1PTOC

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoC01
1PRTF 2NTSA 1QILA 1S5BD 3EA6A 4TSSA 3TSSA 1SBBB 1GOZA 3CHBD 1B44D 3V05A 1EU4A 2R61A 1ET9A 1V1OA 1LO5D 4DXFA 1I4QA 1PTOF 1FD7D 1BCPB 3GP7A 2AQ2B 1PREA 2J4XA 1D6EC 1UNSA 1KTKA 1TS5A 5FK9C 1PTOC 1XXGA 4RHRA 4Z9CB 1SJED 1I4XA 3BYTB 1BCPF 1L0YB 2SEBD 1D5ZC 1TS3A 1UUPA 1EU3A 1TY0A 1LTBD 1PTOB 1TS2A 3OWEB 1EEID 1S5CD 1TY2A 1V1PB 4OHJA 5ELEA 1PZID 1S5FD 1BXTA 1ESFA 4RFBA 1LTSD 1RDPD 1LT4D 3SEBA 1AW7A 1LTRD 1KLGD 1LLRD 3O13A 1FNWA 1DYQA 3URYA 3W2DA 4L6TB 4RCOA 1ET6A 4UDUC 5D3IB 4RGTA 2RDGA 3BVZA 1JCKB 1RD9D 1EWCA 3G4OA 1FGBD 1ENFA 2XNAC 3R2TA 5ELBA 1Z52A 1RCVD 1S5ED 5ELCA 1I4HA 4O1NA 4RGMA 2IPKD 2XRQD 1CT1D 3BVMA 1XTCD 1FNUA 1JWMD 3DWPA 1CK1A 4RGOS 1LT5D 1LTID 1PRTD 1PTOH 3C0MA 1B1ZA 2NTTA 1HA5A 1KLUD 3KLSX 2QILA 1CQVA 4RHSA 1DJRD 1EEFD 1SE2A 2O2LD 1I4GA 1HXYD 2XN9C 1TS4A 1LTTD 1S5DD 2RDHA 5I4DA 3C0OA 2CHBD 1STEA 1MD2D 3R2IA 5ELDA 1RF2D 1LT6D 5D3DA 3R8BA 3DWAA 1JQYD 4ZYSA 1L0XB 5TSSA 1PZKD 1JWUD 2QEJC 1BCPD 1I4PA 4BWGB 1SXTA 2G9HD 1D5MC 1FNVA 2Z8LA 2WV6D 2IJ0A 1M4VA 1LTGD 2TSSA 4L63B 3BZDB 1LTAD 1CHPD 1AN8A 1V1PA 3BVGA 1PRTC 1LT3D 1F77A 1G8ZD 3MC0B 3MFGA 1HQRD 2AQ1B 3DWQA 4DXGA 1PTOD 1SEBD 3EFXD 1SE3A 1HTLD 4K6LA 4RH6A 1SJHD 5ELFA 4C56C 1PZJD 1PYWD 5FKAC 4RGNA 1JWSD 1T5XD 1PRTB 2ICIA 3BYYB 1EFID 1I4RA 1SE4A 1D5XC 2XRSD 3G4NA 3C0NA 2AQ3B 1CHQD 1JR0D 1BCPC
chains in the Genus database with same CATH superfamily
3LWEA 4DR5L 4K0KL 1Y1VB 5KGUA 2R7ZH 4DAYA 1VDZA 1FVIA 1D1IA 1HZ9A 1ZKOA 2Z6KA 5KNBA 1KNEA 4KN7C 1VCIA 2CH4W 1KTKA 2UXCL 3BDOA 1EY0A 2ZJRA 2DNEA 4X66Q 2KEDA 1L0YB 3HOXH 1J6QA 1EIGA 2ID0A 5I9OA 4ALPA 3S15B 4JI6L 2R3ZA 2PW7A 2F0WA 4RFBA 1LTSD 4R1JA 4RKBA 4A3EB 1X9NA 4JI0Q 4L8JA 1GJXA 2ATWA 2N8NA 2I0QA 4ZLTF 2F4VL 2JK8A 5IGGA 4BBRG 3BVZA 3SK6A 5BN5A 1A6XA 1RD9D 3CAMA 1Q86C 3TS2A 3TZDA 1HFGA 2K1BA 1GKHA 4GS3A 3Q22A 3PCOB 4JV5Q 1EWHA 1IBML 1BF4A 2Z1CA 3M4YA 4LFAL 1HRJA 4NPSA 3C1EA 5CGKA 4A3JH 1VQHA 1N34L 4GNXB 4JW0A 3GV6A 2R6GA 4RGOS 4XT1B 4DV5L 2D9UA 1GHJA 2FMMA 2MPMA 1S40A 2KBNA 4BA1I 3K81C 3X3MA 2EY6A 5EBCA 3ND9A 1IBKL 1E2ZA 1VQ8A 4L5RC 2JEAI 1ICWA 3L3OC 1HZCA 2EY1A 4B3TQ 5D3DA 3OPOA 3HOWB 4NDXA 1L0XB 3ZYYX 4FYDA 3PIOA 1I4PA 5C4XB 2NZ1D 3D6WA 3J7ZC 4KKSA 4V190 2R7ZB 4IUPA 4ABNA 5FLXE 1E22A 3I90A 4IPCA 4DR7L 1K8GA 3PV0A 1AE2A 1JB7A 1V1PA 4JI8L 1WTWA 3VA7A 3MEHA 1I6VC 3PO3H 1ICFB 3S1QB 1SROA 2F0IA 3HOXB 4JI7Q 4JYAQ 4KY5A 2R93H 2B2TA 4QL5A 2K5HA 2BDNA 2E2JH 1X3QA 3C0NA 1STNA 1BCPC 3E0EA 1PRTF 3I4NB 4A3IB 5FJ8G 3S16B 2F3IA 1I4QA 1Y1WH 3DXJC 4X64L 3LX0A 1KC8C 3NELA 3U9SA 3CCUA 2WKDA 2BA1A 4A3JB 1STGA 2UXBQ 4EQPA 3CC4A 2LFNA 2YU9H 3E6ZX 3CP0A 2A6HC 4NKLA 2JA7B 4LF9Q 1U4MA 2MGSA 5IYBH 3OW7A 4BY1H 1BBWA 4N9TA 1RDPD 1KLGD 2QKIC 4R4CA 5IP9H 3P20A 1IKLA 3J81j 3AB9A 3KUPA 4YCVA 1Y1VG 1JCKB 4UP8A 5C3XA 1S5ED 2RCNA 4XDXA 5C3WA 2B63H 3NTHA 4DGZA 1NR4A 3DM1A 3VR2A 4POGA 5G3LD 2AMCB 2FMCA 4KHPL 1GVPA 1LM0A 3A55A 4B3ML 3S2DH 1EY7A 4KHVA 1R4PB 2BE5D 2NVYH 3RZOH 3K57A 5HGQA 1GHKA 4G7ZC 1S5DD 2F0JA 3DEOA 4A3EG 3V96A 1X3PA 3JAMi 1STEA 4OX9L 1L0WA 2E2JB 4AH6A 4MTKA 4CBVA 3BDCA 2X6LA 1X3GA 4NXML 1HUMA 2QW7A 2F0NA 2X6GA 1ESRA 5M5WB 1E2WA 4Q0FA 4CDCC 3KJOA 3AU7A 1G8ZD 2EYOA 5DEHA 3PUWA 1S72A 3SK8A 2OEOA 1KQSA 4OIJA 2M9VA 4DUZL 4JI4L 5JPMC 2PQAB 2RVLA 3FRPB 3HFZB 5CMDA 3RZDH 1I6HH 5CBAE 1O7ZA 4TVAB 1S3OA 5KRUA 3HOWG 2VNUD 4DR4L 1K0SA 4HR7B 3A0JA 1QVGA 5C4XG 5GROA 1EZ8A 5M3MH 1W2BA 4C3HB 4PV1C 2R7ZG 4FNFA 1OO9B 4LUZA 4R9WA 4BY7H 5HY6A 1UNSA 3E9IA 2B63B 1TS5A 1Q12A 3MXPA 1G6ZA 3STBD 3G4SA 2IL8A 1L1OB 5KEEA 3J80L 3RN2A 2L11A 2HQEA 2R92H 1CQFA 2K50A 1YNJC 3T1YL 1VQLA 3HOXG 1EL0A 1TS2A 1QB5D 1SNQA 4DR3Q 3GTMH 2ASBA 4YY3Q 1TR5A 2E2IH 4PZ6A 3NBHA 5ISRA 3BDLA 4HAEA 1PFNA 3MTSA 4J8QA 1MSGA 5HGTA 5GAGC 3Q0AA 3G6EA 2I46A 1MGSA 4KV6A 3VYSA 4HCSA 1IW7D 1PH4A 1IYVA 1A8VA 2JP1A 3UE0A 4K14A 2NUCA 4A3JG 2Q2IA 3PUYA 1LTID 2OTLA 2EJMA 3FKIH 1EYGA 3J81L 4F7XA 2JA7G 1K83H 2A74C 2EE1A 3NBIA 1V8QA 2B8FA 4ZRZA 1EQQA 1TS4A 4J1MA 2EDGA 5JJKA 4DK6C 5LMNQ 1BUVT 1RHPA 3P1HA 2E5LL 4F87A 1JOOA 1I6HB 4R4OA 3K0XA 3R8BA 3PSIA 2N78A 5EPLA 4I65A 1MSHA 3TMEA 2WV6D 1R9TH 2GVBA 3KF8A 3ERQA 2NVQB 5M5YH 1BKBA 1YITA 4B3RL 2A69D 2PI2A 5GADC 3I91A 3QOLA 1VQJA 1XPUA 4HCEA 5C6AA 4DUYQ 1HJPA 4OONA 2PI2E 3TP8A 3HOUH 4GKJL 2F0HA 4JPBW 1EFWA 1IZ6A 1KRSA 2D2CC 1T9HA 3FPPA 3GTOH 1C48A 2R93G 3G4NA 1Q8KA 3GTMB 4L5QA 5C5MA 4ZKBB 1X3EA 4BXXH 2F03A 3VR4A 4DK3C 1SBBB 3CCEA 1QZGA 4JBKA 4DXFA 2VUMB 4HJAA 4LF6L 1G291 2L55A 3Q6SA 5FOBB 3PO2H 1O80A 1PREA 3S9WA 1Y1WG 4GOPC 4ZQ3A 1HNXL 3X3NA 3UDGA 1STBA 2Z4IA 4JOIC 1B9NA 1KL9A 3K58A 1QNUA 1V1PB 3HOVB 1ESFA 1JE4A 4R8NA 2KCCA 3L2PA 2SNSA 4AQYL 3O13A 5EQ0A 3TP7A 1K9MC 4JI2L 3GQBA 3W2DA 4RCOA 2DJFC 1P8LA 3K8AA 1SNMA 5IP9G 4B3MQ 2UUAQ 1EWCA 4DAPA 2JA5H 4FXKC 3P75A 2L1BA 1R9TB 2B63G 5M5YB 2L0CA 1H9SB 3OIPA 3R3OA 4YWKA 4PZ7A 2RCFA 4A3KH 1DJRD 1VS0A 3HOUB 3OWFA 5EAYA 3GTLH 1ILPA 4X66L 3S1NB 1NY4A 2HDMA 2CHBD 3ONAB 3T4AC 3E5SA 4OGQC 2R7DA 2RHQB 1SNDA 3MXUA 3K5NA 3NSWA 3H3VC 4KY6A 5KNDA 3MXGA 4RA8A 4JI0L 5GAEC 3S14H 3HKSA 1IHZA 1QNKA 1N32Q 4LF7Q 3CC2A 1ONLA 2EYPA 1AN8A 3HP3A 3NWSA 2Q8IB 5FO7B 3OMGA 2AQ1B 4DXGA 4C3IH 4AIMA 3I2ZA 4JV5L 4DK1A 3AFQA 4K2KA 1E3PA 4BBSB 4KY7A 1F9SA 5AFWA 2H5XA 4UAIA 3FHWA 2F0MA 3KFUA 1JR0D 4IPHA 1I3QH 4DK0A 1OXTA 1D7QA 4B9XA 1GOZA 1DXMA 1WOCA 4ZK9B 5JOBA 1KABA 1PTOF 1W6KA 1VQKA 4GLXA 4EX5A 1IXRA 1SFOB 2HQLA 1PLFA 4DNRB 4B3TL 1JICA 3NQTA 4LK1C 3DMUA 1KIXA 2J0TD 5IGEA 1PYSB 2K5VA 3BYTB 4PMWA 1BCPF 1CZGA 2K03A 1CKMA 4X65Q 1WVLA 5FJ8H 1TWHH 1SYBA 2R92G 1N33Q 3HRZC 3D3RA 3MZ5A 2Q2UA 3TEHB 2E2DC 2NZOA 1VQ4A 1PFBA 4PZ8A 2F0FA 4JYAL 1VF5C 3BJUA 4JI7L 1VQ6A 2Z6BA 4UPAA 3D31A 2VUMG 1WCMH 2B2UC 2BCOA 2EQSA 4Y7NH 3S14B 2IX3A 4IN3A 1G2TA 3UDIA 2RDFA 1Y8NB 2KCNA 3N52A 3HOZH 4B3SQ 1IYUA 2XSCA 1BQQT 3PUZA 1MHWC 2FJ2A 2PW5A 1VQMA 1HA5A 2ZJQA 4C3IB 5JVG3 2BE5C 4AYBE 2O2LD 4F8MA 4NW2A 3W1GA 3Q24A 3HOVG 4JOIA 2RDHA 2UXBL 2UU9Q 3H6MA 3NP8A 4RKLA 3U50C 4LF9L 2RSOA 4IJHA 3EROA 1PZKD 4DR1Q 1EY4A 2E76C 2M00A 1D5MC 1YBYA 2XTIA 3I70A 2IT1A 4DV7Q 4X62Q 2MQHA 5D14A 3M85A 3NBHB 3GTPH 2EIFA 3S15H 1TKWB 2HD3A 3MC0B 4A3EH 4GZYC 1YI2A 5EKKA 4O0AA 4XQJA 1EY8A 2K5WA 4L5SA 4MIUA 4RWSC 2E2HH 3HOUG 4ZAIA 5H1SE 1TT2A 1I94Q 4KHZA 1VQPA 4LF8Q 3GV3A 4ZCKA 3JAME 3A8IE 2F0EA 4DPGA 1S5BD 1FL0A 3EIVA 3NWTA 2R61A 1YZ6A 4BXXG 1LO5D 1SMYD 2AQ2B 1CUKA 5GAHC 2HHHQ 3A8KE 1E7ZA 4DN4M 5JJZA 1YJ9A 1RIPA 2Y0SE 2OQ0A 1SAPA 1D5ZC 1TWCB 3HOZB 3KF8B 1NBWA 1WD1A 2RA4A 4WORA 2Q8RE 3HZXA 1TY2A 4LF4Q 1BXTA 3E0JA 4A3DH 1U4RA 1AW7A 5C4XH 3CMAA 1U0LA 1Z47A 2NWGA 4APVA 2EYLA 2H4OA 3RN5A 2QA4A 3CU7A 1C4QA 3CQZH 1AH9A 1LV9A 2F0GA 5DNFA 2RF4A 2JA5G 3S1QH 3MXNB 3GTPB 4A3BH 4HIMA 4HSPA 2K28A 3F2DA 1GUOA 1SE8A 2HIXA 5EPKA 1PRTD 4HIOA 3KDFB 2I5HA 3AFPA 1CZWA 2EJFC 4WJ4A 1IKMA 1I50B 2MFIA 3I4NH 2O5IC 1CKNB 4A3IH 2IWHA 2K5NA 4IPDA 1XNQQ 5C4ZA 1XMOQ 3S16H 4JI5Q 1PV4A 3NEMA 3C0OA 4A3KG 2E2HB 2NB0A 1EQVA 3AMUA 1RJTA 1Q90A 5NUCA 3I7FA 3DWAA 4HIKA 2ES2A 5BR8Q 2QEJC 3HS0C 4DR3L 4YWMA 1QVCA 1J5EQ 4YY3L 1FNVA 3GTGB 1VQBA 1LTGD 2ZXPA 1C7YA 2A6ED 4ILWA 2JA7H 3BZDB 1XTDA 2B2UA 2RSNA 2Q8TA 2Z4HA 2G9DA 3U4ZA 2EPBA 2IY5B 3KBGA 3S1RB 1PFSA 1PYWD 5K36H 4C3IG 3J7YW 4FXGC 2HUGA 5AJ3Q 1SE4A 2J7ZA 4A3DB 2QDBA 3F2UA 1PFMA 4DKAC 3RLFA 1Q46A 4LF5Q 1K3BC 1YJNA 4FP5D 5LMNL 4KKUA 2B2VC 3CQZB 2K6AA 1TWFB 2JA9A 2VY3A 1PTOC 2ZXRA 1XXGA 1NCVA 4UP9A 1UWVA 4A3BB 3D6CA 4JCVE 1LTLA 1B53A 3PUVA 2K52A 1TXYA 2WKCA 1X65A 1E1OA 1JJCB 2F1MA 4IZ8A 5IODA 1LTRD 1LLRD 5IGDA 4YHHQ 1FNWA 4DUYL 3URYA 3T56B 4DV4Q 5M5WH 2VW9A 1SNOA 5CV7A 5CV9A 4IQZA 2IHFA 1SMXA 1BBXC 1XMQQ 4TQUS 3VR3A 1B3QA 1SRUA 4O1NA 1WCMG 3J80i 2F52A 1FJGQ 1H95A 1U5KA 3IFDA 1M1KC 1STYA 1P16A 4JBJA 4P72A 3HOZG 2KJXA 3KLSX 2ZTCA 3CKIB 4DV3Q 1CQVA 2OCEA 4O2DA 4RHSA 4K5VA 1YNND 4MTNA 1HXYD 2VQFQ 3HKZE 1WFQA 4Y52H 2OQKA 4C3HH 4YCWA 3EVQA 4JI3Q 2KHJA 3RR5A 5KYLA 