  5M3F B;  1HA6 A;  1JWM D;  1LTI D;  1QNK A;  1CHQ D;  5C0X H;  4EGV A;  2DY7 A;  5K36 G;  1OXS C;  4KN7 C;  1ENC A;  1XXG A;  3QWN A;  3M4Y A;  3K5L A;  1SE3 A;  4OGQ C;  1UEA B;  1TWH B;  4RAU C;  1A2U A;  3HG9 A;  2M2L A;  2K6A A;  5C44 B;  2RSN A;  1BR9 A;  1EIH A;  3GO5 A;  4I65 A;  4H0L C;  2JA7 B;  3S1R B;  1Q90 A;  5JPM C;  2A6E C;  2K28 A;  1VMP A;  4DF7 A;  2F03 A;  3H3V C;  4XYO A;  4ZUJ A;  1TII D;  2B2T C;  3J80 L;  3SHL A;  4KKS A;  5FO9 B;  2XVS A;  2DN8 A;  1TWG B;  5AFW A;  3VA7 A;  1BXT A;  3I3C A;  3PMF A;  3NP8 A;  5ELF A;  3A8K E;  2BA0 A;  4KHV A;  4J8Q A;  1I4R A;  2K7V A;  1SDF A;  5FK9 C;  4A3E B;  4OIK A;  5CV6 A;  1Y8O B;  2B2T A;  4DFA A;  1EYC A;  3PUV A;  4XT1 B;  2CQA A;  1M4V A;  5C4X B;  2Y0S B;  4DXF A;  2R3Z A;  2X6L A;  5CV5 A;  1FR3 A;  4WOR A;  3NSW A;  4A3D B;  1EWH A;  4IUR A;  5F2D A;  3S1M B;  2X69 A;  2R93 B;  2KCC A;  3IFT A;  3PIP 3;  1PTO B;  1BBX C;  2B8G A;  1HFG A;  1F2L A;  2K1B A;  1GUW A;  2NZ1 D;  2NN6 G;  1F77 A;  3HOY B;  2A68 C;  2HCC A;  2Q8R E;  1BCP F;  2JA6 B;  3TSS A;  4X3S A;  1BUV T;  3C2P A;  3EVQ A;  5KIX A;  1SE4 A;  2B2Y C;  2PCF B;  2QF7 A;  2NVX B;  1SNQ A;  2B2U C;  1A3V A;  2F4I A;  3BVG A;  4HTH A;  4C3I B;  1E2Z A;  5JVG 3;  2I07 B;  3MEH A;  1QWY A;  3QO2 A;  2R61 A;  4N9T A;  1EY6 A;  2B2Y A;  3HOX B;  5T1I A;  3MTS A;  1WTV A;  2Z8L A;  2B2U A;  1DON A;  5EKI A;  2E74 C;  1Y69 U;  1VF5 C;  1LTT D;  2FJ2 A;  3DWP A;  3S1N B;  1JB3 A;  3TP7 A;  5EKL A;  3H91 A;  2F0E A;  2HUG A;  1BCP C;  2ZXP A;  5KRU A;  1K83 B;  1EYD A;  5D3D A;  2M00 A;  4X3U A;  3M7N A;  2IL8 A;  2RBM A;  2VXW A;  1B9M A;  5JVH 3;  2IPK D;  2RDF A;  1E2V A;  4CJ2 C;  1HFN A;  3VYT A;  1HHV A;  2OF1 A;  1WTR A;  5CV7 A;  1D5M C;  4IUP A;  1H9K A;  2RKS A;  5IGG A;  1L0X B;  3BVM A;  4LAA A;  4ME5 A;  4HSP A;  3MFY A;  3LWE A;  4C56 C;  1XYI A;  4R9W A;  2ZXR A;  4RKL A;  2A73 B;  3CQZ B;  1TVX A;  3R8B A;  4K5X A;  1YNJ C;  1JE4 A;  3FMC A;  3C1F A;  4OO1 I;  2EYM A;  3I4N B;  1R9T B;  5BN3 A;  1LTB D;  2BA1 A;  4C3I G;  4BA1 I;  4XQJ A;  2VNU D;  3P1H A;  3QJY A;  4RCN A;  3K6O A;  1LV9 A;  4F87 A;  3PUW A;  3A56 A;  3T16 A;  3GP7 A;  3PIO 3;  5LL6 X;  4CGY B;  1B44 D;  1PMR A;  1JC7 A;  5A35 A;  3H0G B;  2E2I B;  3SR1 A;  2E76 C;  3NWS A;  4RA8 A;  4DA2 A;  2JSO A;  2B39 A;  1T5E A;  1STA A;  3DHQ A;  1STG A;  2PNR C;  4TKO B;  3GQB A;  1SYG A;  3ZYY X;  1DOL A;  1CTM A;  2PQE A;  3R93 A;  1EY5 A;  2WAQ B;  3OMC A;  1S5E D;  1EY8 A;  1QNU A;  3IAY A;  1NCV A;  4K2L A;  3X3N A;  2FHT A;  2F0J A;  4K8J A;  1I50 B;  2B2W C;  2E2H B;  1VDZ A;  1GUN A;  5KNB A;  3ND9 A;  3JAM L;  1D6E C;  4V0B A;  1LT3 D;  1EY4 A;  5J1Z A;  4XXE A;  4PMW A;  2PW5 A;  1F2M A;  5I9P A;  1KAA A;  3KBX A;  1Q1E A;  3I8Z A;  2B2W A;  1SYD A;  3FRP B;  1ET6 A;  1B4O A;  3WOE A;  4UDU C;  3E6Z X;  2HDM A;  1B3A A;  5I6Y A;  1KAB A;  1LT4 D;  2K32 A;  2L9H A;  3BYY B;  5ISR A;  2IX1 A;  1EFI D;  2L5T A;  1OO9 B;  1U4R A;  1WTX A;  1CFM A;  5J22 A;  5ELD A;  2KEC A;  4RCO A;  3A8J E;  3MAQ A;  1BDO A;  4TQU S;  5EKK A;  2SNS A;  1I4G A;  4P2C B;  3VR4 A;  5E1F A;  4RFB A;  4BA2 I;  2E2J B;  3TP8 A;  4L63 B;  1R4Q B;  3NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...