4DV2Q 3WOEA 4A3GB 1IBLQ 2KEEA 1XJVA 3J80c 5TSSA 5JJLA 2ZT9C 3IFTA 4BWGB 1WTRA 2O4XA 1CFMA 3SE0A 1EIHA 2IHEA 4ODGA 3BZCA 2UUAL 5IGBA 1A3TA 5A2QE 2UUBQ 4K6DA 1EYCA 4C56C 3M4OB 3KF6B 3CRKC 3QO2A 1PRTB 5JAVA 3ND8A 4J15A 1I4RA 1ASZA 4A3FB 1NR2A 3GDEA 1GO3E 2HCIA 4AYBB 1CHQD 1Y8OB 1WTHA 2NTSA 3EA6A 3MA2B 5C4HA 1EOTA 1KAAA 3V05A 4X6AH 3J81c 1F2ZA 2MHVA 2EY2A 2WINB 2F0PA 1WD0A 1AP0A 4XQQA 3K80C 1QZHA 1H9JA 5IT9E 4OO1H 5FO8B 4OXPA 1AEXA 2VL6A 5LL6S 4C1NK 1U4LA 4P74A 1N32L 4LF7L 1RTOA 3E3XA 1Z52A 1G51A 1N36Q 1UE5A 4HTHA 5C44B 3GO5A 1Q8IA 1PH9A 1HZAA 1X32A 1D8LA 1AE3A 4A3DG 1ZYRC 2NVQH 4GN3B 1QJOA 1ET6A 5D3IB 4TKOB 3FPUB 3T51B 3ULPA 2UUCQ 1FGBD 3A54A 4K5WA 4GNXC 1S4ZA 4G4KA 2NZHA 4NB3A 2F0LA 2KCMA 1EY5A 3QOJA 1VF7A 5CC4A 1X56A 5DM73 2A73B 1CSPA 4DA2A 2B2VA 2D0PA 4LUVA 4QY7A 2CW0D 3WOFA 4A3BG 1FYCA 3C0MA 1KLUD 4IOAA 4QCLA 1EEFD 1V1QA 4H0LC 1Y69U 2QF7A 2VUMH 1SR3A 4KD4A 4A3IG 1BNZA 3I4NG 3A8JE 2EY5A 4X65L 3VYTA 1JQYD 1N33L 2F0QA 2BH8A 5G3LF 2F3WA 1M90C 2WB1E 2A8VA 1VQDA 1OXXK 5JJIA 4FDBA 1DD2A 4DAYB 3SDZA 2R7FA 4LMQD 1LTAD 1DM0B 1O7YA 2JE6I 3K5MA 1BR9A 3HOVH 1UEBA 3IKJA 5M3FH 4HJ9A 1VMPA 3U4VA 3EFXD 4XQNA 4OO1I 1PZJD 2CQAA 1PA6A 2EJGC 2ICIA 2JN4A 2DGYA 3NTKA 1K3RA 4JVZA 2SDFA 4MHEA 5K36G 4B3SL 4NMZA 3GTJH 4PNYA 5I2XA 1PH6A 3I72A 2L5TA 1A0IA 4LAAA 5I6YA 4CGYB 4A3GG 2FHTA 4XYQA 4EQOA 2LKVA 4LFCQ 1F9PA 1ML0D 2UU9L 4JG2A 5CV8A 1HNWQ 1J8IA 1A15A 1G91A 1WTQA 1XX8A 3S1NH 1J9OA 2EYJA 4DR1L 3NUCA 3K5LA 2EZVA 1QUQA 2DN8A 4DV7L 4X62L 3PF5A 4U673 2A68C 3OWEB 1EEID 5ELEA 1PZID 4A93B 2L9HA 4DF7A 1CTMA 3OHXC 4KJNA 4OEMB 2LSSA 2UXDQ 3ZJYC 2F0SA 1XNRQ 2B2YC 2RHSB 3QJYA 4QGUA 5FLXc 3GTKB 5ELBA 5I2YA 3RMHA 1I94L 5IWAQ 4LF8L 4JC0A 1IL8A 1N9WA 4FF4A 1VQCA 3RUZA 4OWXB 3SXHA 1PYBA 4TRDA 4EGVA 4BBSH 3F8TA 2DY7A 3BVMA 3SK4A 3M4QA 2K04A 1JWMD 3DWPA 4GN4B 3ERSX 3CRLC 3DHQA 3LNNA 3MEFA 5M3FB 3MAQA 1DGSA 1KRTA 2HHHL 5EGTA 4DNTB 5LL6X 1K28A 5C44G 3OSOA 3T1HQ 1SFOH 5IYDH 3K6OA 2PPBC 1JT8A 3GTJB 2DUDA 4RAUC 4C3HG 3TS0A 2PQEA 4LF4L 4XXEA 1O78A 1BCPD 4K2LA 5LMUQ 2G9HD 1U9RA 1C0AA 3W1BA 1H9RA 4OWTB 4GN5A 2Z8LA 5DLQE 3B6YA 2PZUA 4DR2Q 4GNXA 5IP7H 1RTNA 1EYAA 2A6EC 2BOSA 5KIXA 1EYDA 4IOCA 2AWNA 1WTVA 5J39A 4K6LA 2NVXB 5EKLA 5FKAC 3U9OA 4RGNA 4QMGA 1OXVA 1T5XD 3QR8A 1EFID 4GLVB 2A6HD 1VQ9A 1PVOA 2NVTB 4KK7A 1MIUA 1VQIA 3BG3A 4DFAA 2GVAA 5K5PA 1XNQL 1XMOL 1ET9A 1VMCA 4JI5L 3EBEA 4C2MH 1JOKA 1L1OC 2KHIA 3GP7A 2SNMA 1BBUA 2I5MX 2JYOA 5KYIA 1CA6A 1L2FA 1SYEA 3MVVA 1DOLA 5FLXL 3KYHC 1VQNA 5BR8L 1KAWA 1HH2P 3V2TA 2CQOA 1J5EL 3R93A 4QQBX 2RBMA 4OO1G 2B29A 3RLNA 3K7AB 1TY0A 3K5OA 3SVMA 4OHJA 4BS9A 1S5FD 4HJ7A 5M9OA 2FINB 3C46A 1BO0A 3F2CA 5E4WC 4IFDI 5I9PA 5AJ3L 1Z6HA 2XNAC 4CJ0B 2WP8J 4OL7A 4IO9A 3M3YB 2Z6KC 4FF2A 4RGMA 4G57A 2XRQD 4NXNQ 1UEAB 1HHVA 1Q81C 2XGTA 4ULLA 1CT1D 3EQLC 4F88A 4LF5L 1UAPA 2NYZD 5IT9c 1LT5D 5FO9B 4R8IA 2F0KA 2B39A 2NTTA 2JQOA 3TREA 4B08A 2K7VA 3CC7A 2CCZA 1SE2A 3DM3A 1BOSA 4KTAA 2JJQA 1YNNC 4BA2I 3A7LA 1Q1BA 5I4DA 1RODA 1EZ6A 2AWOA 3ICEA 1KDCA 4GKKQ 1E1TA 4IALA 2NBFA 5D65A 5CR3A 4YHHL 1TWCH 1G6PA 2B2YA 1AZQA 3CW2C 1GUSA 2HDLA 4C2MB 1NE3A 4DV4L 1F2MA 4GOPA 3L9AX 4O42A 2EYHA 1YEZA 2BA0A 3MFGA 1HTPA 3J7AF 3DWQA 1XMQL 5IE8A 5ELFA 5M3FG 5FLMG 1X54A 1JWSD 2VZAA 3RNUA 1FJGL 2VB3X 5IIFA 3PGZA 4X3TA 5A2QL 3S17B 4R4TA 2Z0SA 5E4XA 3SGIA 4A4IA 1NTGA 3PUXA 4E6IA 2TMPA 2IX1A 4HEDA 1II3A 4DV3L 1CM9A 2Z9HA 2LS01 3TSSA 4M8AA 1B44D 1GM5A 1EU4A 2WAQE 2VQFL 2KOLA 1SNPA 1BCPB 3QG1A 3WWVA 2J4XA 4JI3L 2WB1B 3TRZA 1I50H 5IGFA 3I8ZA 4DV2L 1IBLL 4RHRA 3UDFA 2KUMA 3VA5A 2SEBD 1BDOA 4IUUA 4IUTA 2PQAA 3FMCA 2JA6B 2L15A 4HJ8A 3KK7A 3IL8A 2KENA 5IT9L 4LWCA 4R4QA 4LUOA 2UUBL 3GTGH 2ZTEA 3C3LA 2I5LX 2YTXA 3I4MH 3R2TA 1RCVD 2E74C 3HOYB 5L37A 3U58A 3STBC 2VXWA 3A74A 2IPKD 4P2CB 3S1RH 1BVSA 4DV1Q 1JB3A 4B9WA 1A3VA 1PH2A 2ZM6Q 4X3KA 2K05A 1XTCD 3BZKA 3S24A 1WTOA 2D5DA 4BBSG 2CW0C 3CPWA 1NAPA 2ZXOA 5T1IA 2L12A 3M9BA 4V0BA 3I73A 3H91A 2I07B 5JEAH 1I4GA 3CPFA 4GLAC 3VDYA 4JBWA 2MP1A 1EOVA 5C3EB 3A5UA 1KDAA 1AZPA 1ILQA 4N8X1 4IFDG 4G7HC 1PH3A 5J22A 5M5XH 3D4WA 4LFBQ 1AFPA 4JK1C 2KVMA 1TWFH 2AUKA 1TWAH 5IYDG 4P71A 1JWUD 2YTYA 4L5TA 3G7LA 1N36L 3C2PA 1HUNA 1ENAA 1RL2A 1IW7C 2D62A 1MKHA 1XWEA 2QGQA 4A75A 1PH1A 2MO1A 2MJ8A 3BVGA 1SNCA 3T13A 1JMCA 2UUCL 4P75A 5IP7G 1YVCA 5CORA 1PXUA 3D0FA 3TP5A 1VQ7A 2FXQA 4OWWB 3TP6A 1TVXA 3NENA 1WTXA 1F9QA 1NJIC 5CV4A 4CHTB 4A3MH 2F3VA 3A56A 3OTOQ 3G6JB 1HR0Q 2ALYB 4HN7A 1FR3A 4IJLA 3I56A 5E7NA 3NQIA 2Q2HA 3I4MB 5I6WA 4KN4C 1HNZQ 1VQFA 2A69C 1YNXA 2LY7A 4N9PA 3KOJA 3H0GH 1B7YB 2E8GA 2HCCA 2JA8H 1S5CD 3D8GA 4A3GH 1NSNS 1XYIA 3K7UC 4HIDA 1LT4D 2N88A 1HCZA 4IUNA 2CFMA 5GQOA 2EOTA 2N3SA 2VQEQ 4L6TB 1GUGA 2K5QA 1YHQA 2LXJA 2RDGA 1YJWA 1QCBD 5M5XB 1F2YA 3I4OA 4ZUIA 4DAMA 3QB3A 1TWAB 4EVOA 2PZTA 1I4HA 3RD4A 3TN2A 3M4OH 2WB1G 2M2LA 2OF1A 1YHBA 5ELOA 1HR0W 5F2DA 3AEVA 4QIWE 4LFCL 1FGUA 4A3FH 2AKWB 2JEBI 1TQOA 1WYDA 1OXSC 2CKZB 5J1ZA 3GTQH 1HNWL 3KJPA 1LACA 2AHOB 4DV0Q 2MNAA 2SOBA 2JA6G 3OW2A 3M7NA 1LTTD 1NNXA 4MN3A 4N8FA 5ELDA 3QWNA 3D4DA 2ICEC 4HSVA 5E3FA 3N6RA 3J7A5 1A3UA 3RLOA 4A3MB 2PNHA 1T5EA 2A5HA 4ZYSA 3I3CA 1PMRA 4MZ9A 1ZEQX 3NPPA 4FF1A 3HOYG 4A76A 1V9PA 3UE1A 4LJZC 3NTIA 2UXDL 1GD7A 1XNRL 4I7AA 2H1EA 1PH8A 3MFYA 3UDXA 1H9SA 2E75C 5C44H 1GUWA 5IWAL 2RQXA 4DR6Q 1EY6A 1GXDC 3S2HH 3H0GB 1O7IA 1JJGA 2B8GA 3BYYB 2L4NA 1K8AC 4ZUJA 2JA8B 4H13C 2YYZA 5C3EG 5IYCH 2K5DA 4U68A 4LNQA 1VQ5A 4TSSA 5E1FA 1V1OA 1EIYB 4A3LH 2JSOA 1GUTA 3J81i 4Q5VA 1JE5A 3T1HL 1A2TA 4IPGA 3QIAA 4CKBA 4K8JA 4CJ1B 3H3VH 2HT1A 1KXLA 2KQ3A 5LMUL 2XWJB 1GUNA 1UUPA 2NN6H 4PG3A 4K8IA 2P5ZX 3FVQA 4DR2L 1LYLA 2RKSA 3GTQB 2G5DA 4DV6Q 4GOPB 1Z7TA 4C1NI 3W3AA 3SEBA 3PO3B 3E9HA 3CCLA 5IGCA 5BN4A 2PMZE 4RGTA 2R93B 1K73C 3HGBA 4ME3A 3H09A 5CV6A 1D1KA 2OT2A 4DNIA 5JEAJ 4RMFA 3I4MG 2B2WC 2PCFB 2WAQB 1K8MA 4JI1Q 2CVRA 2WACA 1Y1WB 4DU9A 1B9MA 1B1ZA 1Q82C 3S1MH 3TBIB 2IX0A 5CBEE 4DR5Q 3JC66 4K0KQ 1B2TA 3S2HB 4QUCA 2HIVA 3CCVA 3JAMc 3PIO3 5JEAG 3R2IA 4IUQA 4PMCA 2YU9B 1Q1EA 4UHVA 3WDNA 2O5JC 4CDDC 1LT6D 2UXCQ 1TWGH 2GA4B 4IURA 4BY1B 5IOCA 4K5XA 1W6JA 3MWYW 3SR1A 1H9MA 3NHHA 4JBMA 2K33A 1YIJA 3W5OA 5C4JH 4JI6Q 2OTJA 3G48A 2IW3A 2Y0SB 4A93H 1LT3D 1F77A 1STAA 3H3VI 3F2BA 1SYCA 2OWOA 3AYHB 2F4VQ 2CWAA 4RCNA 2K32A 4NXNL 4YIJA 3DUZA 1V43A 1JC7A 4KKTA 2NN6I 1JJ2A 3GTKH 4LW1A 2FFKB 3S2DB 1LUZA 1IBMQ 1B3AA 2WIIB 4LFAQ 1NUCA 2NVYB 4A3MG 3RZOB 1EWIA 1N34Q 4FXDA 1Q3LA 3GD7A 4DV5Q 3ULLA 1HPCA 3CMEA 5C5LA 1DOMA 1YHAA 3NXWA 5FLMH 1D6EC 1X55A 4C3JH 4GKKL 1IBKQ 1I4XA 1K0RA 3UI2A 1MJEA 3DLLA 4OELB 1UE6A 3H0GG 1PDQA 1SLJA 1LTBD 1Z9FA 4YCUA 1ENCA 3S1MB 2N49A 1SYFA 1HA6A 4H7BA 2KECA 2JA8G 2F0DA 3L7ZC 2F0UA 2PZWA 3CCJA 5JVH3 1DYQA 1SYDA 4DR7Q 1DONA 5T1GA 1SMYC 4H44C 4IUVA 4JI8Q 3JAML 1TWGB 3FP9A 1QWYA 2B3GA 3RZDB 3I4LA 1ZXTA 1HQMC 4CJ2C 3KLRA 4FO2A 1OXUA 1F9RA 1QE6A 1WTPA 2VS1A 5C0XH 2NVXH 2K01A 3LWUA 4ZKCB 3BU2A 3VR5A 2XVSA 4CDEC 1R4QB 3EN2A 5C4JB 1XPOA 5HURA 5M3MB 3F1ZA 3C1FA 2NVTH 4KLKA 3OYYA 4BY7B 2A1AA 4A3FG 5LHY1 4WFN3 1KDBA 4AYBG 1VQAA 4XIGS 1H9KA 2V1CC 2WFWA 3PO3G 4KD3A 1MD2D 3IRBA 2R92B 1LABA 4X64Q 1TU2B 1CSQA 3MHBA 2EXDA 4ME5A 1IL2A 3CCRA 2LXKA 1D2BA 4UY8C 3HEJA 3MXNA 2E2IB 2EXZA 3I55A 4WRDA 1M4VA 3K7AH 4L63B 2WAQG 3Q23A 4I7ZC 1PRTC 2B2WA 3KDFA 3VYUA 5LMNW 3FDTA 4EQ5A 4C3JB 4A3CH 4IFDH 1CKNA 1PTOD 2XWBB 1MJCA 1SE3A 1HTLD 3OOCA 4R4IA 1SJHD 4QIWB 2K75A 4DV1L 3CCQA 3TQYA 4RG1A 2ZM6L 2KCTA 3FKIB 4PMBA 3M3YH 1QOHA 1KD1C 1HFNA 1K83B 1EIFA 1QILA 5BN3A 2MUYA 5IYCG 5IYBG 3CHBD 4BY1G 2N55A 1FD7D 4EQNA 3KLWA 4KHPQ 4A3LG 1CKOA 1W3SA 5J3BA 3PQIA 3H94A 4ID6A 4LFBL 1X6OA 1A2UA 1SJED 4HMJA 2VB2X 2Y0SG 1QG7A 3SHLA 3TZUA 5C0XI 4OX9Q 2XIWA 3NK9A 1X3FA 2NN6G 4X3UA 3HKZB 5JPNC 4NXMQ 1JORA 1U4PA 3HG9A 4P73A 4QF4A 4X3SA 4BBRH 4NP5A 4XTCS 1VQEA 2DY8A 4PQXA 1B50A 1CI3M 3NE5B 3GTOB 1Y14B 5CV5A 4H02A 1VQOA 1B4OA 2CWPA 5ELCA 4HJ5A 2F0TA 3OTOL 5DAUA 4QB4A 1HR0L 1OTCA 1EQRA 4DUZQ 4JI4Q 3ULJA 1A63A 1C8CA 3CCMA 5KNCA 1DZ1A 1MI2A 3S17H 1KNAA 3PO2B 1HNZL 1PTOH 4XYOA 1UE7A 3J7AV 2QILA 1NMFA 4CKEA 1E0BA 4DR4Q 4POFA 3ITPA 4YWLA 1SYGA 3FEWX 3LGJA 3CCSA 2PO4A 5EBDA 4KMUC 1C9OA 2K4KA 3KLSA 3CF5A 1HZBA 3SK5A 1SXTA 3PIPA 4MNOA 2PMZB 1EY9A 2C9OA 2IJ0A 5EJWA 1SSOA 1Y8PB 2VQEL 1QVFA 2TSSA 3T1YQ 3OMCA 2BDOA 1CHPD 2JA6H 4QJFA 3A7AB 2QEXA 4HMIA 2JA5B 3T53B 2OXPA 1HQRD 5M3MG 2C35B 1EUJA 2DJGC 4A93G 2JXMB 4BY7G 5COYA 2QCPX 1Q7YC 2PYKA 5EKIA 2ENBA 3HOYH 2XRSD 4J6HA 2AQ3B 3Q8DA 1F2LA 1E2VA 1JOQA 1K8OA 2MO0A 4BBRB 3K0YA 3AQQA 4DV0L 4A3KB 2D0OA 1UE1A 1N8RC 1PH7A 2Q2TA 3GTLB 1ZYRD 3PMFA 1MBYA 3J80E 1XPRA 5DM63 3G71A 1M8AA 3D4RA 2X69A 1EQTA 4FF3A 5FK9C 4Z9CB 5C3EH 4C3JG 1TS3A 3KF6A 2DNCA 5ELNA 2E5LQ 1EU3A 3CXCA 1YNJD 4M1UB 4FVMA 4XT3B 1PTOB 3L0OA 5C0XJ 1E24A 4OIKA 3BS1A 3A5ZB 2KA7A 4DR6L 1Y1VH 3FKIG 2QDLA 3TDQA 3VR6A 4UDUC 1CA5A 2PNRC 3P7JA 1ASYA 4B3RQ 5IY0A 3G4OA 1ENFA 1RKNA 3IAYA 3PF4A 2AUJD 1SN8A 2EVBA 2YTVA 4S3SA 3J81E 1I3QB 4GKJQ 5EPJA 5C0XG 1DCZA 1FNUA 1CK1A 2B2TC 1WJJA 2F0VA 2ZJPA 4KJOA 4CKCA 1NMGA 2V4DA 2XN9C 4LF6Q 2ZTDA 3HKZG 1PHJA 1A62A 1IYJB 4KI0A 2BH2A 1VQGA 2F0OA 1RF2D 3VYRA 3DEPA 4UP7A 4IFDJ 1WI5A 1TWHB 4QUFA 1STHA 3KBXA 4DV6L 4CDFC 5CYUA 1HNXQ 1L1OA 3EJIA 2EYMA 1I5FA 2EYFA 4WJ3M 2A19A 2K14A 1KHIA 4DAVA 2KHSA 3K59A 1WCMB 5A35A 4AQYQ 1DOKA 4JI2Q 1SEBD 3T16A 3PO2G 4G7OC 2GN5A 1SDFA 3M7GA 4RH6A 2LMCB 4Y7NB 4JI1L 3OIQA 4A3CG 2C5CA 1QUQB 3PIP3 2CH4A 2YV5A 1G2SA 3H15A 2F4IA 4WJWA 3CD6A 1B8AA 3M4PA 1PH5A 1B70B 1TIID 2A68D 1D5XC 3ER0A 3HOWH 1O7LA
chains in the Genus database with same CATH topology
3LWEA 1Y1VB 5KGUA 4DAYA 1VDZA 1D1IA 1ZKOA 5KNBA 1KNEA 4KN7C 1VCIA 1KTKA 3BDOA 1EY0A 2DNEA 2KEDA 1L0YB 1EIGA 2ID0A 5I9OA 3S15B 2R3ZA 2PW7A 2F0WA 4RFBA 1LTSD 4RKBA 4A3EB 4L8JA 1GJXA 4ZLTF 5IGGA 3BVZA 3SK6A 5BN5A 1A6XA 1RD9D 3TZDA 1HFGA 2K1BA 3Q22A 1EWHA 1BF4A 2Z1CA 3M4YA 1HRJA 3C1EA 5CGKA 3GV6A 2R6GA 4RGOS 4XT1B 2D9UA 1GHJA 2FMMA 2MPMA 4BA1I 3X3MA 2EY6A 5EBCA 3ND9A 1E2ZA 2JEAI 1ICWA 3L3OC 2EY1A 5D3DA 3OPOA 3HOWB 4NDXA 1L0XB 3ZYYX 4FYDA 1I4PA 5C4XB 2NZ1D 3D6WA 4KKSA 4V190 2R7ZB 4IUPA 4ABNA 5FLXE 3I90A 3PV0A 1V1PA 1WTWA 3VA7A 3MEHA 1I6VC 3S1QB 2F0IA 3HOXB 4KY5A 2B2TA 2BDNA 1X3QA 3C0NA 1STNA 1BCPC 1PRTF 3I4NB 4A3IB 3S16B 1I4QA 3DXJC 3LX0A 3U9SA 2WKDA 2BA1A 4A3JB 1STGA 4EQPA 2LFNA 3E6ZX 2A6HC 4NKLA 2JA7B 1U4MA 2MGSA 3OW7A 4N9TA 1RDPD 1KLGD 2QKIC 3P20A 1IKLA 3AB9A 3KUPA 1JCKB 5C3XA 1S5ED 4XDXA 5C3WA 3NTHA 4DGZA 1NR4A 3DM1A 3VR2A 5G3LD 2FMCA 3A55A 1EY7A 4KHVA 1R4PB 2BE5D 3K57A 1GHKA 4G7ZC 1S5DD 2F0JA 3DEOA 3V96A 1X3PA 1STEA 2E2JB 4CBVA 3BDCA 2X6LA 1HUMA 2F0NA 2X6GA 1ESRA 5M5WB 1E2WA 4Q0FA 3AU7A 1G8ZD 2EYOA 5DEHA 3PUWA 3SK8A 2OEOA 4OIJA 2M9VA 5JPMC 2RVLA 3FRPB 5CMDA 5CBAE 1O7ZA 5KRUA 2VNUD 4HR7B 1EZ8A 4C3HB 4PV1C 4FNFA 1OO9B 4R9WA 1UNSA 2B63B 1TS5A 1Q12A 3MXPA 1G6ZA 2IL8A 5KEEA 3J80L 2L11A 2HQEA 1CQFA 1YNJC 1EL0A 1TS2A 1QB5D 1SNQA 1TR5A 3NBHA 5ISRA 3BDLA 4HAEA 1PFNA 3MTSA 4J8QA 1MSGA 5HGTA 3Q0AA 2I46A 1MGSA 4KV6A 3VYSA 4HCSA 1IW7D 1IYVA 2JP1A 4K14A 2NUCA 3PUYA 1LTID 2EJMA 3J81L 4F7XA 2A74C 2EE1A 3NBIA 1V8QA 2B8FA 4ZRZA 1TS4A 4J1MA 2EDGA 1BUVT 1RHPA 3P1HA 4F87A 1JOOA 1I6HB 3R8BA 5EPLA 4I65A 1MSHA 3TMEA 2WV6D 3KF8A 3ERQA 2NVQB 2A69D 3I91A 3QOLA 4HCEA 5C6AA 3TP8A 2F0HA 2D2CC 3FPPA 1C48A 3G4NA 3GTMB 5C5MA 4ZKBB 2F03A 3VR4A 1SBBB 4DXFA 2VUMB 1G291 2L55A 3Q6SA 5FOBB 1O80A 1PREA 3S9WA 4ZQ3A 3X3NA 1STBA 2Z4IA 1B9NA 3K58A 1QNUA 1V1PB 3HOVB 1ESFA 1JE4A 4R8NA 2KCCA 2SNSA 3O13A 5EQ0A 3TP7A 3GQBA 3W2DA 4RCOA 1SNMA 1EWCA 4DAPA 4FXKC 3P75A 2L1BA 1R9TB 5M5YB 2L0CA 1H9SB 3OIPA 3R3OA 1DJRD 3HOUB 3OWFA 1ILPA 3S1NB 2HDMA 2CHBD 3ONAB 3T4AC 3E5SA 4OGQC 1SNDA 3MXUA 3K5NA 3NSWA 3H3VC 4KY6A 5KNDA 3MXGA 4RA8A 1IHZA 1QNKA 1ONLA 2EYPA 1AN8A 3HP3A 3NWSA 2Q8IB 5FO7B 3OMGA 2AQ1B 4DXGA 4DK1A 4K2KA 4BBSB 4KY7A 1F9SA 5AFWA 4UAIA 2F0MA 1JR0D 4DK0A 1OXTA 4B9XA 1GOZA 1DXMA 4ZK9B 5JOBA 1KABA 1PTOF 1W6KA 1SFOB 1PLFA 4DNRB 1JICA 3NQTA 4LK1C 3DMUA 2J0TD 5IGEA 3BYTB 4PMWA 1BCPF 1CZGA 2K03A 1WVLA 1SYBA 3HRZC 3D3RA 3MZ5A 2E2DC 1PFBA 2F0FA 1VF5C 3D31A 2B2UC 2BCOA 3S14B 2IX3A 4IN3A 1G2TA 2RDFA 1Y8NB 2KCNA 3N52A 1IYUA 2XSCA 1BQQT 3PUZA 2FJ2A 2PW5A 1HA5A 4C3IB 5JVG3 2BE5C 2O2LD 4F8MA 4NW2A 3Q24A 2RDHA 3H6MA 3NP8A 4RKLA 2RSOA 3EROA 1PZKD 1EY4A 2E76C 2M00A 1D5MC 3I70A 2IT1A 5D14A 3M85A 1TKWB 3MC0B 4GZYC 5EKKA 4XQJA 1EY8A 2K5WA 4MIUA 4RWSC 4ZAIA 1TT2A 4KHZA 3GV3A 3JAME 3A8IE 2F0EA 1S5BD 3NWTA 2R61A 1LO5D 1SMYD 2AQ2B 3A8KE 4DN4M 5JJZA 1SAPA 1D5ZC 1TWCB 3HOZB 1WD1A 2RA4A 4WORA 2Q8RE 3HZXA 1TY2A 1BXTA 3E0JA 1U4RA 1AW7A 1Z47A 2NWGA 2EYLA 2H4OA 3CU7A 1C4QA 1LV9A 2F0GA 5DNFA 3GTPB 4HSPA 2K28A 1GUOA 5EPKA 1PRTD 1CZWA 2EJFC 1IKMA 1I50B 2O5IC 2IWHA 5C4ZA 3C0OA 2E2HB 2NB0A 1EQVA 3AMUA 1RJTA 1Q90A 5NUCA 3DWAA 2QEJC 3HS0C 1FNVA 3GTGB 1LTGD 2ZXPA 2A6ED 4ILWA 3BZDB 2B2UA 2RSNA 2Q8TA 2Z4HA 2G9DA 2EPBA 3KBGA 3S1RB 1PYWD 5K36H 4C3IG 3J7YW 4FXGC 2HUGA 1SE4A 2J7ZA 4A3DB 2QDBA 3F2UA 1PFMA 3RLFA 4FP5D 4KKUA 2B2VC 3CQZB 2K6AA 1TWFB 2ZXRA 1PTOC 1XXGA 1NCVA 4A3BB 3D6CA 1B53A 3PUVA 2WKCA 2F1MA 4IZ8A 5IODA 1LTRD 1LLRD 5IGDA 1FNWA 3URYA 3T56B 1SNOA 5CV7A 5CV9A 4IQZA 1BBXC 4TQUS 3VR3A 4O1NA 3IFDA 1STYA 2KJXA 3KLSX 3CKIB 1CQVA 4RHSA 4K5VA 1YNND 1HXYD 3EVQA 5KYLA 3WOEA 4A3GB 2KEEA 5TSSA 2ZT9C 3IFTA 4BWGB 1WTRA 2O4XA 1CFMA 3SE0A 1EIHA 4ODGA 5IGBA 1A3TA 5A2QE 4K6DA 1EYCA 4C56C 3M4OB 3CRKC 3QO2A 1PRTB 5JAVA 3ND8A 1I4RA 4A3FB 1NR2A 2HCIA 4AYBB 1CHQD 1Y8OB 2NTSA 3EA6A 3MA2B 5C4HA 1EOTA 1KAAA 3V05A 1F2ZA 2MHVA 2EY2A 2WINB 2F0PA 1WD0A 1AP0A 4XQQA 1H9JA 5IT9E 4OO1H 5FO8B 1AEXA 5LL6S 4C1NK 1U4LA 1RTOA 1Z52A 4HTHA 5C44B 3GO5A 1Q8IA 1X32A 1ZYRC 1QJOA 1ET6A 5D3IB 4TKOB 3FPUB 3T51B 1FGBD 3A54A 4K5WA 1S4ZA 4G4KA 2F0LA 1EY5A 3QOJA 1VF7A 5CC4A 5DM73 2A73B 4DA2A 2B2VA 3WOFA 2CW0D 1FYCA 3C0MA 1KLUD 4QCLA 1EEFD 4H0LC 1Y69U 2QF7A 4KD4A 1BNZA 3A8JE 2EY5A 3VYTA 1JQYD 2F0QA 5G3LF 2F3WA 1OXXK 1DD2A 3SDZA 4LMQD 1LTAD 1DM0B 1O7YA 2JE6I 3K5MA 1BR9A 3IKJA 1VMPA 3EFXD 4XQNA 4OO1I 1PZJD 2CQAA 2EJGC 2ICIA 3NTKA 2SDFA 4MHEA 5K36G 4NMZA 4PNYA 5I2XA 3I72A 2L5TA 4LAAA 5I6YA 4CGYB 2FHTA 4XYQA 4EQOA 2LKVA 1F9PA 1ML0D 5CV8A 1J8IA 1A15A 1G91A 1WTQA 1XX8A 1J9OA 2EYJA 3NUCA 3K5LA 2EZVA 2DN8A 4U673 2A68C 3OWEB 1EEID 5ELEA 1PZID 4A93B 2L9HA 4DF7A 1CTMA 3OHXC 4KJNA 2F0SA 2B2YC 3QJYA 3GTKB 5ELBA 5I2YA 3RMHA 1IL8A 4FF4A 3RUZA 3SXHA 4TRDA 4EGVA 2DY7A 3BVMA 3SK4A 2K04A 1JWMD 3DWPA 3CRLC 3DHQA 3LNNA 5M3FB 3MAQA 5EGTA 4DNTB 5LL6X 3OSOA 3K6OA 2PPBC 3GTJB 4RAUC 4C3HG 2PQEA 4XXEA 1O78A 1BCPD 4K2LA 2G9HD 1U9RA 1H9RA 2Z8LA 2PZUA 1RTNA 1EYAA 2A6EC 2BOSA 5KIXA 1EYDA 2AWNA 1WTVA 5J39A 4K6LA 2NVXB 5EKLA 5FKAC 3U9OA 4RGNA 4QMGA 1OXVA 1T5XD 1EFID 2A6HD 2NVTB 4KK7A 3BG3A 4DFAA 5K5PA 1ET9A 1VMCA 1JOKA 3GP7A 2SNMA 2JYOA 5KYIA 1CA6A 3MVVA 1SYEA 1DOLA 5FLXL 3V2TA 3R93A 2RBMA 4OO1G 3K7AB 1TY0A 3K5OA 3SVMA 4OHJA 4BS9A 1S5FD 5M9OA 2FINB 3C46A 1BO0A 5E4WC 4IFDI 5I9PA 1Z6HA 2XNAC 4CJ0B 2WP8J 4OL7A 3M3YB 4FF2A 4RGMA 4G57A 2XRQD 1UEAB 1HHVA 4ULLA 1CT1D 3EQLC 4F88A 1UAPA 2NYZD 1LT5D 5FO9B 4R8IA 2F0KA 2B39A 2NTTA 4B08A 2K7VA 1SE2A 1BOSA 4KTAA 1YNNC 4BA2I 3A7LA 1Q1BA 5I4DA 1RODA 1EZ6A 2AWOA 1KDCA 4IALA 2NBFA 5D65A 5CR3A 2B2YA 1AZQA 1GUSA 2HDLA 4C2MB 1F2MA 3L9AX 4O42A 2EYHA 2BA0A 3MFGA 1HTPA 3J7AF 3DWQA 5ELFA 1JWSD 2VB3X 5IIFA 4X3TA 5A2QL 3S17B 5E4XA 3PUXA 4E6IA 2TMPA 2IX1A 4HEDA 1II3A 1CM9A 2LS01 3TSSA 4M8AA 1B44D 1EU4A 2KOLA 1SNPA 1BCPB 3QG1A 2J4XA 2WB1B 5IGFA 3I8ZA 4RHRA 2KUMA 3VA5A 2SEBD 1BDOA 4IUUA 4IUTA 3FMCA 2JA6B 3KK7A 3IL8A 5IT9L 3C3LA 3R2TA 1RCVD 2E74C 3HOYB 2VXWA 2IPKD 4P2CB 1JB3A 4B9WA 1A3VA 1WTOA 4X3KA 2K05A 1XTCD 2D5DA 2CW0C 1NAPA 2ZXOA 5T1IA 2L12A 4V0BA 3I73A 3H91A 2I07B 5JEAH 1I4GA 4JBWA 2MP1A 5C3EB 1KDAA 1AZPA 1ILQA 4IFDG 4G7HC 5J22A 3D4WA 1AFPA 4JK1C 2KVMA 2AUKA 1JWUD 3C2PA 3G7LA 1HUNA 1ENAA 1IW7C 2D62A 1XWEA 2MJ8A 3BVGA 1SNCA 3T13A 5CORA 1PXUA 3TP5A 3TP6A 1TVXA 1WTXA 1F9QA 5CV4A 4CHTB 2F3VA 3A56A 3G6JB 4HN7A 1FR3A 3NQIA 3I4MB 5I6WA 4KN4C 2A69C 2LY7A 4N9PA 2HCCA 1S5CD 3D8GA 1NSNS 1XYIA 1LT4D 2N88A 1HCZA 4IUNA 2EOTA 4L6TB 1GUGA 2K5QA 2RDGA 1QCBD 5M5XB 1F2YA 4ZUIA 3QB3A 1TWAB 4EVOA 2PZTA 1I4HA 3RD4A 3TN2A 2M2LA 2OF1A 5F2DA 2JEBI 1TQOA 1OXSC 5J1ZA 1LACA 2SOBA 3M7NA 1LTTD 4MN3A 5ELDA 5E3FA 3D4DA 2ICEC 3QWNA 4HSVA 3N6RA 1A3UA 4A3MB 1T5EA 2A5HA 4ZYSA 3I3CA 1PMRA 1ZEQX 3NPPA 4FF1A 4LJZC 3NTIA 2H1EA 3MFYA 1H9SA 2E75C 1GUWA 2RQXA 1EY6A 1GXDC 3H0GB 2B8GA 3BYYB 2L4NA 4ZUJA 2JA8B 4H13C 2YYZA 2K5DA 4U68A 4TSSA 5E1FA 1V1OA 2JSOA 1GUTA 4Q5VA 1A2TA 3QIAA 4CKBA 4K8JA 4CJ1B 2KQ3A 2XWJB 1GUNA 1UUPA 2NN6H 4K8IA 3FVQA 2RKSA 3GTQB 1Z7TA 4C1NI 3W3AA 3SEBA 3PO3B 5IGCA 5BN4A 2R93B 4RGTA 3HGBA 3H09A 5CV6A 1D1KA 2OT2A 5JEAJ 2B2WC 2PCFB 2WAQB 1K8MA 2CVRA 2WACA 1Y1WB 4DU9A 1B9MA 1B1ZA 3TBIB 2IX0A 5CBEE 1B2TA 3S2HB 4QUCA 3PIO3 5JEAG 3R2IA 4IUQA 4PMCA 2YU9B 1Q1EA 2O5JC 3WDNA 1LT6D 2GA4B 4IURA 4BY1B 5IOCA 4K5XA 1W6JA 3MWYW 3SR1A 1H9MA 3NHHA 2K33A 2IW3A 2Y0SB 1LT3D 1F77A 1STAA 1SYCA 4RCNA 2K32A 4YIJA 3DUZA 1V43A 1JC7A 4KKTA 2NN6I 2FFKB 3S2DB 1B3AA 2WIIB 1NUCA 2NVYB 3RZOB 4FXDA 1Q3LA 3GD7A 1HPCA 5C5LA 1DOMA 3NXWA 1D6EC 1I4XA 3UI2A 1PDQA 1LTBD 1ENCA 3S1MB 1SYFA 1HA6A 4H7BA 2KECA 2F0DA 3L7ZC 2F0UA 2PZWA 5JVH3 1DYQA 1SYDA 1DONA 5T1GA 1SMYC 4H44C 4IUVA 3JAML 1TWGB 1QWYA 3RZDB 3I4LA 1ZXTA 1HQMC 4CJ2C 3KLRA 4FO2A 1OXUA 1F9RA 1QE6A 1WTPA 5C0XH 2K01A 3LWUA 4ZKCB 3VR5A 2XVSA 1R4QB 5C4JB 5HURA 5M3MB 3C1FA 4BY7B 5LHY1 4WFN3 1KDBA 4XIGS 1H9KA 4KD3A 1MD2D 2R92B 1LABA 1TU2B 3MHBA 4ME5A 1D2BA 3HEJA 3MXNA 2E2IB 2EXZA 4WRDA 1M4VA 4L63B 3Q23A 4I7ZC 1PRTC 2B2WA 3VYUA 3FDTA 4C3JB 4IFDH 1PTOD 2XWBB 1SE3A 1HTLD 3OOCA 4QIWB 1SJHD 3FKIB 4PMBA 1QOHA 1HFNA 1K83B 1QILA 5BN3A 2MUYA 3CHBD 2N55A 1FD7D 4EQNA 3H94A 4ID6A 1A2UA 1SJED 4HMJA 2VB2X 3SHLA 1QG7A 3TZUA 5C0XI 2XIWA 3NK9A 2NN6G 4X3UA 3HKZB 5JPNC 1JORA 1U4PA 3HG9A 4QF4A 4X3SA 4NP5A 4XTCS 2DY8A 4PQXA 1B50A 1CI3M 3NE5B 3GTOB 5CV5A 1B4OA 5ELCA 2F0TA 5DAUA 4QB4A 1C8CA 5KNCA 1DZ1A 1MI2A 3PO2B 1KNAA 1PTOH 4XYOA 3J7AV 2QILA 4CKEA 1E0BA 3ITPA 1SYGA 3FEWX 2PO4A 5EBDA 4KMUC 3KLSA 3SK5A 1SXTA 2PMZB 1EY9A 2C9OA 2IJ0A 5EJWA 1SSOA 1Y8PB 2TSSA 3OMCA 2BDOA 1CHPD 3A7AB 4HMIA 2JA5B 3T53B 2OXPA 1HQRD 2JXMB 5COYA 2QCPX 2PYKA 5EKIA 2ENBA 2XRSD 4J6HA 2AQ3B 1F2LA 1E2VA 1JOQA 1K8OA 4BBRB 3K0YA 4A3KB 3GTLB 1ZYRD 3PMFA 1MBYA 3J80E 5DM63 1M8AA 3D4RA 2X69A 1EQTA 4FF3A 5FK9C 4Z9CB 4C3JG 1TS3A 2DNCA 1EU3A 1YNJD 4M1UB 4FVMA 4XT3B 1PTOB 5C0XJ 4OIKA 3BS1A 2KA7A 3TDQA 3VR6A 4UDUC 1CA5A 2PNRC 3P7JA 3G4OA 1ENFA 1RKNA 3IAYA 2AUJD 2EVBA 4S3SA 3J81E 1I3QB 5EPJA 5C0XG 1DCZA 1FNUA 1CK1A 2B2TC 2F0VA 4KJOA 4CKCA 2V4DA 2XN9C 4KI0A 2F0OA 1RF2D 3VYRA 3DEPA 4IFDJ 1TWHB 4QUFA 1STHA 3KBXA 5CYUA 3EJIA 2EYMA 2EYFA 4DAVA 2KHSA 3K59A 1WCMB 5A35A 1DOKA 1SEBD 3T16A 4G7OC 1SDFA 3M7GA 4RH6A 2LMCB 4Y7NB 3OIQA 2C5CA 3PIP3 1G2SA 2F4IA 4WJWA 1TIID 2A68D 1D5XC 1O7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT F;  2NTS A;  1QIL A;  1S5B D;  3EA6 A;  4TSS A;  3TSS A;  1SBB B;  1GOZ A;  3CHB D;  1B44 D;  3V05 A;  1EU4 A;  2R61 A;  1ET9 A;  1V1O A;  1LO5 D;  4DXF A;  1I4Q A;  1PTO F;  1FD7 D;  1BCP B;  3GP7 A;  2AQ2 B;  1PRE A;  2J4X A;  1D6E C;  1UNS A;  1KTK A;  1TS5 A;  5FK9 C;  1PTO C;  1XXG A;  4RHR A;  4Z9C B;  1SJE D;  1I4X A;  3BYT B;  1BCP F;  1L0Y B;  2SEB D;  1D5Z C;  1TS3 A;  1UUP A;  1EU3 A;  1TY0 A;  1LTB D;  1PTO B;  1TS2 A;  3OWE B;  1EEI D;  1S5C D;  1TY2 A;  1V1P B;  4OHJ A;  5ELE A;  1PZI D;  1S5F D;  1BXT A;  1ESF A;  4RFB A;  1LTS D;  1RDP D;  1LT4 D;  3SEB A;  1AW7 A;  1LTR D;  1KLG D;  1LLR D;  3O13 A;  1FNW A;  1DYQ A;  3URY A;  3W2D A;  4L6T B;  4RCO A;  1ET6 A;  4UDU C;  5D3I B;  4RGT A;  2RDG A;  3BVZ A;  1JCK B;  1RD9 D;  1EWC A;  3G4O A;  1FGB D;  1ENF A;  2XNA C;  3R2T A;  5ELB A;  1Z52 A;  1RCV D;  1S5E D;  5ELC A;  1I4H A;  4O1N A;  4RGM A;  2IPK D;  2XRQ D;  1CT1 D;  3BVM A;  1XTC D;  1FNU A;  1JWM D;  3DWP A;  1CK1 A;  4RGO S;  1LT5 D;  1LTI D;  1PRT D;  1PTO H;  3C0M A;  1B1Z A;  2NTT A;  1HA5 A;  1KLU D;  3KLS X;  2QIL A;  1CQV A;  4RHS A;  1DJR D;  1EEF D;  1SE2 A;  2O2L D;  1I4G A;  1HXY D;  2XN9 C;  1TS4 A;  1LTT D;  1S5D D;  2RDH A;  5I4D A;  3C0O A;  2CHB D;  1STE A;  1MD2 D;  3R2I A;  5ELD A;  1RF2 D;  1LT6 D;  5D3D A;  3R8B A;  3DWA A;  1JQY D;  4ZYS A;  1L0X B;  5TSS A;  1PZK D;  1JWU D;  2QEJ C;  1BCP D;  1I4P A;  4BWG B;  1SXT A;  2G9H D;  1D5M C;  1FNV A;  2Z8L A;  2WV6 D;  2IJ0 A;  1M4V A;  1LTG D;  2TSS A;  4L63 B;  3BZD B;  1LTA D;  1CHP D;  1AN8 A;  1V1P A;  3BVG A;  1PRT C;  1LT3 D;  1F77 A;  1G8Z D;  3MC0 B;  3MFG A;  1HQR D;  2AQ1 B;  3DWQ A;  4DXG A;  1PTO D;  1SEB D;  3EFX D;  1SE3 A;  1HTL D;  4K6L A;  4RH6 A;  1SJH D;  5ELF A;  4C56 C;  1PZJ D;  1PYW D;  5FKA C;  4RGN A;  1JWS D;  1T5X D;  1PRT B;  2ICI A;  3BYY B;  1EFI D;  1I4R A;  1SE4 A;  1D5X C;  2XRS D;  3G4N A;  3C0N A;  2AQ3 B;  1CHQ D;  1JR0 D;  1BCP C; 
#chains in the Genus database with same CATH topology
 3LWE A;  4DR5 L;  4K0K L;  1Y1V B;  5KGU A;  2R7Z H;  4DAY A;  1VDZ A;  1FVI A;  1D1I A;  1HZ9 A;  1ZKO A;  2Z6K A;  5KNB A;  1KNE A;  4KN7 C;  1VCI A;  2CH4 W;  1KTK A;  2UXC L;  3BDO A;  1EY0 A;  2ZJR A;  2DNE A;  4X66 Q;  2KED A;  1L0Y B;  3HOX H;  1J6Q A;  1EIG A;  2ID0 A;  5I9O A;  4ALP A;  3S15 B;  4JI6 L;  2R3Z A;  2PW7 A;  2F0W A;  4RFB A;  1LTS D;  4R1J A;  4RKB A;  4A3E B;  1X9N A;  4JI0 Q;  4L8J A;  1GJX A;  2ATW A;  2N8N A;  2I0Q A;  4ZLT F;  2F4V L;  2JK8 A;  5IGG A;  4BBR G;  3BVZ A;  3SK6 A;  5BN5 A;  1A6X A;  1RD9 D;  3CAM A;  1Q86 C;  3TS2 A;  3TZD A;  1HFG A;  2K1B A;  1GKH A;  4GS3 A;  3Q22 A;  3PCO B;  4JV5 Q;  1EWH A;  1IBM L;  1BF4 A;  2Z1C A;  3M4Y A;  4LFA L;  1HRJ A;  4NPS A;  3C1E A;  5CGK A;  4A3J H;  1VQH A;  1N34 L;  4GNX B;  4JW0 A;  3GV6 A;  2R6G A;  4RGO S;  4XT1 B;  4DV5 L;  2D9U A;  1GHJ A;  2FMM A;  2MPM A;  1S40 A;  2KBN A;  4BA1 I;  3K81 C;  3X3M A;  2EY6 A;  5EBC A;  3ND9 A;  1IBK L;  1E2Z A;  1VQ8 A;  4L5R C;  2JEA I;  1ICW A;  3L3O C;  1HZC A;  2EY1 A;  4B3T Q;  5D3D A;  3OPO A;  3HOW B;  4NDX A;  1L0X B;  3ZYY X;  4FYD A;  3PIO A;  1I4P A;  5C4X B;  2NZ1 D;  3D6W A;  3J7Z C;  4KKS A;  4V19 0;  2R7Z B;  4IUP A;  4ABN A;  5FLX E;  1E22 A;  3I90 A;  4IPC A;  4DR7 L;  1K8G A;  3PV0 A;  1AE2 A;  1JB7 A;  1V1P A;  4JI8 L;  1WTW A;  3VA7 A;  3MEH A;  1I6V C;  3PO3 H;  1ICF B;  3S1Q B;  1SRO A;  2F0I A;  3HOX B;  4JI7 Q;  4JYA Q;  4KY5 A;  2R93 H;  2B2T A;  4QL5 A;  2K5H A;  2BDN A;  2E2J H;  1X3Q A;  3C0N A;  1STN A;  1BCP C;  3E0E A;  1PRT F;  3I4N B;  4A3I B;  5FJ8 G;  3S16 B;  2F3I A;  1I4Q A;  1Y1W H;  3DXJ C;  4X64 L;  3LX0 A;  1KC8 C;  3NEL A;  3U9S A;  3CCU A;  2WKD A;  2BA1 A;  4A3J B;  1STG A;  2UXB Q;  4EQP A;  3CC4 A;  2LFN A;  2YU9 H;  3E6Z X;  3CP0 A;  2A6H C;  4NKL A;  2JA7 B;  4LF9 Q;  1U4M A;  2MGS A;  5IYB H;  3OW7 A;  4BY1 H;  1BBW A;  4N9T A;  1RDP D;  1KLG D;  2QKI C;  4R4C A;  5IP9 H;  3P20 A;  1IKL A;  3J81 j;  3AB9 A;  3KUP A;  4YCV A;  1Y1V G;  1JCK B;  4UP8 A;  5C3X A;  1S5E D;  2RCN A;  4XDX A;  5C3W A;  2B63 H;  3NTH A;  4DGZ A;  1NR4 A;  3DM1 A;  3VR2 A;  4POG A;  5G3L D;  2AMC B;  2FMC A;  4KHP L;  1GVP A;  1LM0 A;  3A55 A;  4B3M L;  3S2D H;  1EY7 A;  4KHV A;  1R4P B;  2BE5 D;  2NVY H;  3RZO H;  3K57 A;  5HGQ A;  1GHK A;  4G7Z C;  1S5D D;  2F0J A;  3DEO A;  4A3E G;  3V96 A;  1X3P A;  3JAM i;  1STE A;  4OX9 L;  1L0W A;  2E2J B;  4AH6 A;  4MTK A;  4CBV A;  3BDC A;  2X6L A;  1X3G A;  4NXM L;  1HUM A;  2QW7 A;  2F0N A;  2X6G A;  1ESR A;  5M5W B;  1E2W A;  4Q0F A;  4CDC C;  3KJO A;  3AU7 A;  1G8Z D;  2EYO A;  5DEH A;  3PUW A;  1S72 A;  3SK8 A;  2OEO A;  1KQS A;  4OIJ A;  2M9V A;  4DUZ L;  4JI4 L;  5JPM C;  2PQA B;  2RVL A;  3FRP B;  3HFZ B;  5CMD A;  3RZD H;  1I6H H;  5CBA E;  1O7Z A;  4TVA B;  1S3O A;  5KRU A;  3HOW G;  2VNU D;  4DR4 L;  1K0S A;  4HR7 B;  3A0J A;  1QVG A;  5C4X G;  5GRO A;  1EZ8 A;  5M3M H;  1W2B A;  4C3H B;  4PV1 C;  2R7Z G;  4FNF A;  1OO9 B;  4LUZ A;  4R9W A;  4BY7 H;  5HY6 A;  1UNS A;  3E9I A;  2B63 B;  1TS5 A;  1Q12 A;  3MXP A;  1G6Z A;  3STB D;  3G4S A;  2IL8 A;  1L1O B;  5KEE A;  3J80 L;  3RN2 A;  2L11 A;  2HQE A;  2R92 H;  1CQF A;  2K50 A;  1YNJ C;  3T1Y L;  1VQL A;  3HOX G;  1EL0 A;  1TS2 A;  1QB5 D;  1SNQ A;  4DR3 Q;  3GTM H;  2ASB A;  4YY3 Q;  1TR5 A;  2E2I H;  4PZ6 A;  3NBH A;  5ISR A;  3BDL A;  4HAE A;  1PFN A;  3MTS A;  4J8Q A;  1MSG A;  5HGT A;  5GAG C;  3Q0A A;  3G6E A;  2I46 A;  1MGS A;  4KV6 A;  3VYS A;  4HCS A;  1IW7 D;  1PH4 A;  1IYV A;  1A8V A;  2JP1 A;  3UE0 A;  4K14 A;  2NUC A;  4A3J G;  2Q2I A;  3PUY A;  1LTI D;  2OTL A;  2EJM A;  3FKI H;  1EYG A;  3J81 L;  4F7X A;  2JA7 G;  1K83 H;  2A74 C;  2EE1 A;  3NBI A;  1V8Q A;  2B8F A;  4ZRZ A;  1EQQ A;  1TS4 A;  4J1M A;  2EDG A;  5JJK A;  4DK6 C;  5LMN Q;  1BUV T;  1RHP A;  3P1H A;  2E5L L;  4F87 A;  1JOO A;  1I6H B;  4R4O A;  3K0X A;  3R8B A;  3PSI A;  2N78 A;  5EPL A;  4I65 A;  1MSH A;  3TME A;  2WV6 D;  1R9T H;  2GVB A;  3KF8 A;  3ERQ A;  2NVQ B;  5M5Y H;  1BKB A;  1YIT A;  4B3R L;  2A69 D;  2PI2 A;  5GAD C;  3I91 A;  3QOL A;  1VQJ A;  1XPU A;  4HCE A;  5C6A A;  4DUY Q;  1HJP A;  4OON A;  2PI2 E;  3TP8 A;  3HOU H;  4GKJ L;  2F0H A;  4JPB W;  1EFW A;  1IZ6 A;  1KRS A;  2D2C C;  1T9H A;  3FPP A;  3GTO H;  1C48 A;  2R93 G;  3G4N A;  1Q8K A;  3GTM B;  4L5Q A;  5C5M A;  4ZKB B;  1X3E A;  4BXX H;  2F03 A;  3VR4 A;  4DK3 C;  1SBB B;  3CCE A;  1QZG A;  4JBK A;  4DXF A;  2VUM B;  4HJA A;  4LF6 L;  1G29 1;  2L55 A;  3Q6S A;  5FOB B;  3PO2 H;  1O80 A;  1PRE A;  3S9W A;  1Y1W G;  4GOP C;  4ZQ3 A;  1HNX L;  3X3N A;  3UDG A;  1STB A;  2Z4I A;  4JOI C;  1B9N A;  1KL9 A;  3K58 A;  1QNU A;  1V1P B;  3HOV B;  1ESF A;  1JE4 A;  4R8N A;  2KCC A;  3L2P A;  2SNS A;  4AQY L;  3O13 A;  5EQ0 A;  3TP7 A;  1K9M C;  4JI2 L;  3GQB A;  3W2D A;  4RCO A;  2DJF C;  1P8L A;  3K8A A;  1SNM A;  5IP9 G;  4B3M Q;  2UUA Q;  1EWC A;  4DAP A;  2JA5 H;  4FXK C;  3P75 A;  2L1B A;  1R9T B;  2B63 G;  5M5Y B;  2L0C A;  1H9S B;  3OIP A;  3R3O A;  4YWK A;  4PZ7 A;  2RCF A;  4A3K H;  1DJR D;  1VS0 A;  3HOU B;  3OWF A;  5EAY A;  3GTL H;  1ILP A;  4X66 L;  3S1N B;  1NY4 A;  2HDM A;  2CHB D;  3ONA B;  3T4A C;  3E5S A;  4OGQ C;  2R7D A;  2RHQ B;  1SND A;  3MXU A;  3K5N A;  3NSW A;  3H3V C;  4KY6 A;  5KND A;  3MXG A;  4RA8 A;  4JI0 L;  5GAE C;  3S14 H;  3HKS A;  1IHZ A;  1QNK A;  1N32 Q;  4LF7 Q;  3CC2 A;  1ONL A;  2EYP A;  1AN8 A;  3HP3 A;  3NWS A;  2Q8I B;  5FO7 B;  3OMG A;  2AQ1 B;  4DXG A;  4C3I H;  4AIM A;  3I2Z A;  4JV5 L;  4DK1 A;  3AFQ A;  4K2K A;  1E3P A;  4BBS B;  4KY7 A;  1F9S A;  5AFW A;  2H5X A;  4UAI A;  3FHW A;  2F0M A;  3KFU A;  1JR0 D;  4IPH A;  1I3Q H;  4DK0 A;  1OXT A;  1D7Q A;  4B9X A;  1GOZ A;  1DXM A;  1WOC A;  4ZK9 B;  5JOB A;  1KAB A;  1PTO F;  1W6K A;  1VQK A;  4GLX A;  4EX5 A;  1IXR A;  1SFO B;  2HQL A;  1PLF A;  4DNR B;  4B3T L;  1JIC A;  3NQT A;  4LK1 C;  3DMU A;  1KIX A;  2J0T D;  5IGE A;  1PYS B;  2K5V A;  3BYT B;  4PMW A;  1BCP F;  1CZG A;  2K03 A;  1CKM A;  4X65 Q;  1WVL A;  5FJ8 H;  1TWH H;  1SYB A;  2R92 G;  1N33 Q;  3HRZ C;  3D3R A;  3MZ5 A;  2Q2U A;  3TEH B;  2E2D C;  2NZO A;  1VQ4 A;  1PFB A;  4PZ8 A;  2F0F A;  4JYA L;  1VF5 C;  3BJU A;  4JI7 L;  1VQ6 A;  2Z6B A;  4UPA A;  3D31 A;  2VUM G;  1WCM H;  2B2U C;  2BCO A;  2EQS A;  4Y7N H;  3S14 B;  2IX3 A;  4IN3 A;  1G2T A;  3UDI A;  2RDF A;  1Y8N B;  2KCN A;  3N52 A;  3HOZ H;  4B3S Q;  1IYU A;  2XSC A;  1BQQ T;  3PUZ A;  1MHW C;  2FJ2 A;  2PW5 A;  1VQM A;  1HA5 A;  2ZJQ A;  4C3I B;  5JVG 3;  2BE5 C;  4AYB E;  2O2L D;  4F8M A;  4NW2 A;  3W1G A;  3Q24 A;  3HOV G;  4JOI A;  2RDH A;  2UXB L;  2UU9 Q;  3H6M A;  3NP8 A;  4RKL A;  3U50 C;  4LF9 L;  2RSO A;  4IJH A;  3ERO A;  1PZK D;  4DR1 Q;  1EY4 A;  2E76 C;  2M00 A;  1D5M C;  1YBY A;  2XTI A;  3I70 A;  2IT1 A;  4DV7 Q;  4X62 Q;  2MQH A;  5D14 A;  3M85 A;  3NBH B;  3GTP H;  2EIF A;  3S15 H;  1TKW B;  2HD3 A;  3MC0 B;  4A3E H;  4GZY C;  1YI2 A;  5EKK A;  4O0A A;  4XQJ A;  1EY8 A;  2K5W A;  4L5S A;  4MIU A;  4RWS C;  2E2H H;  3HOU G;  4ZAI A;  5H1S E;  1TT2 A;  1I94 Q;  4KHZ A;  1VQP A;  4LF8 Q;  3GV3 A;  4ZCK A;  3JAM E;  3A8I E;  2F0E A;  4DPG A;  1S5B D;  1FL0 A;  3EIV A;  3NWT A;  2R61 A;  1YZ6 A;  4BXX G;  1LO5 D;  1SMY D;  2AQ2 B;  1CUK A;  5GAH C;  2HHH Q;  3A8K E;  1E7Z A;  4DN4 M;  5JJZ A;  1YJ9 A;  1RIP A;  2Y0S E;  2OQ0 A;  1SAP A;  1D5Z C;  1TWC B;  3HOZ B;  3KF8 B;  1NBW A;  1WD1 A;  2RA4 A;  4WOR A;  2Q8R E;  3HZX A;  1TY2 A;  4LF4 Q;  1BXT A;  3E0J A;  4A3D H;  1U4R A;  1AW7 A;  5C4X H;  3CMA A;  1U0L A;  1Z47 A;  2NWG A;  4APV A;  2EYL A;  2H4O A;  3RN5 A;  2QA4 A;  3CU7 A;  1C4Q A;  3CQZ H;  1AH9 A;  1LV9 A;  2F0G A;  5DNF A;  2RF4 A;  2JA5 G;  3S1Q H;  3MXN B;  3GTP B;  4A3B H;  4HIM A;  4HSP A;  2K28 A;  3F2D A;  1GUO A;  1SE8 A;  2HIX A;  5EPK A;  1PRT D;  4HIO A;  3KDF B;  2I5H A;  3AFP A;  1CZW A;  2EJF C;  4WJ4 A;  1IKM A;  1I50 B;  2MFI A;  3I4N H;  2O5I C;  1CKN B;  4A3I H;  2IWH A;  2K5N A;  4IPD A;  1XNQ Q;  5C4Z A;  1XMO Q;  3S16 H;  4JI5 Q;  1PV4 A;  3NEM A;  3C0O A;  4A3K G;  2E2H B;  2NB0 A;  1EQV A;  3AMU A;  1RJT A;  1Q90 A;  5NUC A;  3I7F A;  3DWA A;  4HIK A;  2ES2 A;  5BR8 Q;  2QEJ C;  3HS0 C;  4DR3 L;  4YWM A;  1QVC A;  1J5E Q;  4YY3 L;  1FNV A;  3GTG B;  1VQB A;  1LTG D;  2ZXP A;  1C7Y A;  2A6E D;  4ILW A;  2JA7 H;  3BZD B;  1XTD A;  2B2U A;  2RSN A;  2Q8T A;  2Z4H A;  2G9D A;  3U4Z A;  2EPB A;  2IY5 B;  3KBG A;  3S1R B;  1PFS A;  1PYW D;  5K36 H;  4C3I G;  3J7Y W;  4FXG C;  2HUG A;  5AJ3 Q;  1SE4 A;  2J7Z A;  4A3D B;  2QDB A;  3F2U A;  1PFM A;  4DKA C;  3RLF A;  1Q46 A;  4LF5 Q;  1K3B C;  1YJN A;  4FP5 D;  5LMN L;  4KKU A;  2B2V C;  3CQZ B;  2K6A A;  1TWF B;  2JA9 A;  2VY3 A;  1PTO C;  2ZXR A;  1XXG A;  1NCV A;  4UP9 A;  1UWV A;  4A3B B;  3D6C A;  4JCV E;  1LTL A;  1B53 A;  3PUV A;  2K52 A;  1TXY A;  2WKC A;  1X65 A;  1E1O A;  1JJC B;  2F1M A;  4IZ8 A;  5IOD A;  1LTR D;  1LLR D;  5IGD A;  4YHH Q;  1FNW A;  4DUY L;  3URY A;  3T56 B;  4DV4 Q;  5M5W H;  2VW9 A;  1SNO A;  5CV7 A;  5CV9 A;  4IQZ A;  2IHF A;  1SMX A;  1BBX C;  1XMQ Q;  4TQU S;  3VR3 A;  1B3Q A;  1SRU A;  4O1N A;  1WCM G;  3J80 i;  2F52 A;  1FJG Q;  1H95 A;  1U5K A;  3IFD A;  1M1K C;  1STY A;  1P16 A;  4JBJ A;  4P72 A;  3HOZ G;  2KJX A;  3KLS X;  2ZTC A;  3CKI B;  4DV3 Q;  1CQV A;  2OCE A;  4O2D A;  4RHS A;  4K5V A;  1YNN D;  4MTN A;  1HXY D;  2VQF Q;  3HKZ E;  1WFQ A;  4Y52 H;  2OQK A;  4C3H H;  4YCW A;  3EVQ A;  4JI3 Q;  2KHJ A;  3RR5 A;  5KYL A;  4DV2 Q;  3WOE A;  4A3G B;  1IBL Q;  2KEE A;  1XJV A;  3J80 c;  5TSS A;  5JJL A;  2ZT9 C;  3IFT A;  4BWG B;  1WTR A;  2O4X A;  1CFM A;  3SE0 A;  1EIH A;  2IHE A;  4ODG A;  3BZC A;  2UUA L;  5IGB A;  1A3T A;  5A2Q E;  2UUB Q;  4K6D A;  1EYC A;  4C56 C;  3M4O B;  3KF6 B;  3CRK C;  3QO2 A;  1PRT B;  5JAV A;  3ND8 A;  4J15 A;  1I4R A;  1ASZ A;  4A3F B;  1NR2 A;  3GDE A;  1GO3 E;  2HCI A;  4AYB B;  1CHQ D;  1Y8O B;  1WTH A;  2NTS A;  3EA6 A;  3MA2 B;  5C4H A;  1EOT A;  1KAA A;  3V05 A;  4X6A H;  3J81 c;  1F2Z A;  2MHV A;  2EY2 A;  2WIN B;  2F0P A;  1WD0 A;  1AP0 A;  4XQQ A;  3K80 C;  1QZH A;  1H9J A;  5IT9 E;  4OO1 H;  5FO8 B;  4OXP A;  1AEX A;  2VL6 A;  5LL6 S;  4C1N K;  1U4L A;  4P74 A;  1N32 L;  4LF7 L;  1RTO A;  3E3X A;  1Z52 A;  1G51 A;  1N36 Q;  1UE5 A;  4HTH A;  5C44 B;  3GO5 A;  1Q8I A;  1PH9 A;  1HZA A;  1X32 A;  1D8L A;  1AE3 A;  4A3D G;  1ZYR C;  2NVQ H;  4GN3 B;  1QJO A;  1ET6 A;  5D3I B;  4TKO B;  3FPU B;  3T51 B;  3ULP A;  2UUC Q;  1FGB D;  3A54 A;  4K5W A;  4GNX C;  1S4Z A;  4G4K A;  2NZH A;  4NB3 A;  2F0L A;  2KCM A;  1EY5 A;  3QOJ A;  1VF7 A;  5CC4 A;  1X56 A;  5DM7 3;  2A73 B;  1CSP A;  4DA2 A;  2B2V A;  2D0P A;  4LUV A;  4QY7 A;  2CW0 D;  3WOF A;  4A3B G;  1FYC A;  3C0M A;  1KLU D;  4IOA A;  4QCL A;  1EEF D;  1V1Q A;  4H0L C;  1Y69 U;  2QF7 A;  2VUM H;  1SR3 A;  4KD4 A;  4A3I G;  1BNZ A;  3I4N G;  3A8J E;  2EY5 A;  4X65 L;  3VYT A;  1JQY D;  1N33 L;  2F0Q A;  2BH8 A;  5G3L F;  2F3W A;  1M90 C;  2WB1 E;  2A8V A;  1VQD A;  1OXX K;  5JJI A;  4FDB A;  1DD2 A;  4DAY B;  3SDZ A;  2R7F A;  4LMQ D;  1LTA D;  1DM0 B;  1O7Y A;  2JE6 I;  3K5M A;  1BR9 A;  3HOV H;  1UEB A;  3IKJ A;  5M3F H;  4HJ9 A;  1VMP A;  3U4V A;  3EFX D;  4XQN A;  4OO1 I;  1PZJ D;  2CQA A;  1PA6 A;  2EJG C;  2ICI A;  2JN4 A;  2DGY A;  3NTK A;  1K3R A;  4JVZ A;  2SDF A;  4MHE A;  5K36 G;  4B3S L;  4NMZ A;  3GTJ H;  4PNY A;  5I2X A;  1PH6 A;  3I72 A;  2L5T A;  1A0I A;  4LAA A;  5I6Y A;  4CGY B;  4A3G G;  2FHT A;  4XYQ A;  4EQO A;  2LKV A;  4LFC Q;  1F9P A;  1ML0 D;  2UU9 L;  4JG2 A;  5CV8 A;  1HNW Q;  1J8I A;  1A15 A;  1G91 A;  1WTQ A;  1XX8 A;  3S1N H;  1J9O A;  2EYJ A;  4DR1 L;  3NUC A;  3K5L A;  2EZV A;  1QUQ A;  2DN8 A;  4DV7 L;  4X62 L;  3PF5 A;  4U67 3;  2A68 C;  3OWE B;  1EEI D;  5ELE A;  1PZI D;  4A93 B;  2L9H A;  4DF7 A;  1CTM A;  3OHX C;  4KJN A;  4OEM B;  2LSS A;  2UXD Q;  3ZJY C;  2F0S A;  1XNR Q;  2B2Y C;  2RHS B;  3QJY A;  4QGU A;  5FLX c;  3GTK B;  5ELB A;  5I2Y A;  3RMH A;  1I94 L;  5IWA Q;  4LF8 L;  4JC0 A;  1IL8 A;  1N9W A;  4FF4 A;  1VQC A;  3RUZ A;  4OWX B;  3SXH A;  1PYB A;  4TRD A;  4EGV A;  4BBS H;  3F8T A;  2DY7 A;  3BVM A;  3SK4 A;  3M4Q A;  2K04 A;  1JWM D;  3DWP A;  4GN4 B;  3ERS X;  3CRL C;  3DHQ A;  3LNN A;  3MEF A;  5M3F B;  3MAQ A;  1DGS A;  1KRT A;  2HHH L;  5EGT A;  4DNT B;  5LL6 X;  1K28 A;  5C44 G;  3OSO A;  3T1H Q;  1SFO H;  5IYD H;  3K6O A;  2PPB C;  1JT8 A;  3GTJ B;  2DUD A;  4RAU C;  4C3H G;  3TS0 A;  2PQE A;  4LF4 L;  4XXE A;  1O78 A;  1BCP D;  4K2L A;  5LMU Q;  2G9H D;  1U9R A;  1C0A A;  3W1B A;  1H9R A;  4OWT B;  4GN5 A;  2Z8L A;  5DLQ E;  3B6Y A;  2PZU A;  4DR2 Q;  4GNX A;  5IP7 H;  1RTN A;  1EYA A;  2A6E C;  2BOS A;  5KIX A;  1EYD A;  4IOC A;  2AWN A;  1WTV A;  5J39 A;  4K6L A;  2NVX B;  5EKL A;  5FKA C;  3U9O A;  4RGN A;  4QMG A;  1OXV A;  1T5X D;  3QR8 A;  1EFI D;  4GLV B;  2A6H D;  1VQ9 A;  1PVO A;  2NVT B;  4KK7 A;  1MIU A;  1VQI A;  3BG3 A;  4DFA A;  2GVA A;  5K5P A;  1XNQ L;  1XMO L;  1ET9 A;  1VMC A;  4JI5 L;  3EBE A;  4C2M H;  1JOK A;  1L1O C;  2KHI A;  3GP7 A;  2SNM A;  1BBU A;  2I5M X;  2JYO A;  5KYI A;  1CA6 A;  1L2F A;  1SYE A;  3MVV A;  1DOL A;  5FLX L;  3KYH C;  1VQN A;  5BR8 L;  1KAW A;  1HH2 P;  3V2T A;  2CQO A;  1J5E L;  3R93 A;  4QQB X;  2RBM A;  4OO1 G;  2B29 A;  3RLN A;  3K7A B;  1TY0 A;  3K5O A;  3SVM A;  4OHJ A;  4BS9 A;  1S5F D;  4HJ7 A;  5M9O A;  2FIN B;  3C46 A;  1BO0 A;  3F2C A;  5E4W C;  4IFD I;  5I9P A;  5AJ3 L;  1Z6H A;  2XNA C;  4CJ0 B;  2WP8 J;  4OL7 A;  4IO9 A;  3M3Y B;  2Z6K C;  4FF2 A;  4RGM A;  4G57 A;  2XRQ D;  4NXN Q;  1UEA B;  1HHV A;  1Q81 C;  2XGT A;  4ULL A;  1CT1 D;  3EQL C;  4F88 A;  4LF5 L;  1UAP A;  2NYZ D;  5IT9 c;  1LT5 D;  5FO9 B;  4R8I A;  2F0K A;  2B39 A;  2NTT A;  2JQO A;  3TRE A;  4B08 A;  2K7V A;  3CC7 A;  2CCZ A;  1SE2 A;  3DM3 A;  1BOS A;  4KTA A;  2JJQ A;  1YNN C;  4BA2 I;  3A7L A;  1Q1B A;  5I4D A;  1ROD A;  1EZ6 A;  2AWO A;  3ICE A;  1KDC A;  4GKK Q;  1E1T A;  4IAL A;  2NBF A;  5D65 A;  5CR3 A;  4YHH L;  1TWC H;  1G6P A;  2B2Y A;  1AZQ A;  3CW2 C;  1GUS A;  2HDL A;  4C2M B;  1NE3 A;  4DV4 L;  1F2M A;  4GOP A;  3L9A X;  4O42 A;  2EYH A;  1YEZ A;  2BA0 A;  3MFG A;  1HTP A;  3J7A F;  3DWQ A;  1XMQ L;  5IE8 A;  5ELF A;  5M3F G;  5FLM G;  1X54 A;  1JWS D;  2VZA A;  3RNU A;  1FJG L;  2VB3 X;  5IIF A;  3PGZ A;  4X3T A;  5A2Q L;  3S17 B;  4R4T A;  2Z0S A;  5E4X A;  3SGI A;  4A4I A;  1NTG A;  3PUX A;  4E6I A;  2TMP A;  2IX1 A;  4HED A;  1II3 A;  4DV3 L;  1CM9 A;  2Z9H A;  2LS0 1;  3TSS A;  4M8A A;  1B44 D;  1GM5 A;  1EU4 A;  2WAQ E;  2VQF L;  2KOL A;  1SNP A;  1BCP B;  3QG1 A;  3WWV A;  2J4X A;  4JI3 L;  2WB1 B;  3TRZ A;  1I50 H;  5IGF A;  3I8Z A;  4DV2 L;  1IBL L;  4RHR A;  3UDF A;  2KUM A;  3VA5 A;  2SEB D;  1BDO A;  4IUU A;  4IUT A;  2PQA A;  3FMC A;  2JA6 B;  2L15 A;  4HJ8 A;  3KK7 A;  3IL8 A;  2KEN A;  5IT9 L;  4LWC A;  4R4Q A;  4LUO A;  2UUB L;  3GTG H;  2ZTE A;  3C3L A;  2I5L X;  2YTX A;  3I4M H;  3R2T A;  1RCV D;  2E74 C;  3HOY B;  5L37 A;  3U58 A;  3STB C;  2VXW A;  3A74 A;  2IPK D;  4P2C B;  3S1R H;  1BVS A;  4DV1 Q;  1JB3 A;  4B9W A;  1A3V A;  1PH2 A;  2ZM6 Q;  4X3K A;  2K05 A;  1XTC D;  3BZK A;  3S24 A;  1WTO A;  2D5D A;  4BBS G;  2CW0 C;  3CPW A;  1NAP A;  2ZXO A;  5T1I A;  2L12 A;  3M9B A;  4V0B A;  3I73 A;  3H91 A;  2I07 B;  5JEA H;  1I4G A;  3CPF A;  4GLA C;  3VDY A;  4JBW A;  2MP1 A;  1EOV A;  5C3E B;  3A5U A;  1KDA A;  1AZP A;  1ILQ A;  4N8X 1;  4IFD G;  4G7H C;  1PH3 A;  5J22 A;  5M5X H;  3D4W A;  4LFB Q;  1AFP A;  4JK1 C;  2KVM A;  1TWF H;  2AUK A;  1TWA H;  5IYD G;  4P71 A;  1JWU D;  2YTY A;  4L5T A;  3G7L A;  1N36 L;  3C2P A;  1HUN A;  1ENA A;  1RL2 A;  1IW7 C;  2D62 A;  1MKH A;  1XWE A;  2QGQ A;  4A75 A;  1PH1 A;  2MO1 A;  2MJ8 A;  3BVG A;  1SNC A;  3T13 A;  1JMC A;  2UUC L;  4P75 A;  5IP7 G;  1YVC A;  5COR A;  1PXU A;  3D0F A;  3TP5 A;  1VQ7 A;  2FXQ A;  4OWW B;  3TP6 A;  1TVX A;  3NEN A;  1WTX A;  1F9Q A;  1NJI C;  5CV4 A;  4CHT B;  4A3M H;  2F3V A;  3A56 A;  3OTO Q;  3G6J B;  1HR0 Q;  2ALY B;  4HN7 A;  1FR3 A;  4IJL A;  3I56 A;  5E7N A;  3NQI A;  2Q2H A;  3I4M B;  5I6W A;  4KN4 C;  1HNZ Q;  1VQF A;  2A69 C;  1YNX A;  2LY7 A;  4N9P A;  3KOJ A;  3H0G H;  1B7Y B;  2E8G A;  2HCC A;  2JA8 H;  1S5C D;  3D8G A;  4A3G H;  1NSN S;  1XYI A;  3K7U C;  4HID A;  1LT4 D;  2N88 A;  1HCZ A;  4IUN A;  2CFM A;  5GQO A;  2EOT A;  2N3S A;  2VQE Q;  4L6T B;  1GUG A;  2K5Q A;  1YHQ A;  2LXJ A;  2RDG A;  1YJW A;  1QCB D;  5M5X B;  1F2Y A;  3I4O A;  4ZUI A;  4DAM A;  3QB3 A;  1TWA B;  4EVO A;  2PZT A;  1I4H A;  3RD4 A;  3TN2 A;  3M4O H;  2WB1 G;  2M2L A;  2OF1 A;  1YHB A;  5ELO A;  1HR0 W;  5F2D A;  3AEV A;  4QIW E;  4LFC L;  1FGU A;  4A3F H;  2AKW B;  2JEB I;  1TQO A;  1WYD A;  1OXS C;  2CKZ B;  5J1Z A;  3GTQ H;  1HNW L;  3KJP A;  1LAC A;  2AHO B;  4DV0 Q;  2MNA A;  2SOB A;  2JA6 G;  3OW2 A;  3M7N A;  1LTT D;  1NNX A;  4MN3 A;  4N8F A;  5ELD A;  3QWN A;  3D4D A;  2ICE C;  4HSV A;  5E3F A;  3N6R A;  3J7A 5;  1A3U A;  3RLO A;  4A3M B;  2PNH A;  1T5E A;  2A5H A;  4ZYS A;  3I3C A;  1PMR A;  4MZ9 A;  1ZEQ X;  3NPP A;  4FF1 A;  3HOY G;  4A76 A;  1V9P A;  3UE1 A;  4LJZ C;  3NTI A;  2UXD L;  1GD7 A;  1XNR L;  4I7A A;  2H1E A;  1PH8 A;  3MFY A;  3UDX A;  1H9S A;  2E75 C;  5C44 H;  1GUW A;  5IWA L;  2RQX A;  4DR6 Q;  1EY6 A;  1GXD C;  3S2H H;  3H0G B;  1O7I A;  1JJG A;  2B8G A;  3BYY B;  2L4N A;  1K8A C;  4ZUJ A;  2JA8 B;  4H13 C;  2YYZ A;  5C3E G;  5IYC H;  2K5D A;  4U68 A;  4LNQ A;  1VQ5 A;  4TSS A;  5E1F A;  1V1O A;  1EIY B;  4A3L H;  2JSO A;  1GUT A;  3J81 i;  4Q5V A;  1JE5 A;  3T1H L;  1A2T A;  4IPG A;  3QIA A;  4CKB A;  4K8J A;  4CJ1 B;  3H3V H;  2HT1 A;  1KXL A;  2KQ3 A;  5LMU L;  2XWJ B;  1GUN A;  1UUP A;  2NN6 H;  4PG3 A;  4K8I A;  2P5Z X;  3FVQ A;  4DR2 L;  1LYL A;  2RKS A;  3GTQ B;  2G5D A;  4DV6 Q;  4GOP B;  1Z7T A;  4C1N I;  3W3A A;  3SEB A;  3PO3 B;  3E9H A;  3CCL A;  5IGC A;  5BN4 A;  2PMZ E;  4RGT A;  2R93 B;  1K73 C;  3HGB A;  4ME3 A;  3H09 A;  5CV6 A;  1D1K A;  2OT2 A;  4DNI A;  5JEA J;  4RMF A;  3I4M G;  2B2W C;  2PCF B;  2WAQ B;  1K8M A;  4JI1 Q;  2CVR A;  2WAC A;  1Y1W B;  4DU9 A;  1B9M A;  1B1Z A;  1Q82 C;  3S1M H;  3TBI B;  2IX0 A;  5CBE E;  4DR5 Q;  3JC6 6;  4K0K Q;  1B2T A;  3S2H B;  4QUC A;  2HIV A;  3CCV A;  3JAM c;  3PIO 3;  5JEA G;  3R2I A;  4IUQ A;  4PMC A;  2YU9 B;  1Q1E A;  4UHV A;  3WDN A;  2O5J C;  4CDD C;  1LT6 D;  2UXC Q;  1TWG H;  2GA4 B;  4IUR A;  4BY1 B;  5IOC A;  4K5X A;  1W6J A;  3MWY W;  3SR1 A;  1H9M A;  3NHH A;  4JBM A;  2K33 A;  1YIJ A;  3W5O A;  5C4J H;  4JI6 Q;  2OTJ A;  3G48 A;  2IW3 A;  2Y0S B;  4A93 H;  1LT3 D;  1F77 A;  1STA A;  3H3V I;  3F2B A;  1SYC A;  2OWO A;  3AYH B;  2F4V Q;  2CWA A;  4RCN A;  2K32 A;  4NXN L;  4YIJ A;  3DUZ A;  1V43 A;  1JC7 A;  4KKT A;  2NN6 I;  1JJ2 A;  3GTK H;  4LW1 A;  2FFK B;  3S2D B;  1LUZ A;  1IBM Q;  1B3A A;  2WII B;  4LFA Q;  1NUC A;  2NVY B;  4A3M G;  3RZO B;  1EWI A;  1N34 Q;  4FXD A;  1Q3L A;  3GD7 A;  4DV5 Q;  3ULL A;  1HPC A;  3CME A;  5C5L A;  1DOM A;  1YHA A;  3NXW A;  5FLM H;  1D6E C;  1X55 A;  4C3J H;  4GKK L;  1IBK Q;  1I4X A;  1K0R A;  3UI2 A;  1MJE A;  3DLL A;  4OEL B;  1UE6 A;  3H0G G;  1PDQ A;  1SLJ A;  1LTB D;  1Z9F A;  4YCU A;  1ENC A;  3S1M B;  2N49 A;  1SYF A;  1HA6 A;  4H7B A;  2KEC A;  2JA8 G;  2F0D A;  3L7Z C;  2F0U A;  2PZW A;  3CCJ A;  5JVH 3;  1DYQ A;  1SYD A;  4DR7 Q;  1DON A;  5T1G A;  1SMY C;  4H44 C;  4IUV A;  4JI8 Q;  3JAM L;  1TWG B;  3FP9 A;  1QWY A;  2B3G A;  3RZD B;  3I4L A;  1ZXT A;  1HQM C;  4CJ2 C;  3KLR A;  4FO2 A;  1OXU A;  1F9R A;  1QE6 A;  1WTP A;  2VS1 A;  5C0X H;  2NVX H;  2K01 A;  3LWU A;  4ZKC B;  3BU2 A;  3VR5 A;  2XVS A;  4CDE C;  1R4Q B;  3EN2 A;  5C4J B;  1XPO A;  5HUR A;  5M3M B;  3F1Z A;  3C1F A;  2NVT H;  4KLK A;  3OYY A;  4BY7 B;  2A1A A;  4A3F G;  5LHY 1;  4WFN 3;  1KDB A;  4AYB G;  1VQA A;  4XIG S;  1H9K A;  2V1C C;  2WFW A;  3PO3 G;  4KD3 A;  1MD2 D;  3IRB A;  2R92 B;  1LAB A;  4X64 Q;  1TU2 B;  1CSQ A;  3MHB A;  2EXD A;  4ME5 A;  1IL2 A;  3CCR A;  2LXK A;  1D2B A;  4UY8 C;  3HEJ A;  3MXN A;  2E2I B;  2EXZ A;  3I55 A;  4WRD A;  1M4V A;  3K7A H;  4L63 B;  2WAQ G;  3Q23 A;  4I7Z C;  1PRT C;  2B2W A;  3KDF A;  3VYU A;  5LMN W;  3FDT A;  4EQ5 A;  4C3J B;  4A3C H;  4IFD H;  1CKN A;  1PTO D;  2XWB B;  1MJC A;  1SE3 A;  1HTL D;  3OOC A;  4R4I A;  1SJH D;  4QIW B;  2K75 A;  4DV1 L;  3CCQ A;  3TQY A;  4RG1 A;  2ZM6 L;  2KCT A;  3FKI B;  4PMB A;  3M3Y H;  1QOH A;  1KD1 C;  1HFN A;  1K83 B;  1EIF A;  1QIL A;  5BN3 A;  2MUY A;  5IYC G;  5IYB G;  3CHB D;  4BY1 G;  2N55 A;  1FD7 D;  4EQN A;  3KLW A;  4KHP Q;  4A3L G;  1CKO A;  1W3S A;  5J3B A;  3PQI A;  3H94 A;  4ID6 A;  4LFB L;  1X6O A;  1A2U A;  1SJE D;  4HMJ A;  2VB2 X;  2Y0S G;  1QG7 A;  3SHL A;  3TZU A;  5C0X I;  4OX9 Q;  2XIW A;  3NK9 A;  1X3F A;  2NN6 G;  4X3U A;  3HKZ B;  5JPN C;  4NXM Q;  1JOR A;  1U4P A;  3HG9 A;  4P73 A;  4QF4 A;  4X3S A;  4BBR H;  4NP5 A;  4XTC S;  1VQE A;  2DY8 A;  4PQX A;  1B50 A;  1CI3 M;  3NE5 B;  3GTO B;  1Y14 B;  5CV5 A;  4H02 A;  1VQO A;  1B4O A;  2CWP A;  5ELC A;  4HJ5 A;  2F0T A;  3OTO L;  5DAU A;  4QB4 A;  1HR0 L;  1OTC A;  1EQR A;  4DUZ Q;  4JI4 Q;  3ULJ A;  1A63 A;  1C8C A;  3CCM A;  5KNC A;  1DZ1 A;  1MI2 A;  3S17 H;  1KNA A;  3PO2 B;  1HNZ L;  1PTO H;  4XYO A;  1UE7 A;  3J7A V;  2QIL A;  1NMF A;  4CKE A;  1E0B A;  4DR4 Q;  4POF A;  3ITP A;  4YWL A;  1SYG A;  3FEW X;  3LGJ A;  3CCS A;  2PO4 A;  5EBD A;  4KMU C;  1C9O A;  2K4K A;  3KLS A;  3CF5 A;  1HZB A;  3SK5 A;  1SXT A;  3PIP A;  4MNO A;  2PMZ B;  1EY9 A;  2C9O A;  2IJ0 A;  5EJW A;  1SSO A;  1Y8P B;  2VQE L;  1QVF A;  2TSS A;  3T1Y Q;  3OMC A;  2BDO A;  1CHP D;  2JA6 H;  4QJF A;  3A7A B;  2QEX A;  4HMI A;  2JA5 B;  3T53 B;  2OXP A;  1HQR D;  5M3M G;  2C35 B;  1EUJ A;  2DJG C;  4A93 G;  2JXM B;  4BY7 G;  5COY A;  2QCP X;  1Q7Y C;  2PYK A;  5EKI A;  2ENB A;  3HOY H;  2XRS D;  4J6H A;  2AQ3 B;  3Q8D A;  1F2L A;  1E2V A;  1JOQ A;  1K8O A;  2MO0 A;  4BBR B;  3K0Y A;  3AQQ A;  4DV0 L;  4A3K B;  2D0O A;  1UE1 A;  1N8R C;  1PH7 A;  2Q2T A;  3GTL B;  1ZYR D;  3PMF A;  1MBY A;  3J80 E;  1XPR A;  5DM6 3;  3G71 A;  1M8A A;  3D4R A;  2X69 A;  1EQT A;  4FF3 A;  5FK9 C;  4Z9C B;  5C3E H;  4C3J G;  1TS3 A;  3KF6 A;  2DNC A;  5ELN A;  2E5L Q;  1EU3 A;  3CXC A;  1YNJ D;  4M1U B;  4FVM A;  4XT3 B;  1PTO B;  3L0O A;  5C0X J;  1E24 A;  4OIK A;  3BS1 A;  3A5Z B;  2KA7 A;  4DR6 L;  1Y1V H;  3FKI G;  2QDL A;  3TDQ A;  3VR6 A;  4UDU C;  1CA5 A;  2PNR C;  3P7J A;  1ASY A;  4B3R Q;  5IY0 A;  3G4O A;  1ENF A;  1RKN A;  3IAY A;  3PF4 A;  2AUJ D;  1SN8 A;  2EVB A;  2YTV A;  4S3S A;  3J81 E;  1I3Q B;  4GKJ Q;  5EPJ A;  5C0X G;  1DCZ A;  1FNU A;  1CK1 A;  2B2T C;  1WJJ A;  2F0V A;  2ZJP A;  4KJO A;  4CKC A;  1NMG A;  2V4D A;  2XN9 C;  4LF6 Q;  2ZTD A;  3HKZ G;  1PHJ A;  1A62 A;  1IYJ B;  4KI0 A;  2BH2 A;  1VQG A;  2F0O A;  1RF2 D;  3VYR A;  3DEP A;  4UP7 A;  4IFD J;  1WI5 A;  1TWH B;  4QUF A;  1STH A;  3KBX A;  4DV6 L;  4CDF C;  5CYU A;  1HNX Q;  1L1O A;  3EJI A;  2EYM A;  1I5F A;  2EYF A;  4WJ3 M;  2A19 A;  2K14 A;  1KHI A;  4DAV A;  2KHS A;  3K59 A;  1WCM B;  5A35 A;  4AQY Q;  1DOK A;  4JI2 Q;  1SEB D;  3T16 A;  3PO2 G;  4G7O C;  2GN5 A;  1SDF A;  3M7G A;  4RH6 A;  2LMC B;  4Y7N B;  4JI1 L;  3OIQ A;  4A3C G;  2C5C A;  1QUQ B;  3PIP 3;  2CH4 A;  2YV5 A;  1G2S A;  3H15 A;  2F4I A;  4WJW A;  3CD6 A;  1B8A A;  3M4P A;  1PH5 A;  1B70 B;  1TII D;  2A68 D;  1D5X C;  3ER0 A;  3HOW H;  1O7L A; 
#chains in the Genus database with same CATH homology
 3LWE A;  1Y1V B;  5KGU A;  4DAY A;  1VDZ A;  1D1I A;  1ZKO A;  5KNB A;  1KNE A;  4KN7 C;  1VCI A;  1KTK A;  3BDO A;  1EY0 A;  2DNE A;  2KED A;  1L0Y B;  1EIG A;  2ID0 A;  5I9O A;  3S15 B;  2R3Z A;  2PW7 A;  2F0W A;  4RFB A;  1LTS D;  4RKB A;  4A3E B;  4L8J A;  1GJX A;  4ZLT F;  5IGG A;  3BVZ A;  3SK6 A;  5BN5 A;  1A6X A;  1RD9 D;  3TZD A;  1HFG A;  2K1B A;  3Q22 A;  1EWH A;  1BF4 A;  2Z1C A;  3M4Y A;  1HRJ A;  3C1E A;  5CGK A;  3GV6 A;  2R6G A;  4RGO S;  4XT1 B;  2D9U A;  1GHJ A;  2FMM A;  2MPM A;  4BA1 I;  3X3M A;  2EY6 A;  5EBC A;  3ND9 A;  1E2Z A;  2JEA I;  1ICW A;  3L3O C;  2EY1 A;  5D3D A;  3OPO A;  3HOW B;  4NDX A;  1L0X B;  3ZYY X;  4FYD A;  1I4P A;  5C4X B;  2NZ1 D;  3D6W A;  4KKS A;  4V19 0;  2R7Z B;  4IUP A;  4ABN A;  5FLX E;  3I90 A;  3PV0 A;  1V1P A;  1WTW A;  3VA7 A;  3MEH A;  1I6V C;  3S1Q B;  2F0I A;  3HOX B;  4KY5 A;  2B2T A;  2BDN A;  1X3Q A;  3C0N A;  1STN A;  1BCP C;  1PRT F;  3I4N B;  4A3I B;  3S16 B;  1I4Q A;  3DXJ C;  3LX0 A;  3U9S A;  2WKD A;  2BA1 A;  4A3J B;  1STG A;  4EQP A;  2LFN A;  3E6Z X;  2A6H C;  4NKL A;  2JA7 B;  1U4M A;  2MGS A;  3OW7 A;  4N9T A;  1RDP D;  1KLG D;  2QKI C;  3P20 A;  1IKL A;  3AB9 A;  3KUP A;  1JCK B;  5C3X A;  1S5E D;  4XDX A;  5C3W A;  3NTH A;  4DGZ A;  1NR4 A;  3DM1 A;  3VR2 A;  5G3L D;  2FMC A;  3A55 A;  1EY7 A;  4KHV A;  1R4P B;  2BE5 D;  3K57 A;  1GHK A;  4G7Z C;  1S5D D;  2F0J A;  3DEO A;  3V96 A;  1X3P A;  1STE A;  2E2J B;  4CBV A;  3BDC A;  2X6L A;  1HUM A;  2F0N A;  2X6G A;  1ESR A;  5M5W B;  1E2W A;  4Q0F A;  3AU7 A;  1G8Z D;  2EYO A;  5DEH A;  3PUW A;  3SK8 A;  2OEO A;  4OIJ A;  2M9V A;  5JPM C;  2RVL A;  3FRP B;  5CMD A;  5CBA E;  1O7Z A;  5KRU A;  2VNU D;  4HR7 B;  1EZ8 A;  4C3H B;  4PV1 C;  4FNF A;  1OO9 B;  4R9W A;  1UNS A;  2B63 B;  1TS5 A;  1Q12 A;  3MXP A;  1G6Z A;  2IL8 A;  5KEE A;  3J80 L;  2L11 A;  2HQE A;  1CQF A;  1YNJ C;  1EL0 A;  1TS2 A;  1QB5 D;  1SNQ A;  1TR5 A;  3NBH A;  5ISR A;  3BDL A;  4HAE A;  1PFN A;  3MTS A;  4J8Q A;  1MSG A;  5HGT A;  3Q0A A;  2I46 A;  1MGS A;  4KV6 A;  3VYS A;  4HCS A;  1IW7 D;  1IYV A;  2JP1 A;  4K14 A;  2NUC A;  3PUY A;  1LTI D;  2EJM A;  3J81 L;  4F7X A;  2A74 C;  2EE1 A;  3NBI A;  1V8Q A;  2B8F A;  4ZRZ A;  1TS4 A;  4J1M A;  2EDG A;  1BUV T;  1RHP A;  3P1H A;  4F87 A;  1JOO A;  1I6H B;  3R8B A;  5EPL A;  4I65 A;  1MSH A;  3TME A;  2WV6 D;  3KF8 A;  3ERQ A;  2NVQ B;  2A69 D;  3I91 A;  3QOL A;  4HCE A;  5C6A A;  3TP8 A;  2F0H A;  2D2C C;  3FPP A;  1C48 A;  3G4N A;  3GTM B;  5C5M A;  4ZKB B;  2F03 A;  3VR4 A;  1SBB B;  4DXF A;  2VUM B;  1G29 1;  2L55 A;  3Q6S A;  5FOB B;  1O80 A;  1PRE A;  3S9W A;  4ZQ3 A;  3X3N A;  1STB A;  2Z4I A;  1B9N A;  3K58 A;  1QNU A;  1V1P B;  3HOV B;  1ESF A;  1JE4 A;  4R8N A;  2KCC A;  2SNS A;  3O13 A;  5EQ0 A;  3TP7 A;  3GQB A;  3W2D A;  4RCO A;  1SNM A;  1EWC A;  4DAP A;  4FXK C;  3P75 A;  2L1B A;  1R9T B;  5M5Y B;  2L0C A;  1H9S B;  3OIP A;  3R3O A;  1DJR D;  3HOU B;  3OWF A;  1ILP A;  3S1N B;  2HDM A;  2CHB D;  3ONA B;  3T4A C;  3E5S A;  4OGQ C;  1SND A;  3MXU A;  3K5N A;  3NSW A;  3H3V C;  4KY6 A;  5KND A;  3MXG A;  4RA8 A;  1IHZ A;  1QNK A;  1ONL A;  2EYP A;  1AN8 A;  3HP3 A;  3NWS A;  2Q8I B;  5FO7 B;  3OMG A;  2AQ1 B;  4DXG A;  4DK1 A;  4K2K A;  4BBS B;  4KY7 A;  1F9S A;  5AFW A;  4UAI A;  2F0M A;  1JR0 D;  4DK0 A;  1OXT A;  4B9X A;  1GOZ A;  1DXM A;  4ZK9 B;  5JOB A;  1KAB A;  1PTO F;  1W6K A;  1SFO B;  1PLF A;  4DNR B;  1JIC A;  3NQT A;  4LK1 C;  3DMU A;  2J0T D;  5IGE A;  3BYT B;  4PMW A;  1BCP F;  1CZG A;  2K03 A;  1WVL A;  1SYB A;  3HRZ C;  3D3R A;  3MZ5 A;  2E2D C;  1PFB A;  2F0F A;  1VF5 C;  3D31 A;  2B2U C;  2BCO A;  3S14 B;  2IX3 A;  4IN3 A;  1G2T A;  2RDF A;  1Y8N B;  2KCN A;  3N52 A;  1IYU A;  2XSC A;  1BQQ T;  3PUZ A;  2FJ2 A;  2PW5 A;  1HA5 A;  4C3I B;  5JVG 3;  2BE5 C;  2O2L D;  4F8M A;  4NW2 A;  3Q24 A;  2RDH A;  3H6M A;  3NP8 A;  4RKL A;  2RSO A;  3ERO A;  1PZK D;  1EY4 A;  2E76 C;  2M00 A;  1D5M C;  3I70 A;  2IT1 A;  5D14 A;  3M85 A;  1TKW B;  3MC0 B;  4GZY C;  5EKK A;  4XQJ A;  1EY8 A;  2K5W A;  4MIU A;  4RWS C;  4ZAI A;  1TT2 A;  4KHZ A;  3GV3 A;  3JAM E;  3A8I E;  2F0E A;  1S5B D;  3NWT A;  2R61 A;  1LO5 D;  1SMY D;  2AQ2 B;  3A8K E;  4DN4 M;  5JJZ A;  1SAP A;  1D5Z C;  1TWC B;  3HOZ B;  1WD1 A;  2RA4 A;  4WOR A;  2Q8R E;  3HZX A;  1TY2 A;  1BXT A;  3E0J A;  1U4R A;  1AW7 A;  1Z47 A;  2NWG A;  2EYL A;  2H4O A;  3CU7 A;  1C4Q A;  1LV9 A;  2F0G A;  5DNF A;  3GTP B;  4HSP A;  2K28 A;  1GUO A;  5EPK A;  1PRT D;  1CZW A;  2EJF C;  1IKM A;  1I50 B;  2O5I C;  2IWH A;  5C4Z A;  3C0O A;  2E2H B;  2NB0 A;  1EQV A;  3AMU A;  1RJT A;  1Q90 A;  5NUC A;  3DWA A;  2QEJ C;  3HS0 C;  1FNV A;  3GTG B;  1LTG D;  2ZXP A;  2A6E D;  4ILW A;  3BZD B;  2B2U A;  2RSN A;  2Q8T A;  2Z4H A;  2G9D A;  2EPB A;  3KBG A;  3S1R B;  1PYW D;  5K36 H;  4C3I G;  3J7Y W;  4FXG C;  2HUG A;  1SE4 A;  2J7Z A;  4A3D B;  2QDB A;  3F2U A;  1PFM A;  3RLF A;  4FP5 D;  4KKU A;  2B2V C;  3CQZ B;  2K6A A;  1TWF B;  2ZXR A;  1PTO C;  1XXG A;  1NCV A;  4A3B B;  3D6C A;  1B53 A;  3PUV A;  2WKC A;  2F1M A;  4IZ8 A;  5IOD A;  1LTR D;  1LLR D;  5IGD A;  1FNW A;  3URY A;  3T56 B;  1SNO A;  5CV7 A;  5CV9 A;  4IQZ A;  1BBX C;  4TQU S;  3VR3 A;  4O1N A;  3IFD A;  1STY A;  2KJX A;  3KLS X;  3CKI B;  1CQV A;  4RHS A;  4K5V A;  1YNN D;  1HXY D;  3EVQ A;  5KYL A;  3WOE A;  4A3G B;  2KEE A;  5TSS A;  2ZT9 C;  3IFT A;  4BWG B;  1WTR A;  2O4X A;  1CFM A;  3SE0 A;  1EIH A;  4ODG A;  5IGB A;  1A3T A;  5A2Q E;  4K6D A;  1EYC A;  4C56 C;  3M4O B;  3CRK C;  3QO2 A;  1PRT B;  5JAV A;  3ND8 A;  1I4R A;  4A3F B;  1NR2 A;  2HCI A;  4AYB B;  1CHQ D;  1Y8O B;  2NTS A;  3EA6 A;  3MA2 B;  5C4H A;  1EOT A;  1KAA A;  3V05 A;  1F2Z A;  2MHV A;  2EY2 A;  2WIN B;  2F0P A;  1WD0 A;  1AP0 A;  4XQQ A;  1H9J A;  5IT9 E;  4OO1 H;  5FO8 B;  1AEX A;  5LL6 S;  4C1N K;  1U4L A;  1RTO A;  1Z52 A;  4HTH A;  5C44 B;  3GO5 A;  1Q8I A;  1X32 A;  1ZYR C;  1QJO A;  1ET6 A;  5D3I B;  4TKO B;  3FPU B;  3T51 B;  1FGB D;  3A54 A;  4K5W A;  1S4Z A;  4G4K A;  2F0L A;  1EY5 A;  3QOJ A;  1VF7 A;  5CC4 A;  5DM7 3;  2A73 B;  4DA2 A;  2B2V A;  3WOF A;  2CW0 D;  1FYC A;  3C0M A;  1KLU D;  4QCL A;  1EEF D;  4H0L C;  1Y69 U;  2QF7 A;  4KD4 A;  1BNZ A;  3A8J E;  2EY5 A;  3VYT A;  1JQY D;  2F0Q A;  5G3L F;  2F3W A;  1OXX K;  1DD2 A;  3SDZ A;  4LMQ D;  1LTA D;  1DM0 B;  1O7Y A;  2JE6 I;  3K5M A;  1BR9 A;  3IKJ A;  1VMP A;  3EFX D;  4XQN A;  4OO1 I;  1PZJ D;  2CQA A;  2EJG C;  2ICI A;  3NTK A;  2SDF A;  4MHE A;  5K36 G;  4NMZ A;  4PNY A;  5I2X A;  3I72 A;  2L5T A;  4LAA A;  5I6Y A;  4CGY B;  2FHT A;  4XYQ A;  4EQO A;  2LKV A;  1F9P A;  1ML0 D;  5CV8 A;  1J8I A;  1A15 A;  1G91 A;  1WTQ A;  1XX8 A;  1J9O A;  2EYJ A;  3NUC A;  3K5L A;  2EZV A;  2DN8 A;  4U67 3;  2A68 C;  3OWE B;  1EEI D;  5ELE A;  1PZI D;  4A93 B;  2L9H A;  4DF7 A;  1CTM A;  3OHX C;  4KJN A;  2F0S A;  2B2Y C;  3QJY A;  3GTK B;  5ELB A;  5I2Y A;  3RMH A;  1IL8 A;  4FF4 A;  3RUZ A;  3SXH A;  4TRD A;  4EGV A;  2DY7 A;  3BVM A;  3SK4 A;  2K04 A;  1JWM D;  3DWP A;  3CRL C;  3DHQ A;  3LNN A;  5M3F B;  3MAQ A;  5EGT A;  4DNT B;  5LL6 X;  3OSO A;  3K6O A;  2PPB C;  3GTJ B;  4RAU C;  4C3H G;  2PQE A;  4XXE A;  1O78 A;  1BCP D;  4K2L A;  2G9H D;  1U9R A;  1H9R A;  2Z8L A;  2PZU A;  1RTN A;  1EYA A;  2A6E C;  2BOS A;  5KIX A;  1EYD A;  2AWN A;  1WTV A;  5J39 A;  4K6L A;  2NVX B;  5EKL A;  5FKA C;  3U9O A;  4RGN A;  4QMG A;  1OXV A;  1T5X D;  1EFI D;  2A6H D;  2NVT B;  4KK7 A;  3BG3 A;  4DFA A;  5K5P A;  1ET9 A;  1VMC A;  1JOK A;  3GP7 A;  2SNM A;  2JYO A;  5KYI A;  1CA6 A;  3MVV A;  1SYE A;  1DOL A;  5FLX L;  3V2T A;  3R93 A;  2RBM A;  4OO1 G;  3K7A B;  1TY0 A;  3K5O A;  3SVM A;  4OHJ A;  4BS9 A;  1S5F D;  5M9O A;  2FIN B;  3C46 A;  1BO0 A;  5E4W C;  4IFD I;  5I9P A;  1Z6H A;  2XNA C;  4CJ0 B;  2WP8 J;  4OL7 A;  3M3Y B;  4FF2 A;  4RGM A;  4G57 A;  2XRQ D;  1UEA B;  1HHV A;  4ULL A;  1CT1 D;  3EQL C;  4F88 A;  1UAP A;  2NYZ D;  1LT5 D;  5FO9 B;  4R8I A;  2F0K A;  2B39 A;  2NTT A;  4B08 A;  2K7V A;  1SE2 A;  1BOS A;  4KTA A;  1YNN C;  4BA2 I;  3A7L A;  1Q1B A;  5I4D A;  1ROD A;  1EZ6 A;  2AWO A;  1KDC A;  4IAL A;  2NBF A;  5D65 A;  5CR3 A;  2B2Y A;  1AZQ A;  1GUS A;  2HDL A;  4C2M B;  1F2M A;  3L9A X;  4O42 A;  2EYH A;  2BA0 A;  3MFG A;  1HTP A;  3J7A F;  3DWQ A;  5ELF A;  1JWS D;  2VB3 X;  5IIF A;  4X3T A;  5A2Q L;  3S17 B;  5E4X A;  3PUX A;  4E6I A;  2TMP A;  2IX1 A;  4HED A;  1II3 A;  1CM9 A;  2LS0 1;  3TSS A;  4M8A A;  1B44 D;  1EU4 A;  2KOL A;  1SNP A;  1BCP B;  3QG1 A;  2J4X A;  2WB1 B;  5IGF A;  3I8Z A;  4RHR A;  2KUM A;  3VA5 A;  2SEB D;  1BDO A;  4IUU A;  4IUT A;  3FMC A;  2JA6 B;  3KK7 A;  3IL8 A;  5IT9 L;  3C3L A;  3R2T A;  1RCV D;  2E74 C;  3HOY B;  2VXW A;  2IPK D;  4P2C B;  1JB3 A;  4B9W A;  1A3V A;  1WTO A;  4X3K A;  2K05 A;  1XTC D;  2D5D A;  2CW0 C;  1NAP A;  2ZXO A;  5T1I A;  2L12 A;  4V0B A;  3I73 A;  3H91 A;  2I07 B;  5JEA H;  1I4G A;  4JBW A;  2MP1 A;  5C3E B;  1KDA A;  1AZP A;  1ILQ A;  4IFD G;  4G7H C;  5J22 A;  3D4W A;  1AFP A;  4JK1 C;  2KVM A;  2AUK A;  1JWU D;  3C2P A;  3G7L A;  1HUN A;  1ENA A;  1IW7 C;  2D62 A;  1XWE A;  2MJ8 A;  3BVG A;  1SNC A;  3T13 A;  5COR A;  1PXU A;  3TP5 A;  3TP6 A;  1TVX A;  1WTX A;  1F9Q A;  5CV4 A;  4CHT B;  2F3V A;  3A56 A;  3G6J B;  4HN7 A;  1FR3 A;  3NQI A;  3I4M B;  5I6W A;  4KN4 C;  2A69 C;  2LY7 A;  4N9P A;  2HCC A;  1S5C D;  3D8G A;  1NSN S;  1XYI A;  1LT4 D;  2N88 A;  1HCZ A;  4IUN A;  2EOT A;  4L6T B;  1GUG A;  2K5Q A;  2RDG A;  1QCB D;  5M5X B;  1F2Y A;  4ZUI A;  3QB3 A;  1TWA B;  4EVO A;  2PZT A;  1I4H A;  3RD4 A;  3TN2 A;  2M2L A;  2OF1 A;  5F2D A;  2JEB I;  1TQO A;  1OXS C;  5J1Z A;  1LAC A;  2SOB A;  3M7N A;  1LTT D;  4MN3 A;  5ELD A;  5E3F A;  3D4D A;  2ICE C;  3QWN A;  4HSV A;  3N6R A;  1A3U A;  4A3M B;  1T5E A;  2A5H A;  4ZYS A;  3I3C A;  1PMR A;  1ZEQ X;  3NPP A;  4FF1 A;  4LJZ C;  3NTI A;  2H1E A;  3MFY A;  1H9S A;  2E75 C;  1GUW A;  2RQX A;  1EY6 A;  1GXD C;  3H0G B;  2B8G A;  3BYY B;  2L4N A;  4ZUJ A;  2JA8 B;  4H13 C;  2YYZ A;  2K5D A;  4U68 A;  4TSS A;  5E1F A;  1V1O A;  2JSO A;  1GUT A;  4Q5V A;  1A2T A;  3QIA A;  4CKB A;  4K8J A;  4CJ1 B;  2KQ3 A;  2XWJ B;  1GUN A;  1UUP A;  2NN6 H;  4K8I A;  3FVQ A;  2RKS A;  3GTQ B;  1Z7T A;  4C1N I;  3W3A A;  3SEB A;  3PO3 B;  5IGC A;  5BN4 A;  2R93 B;  4RGT A;  3HGB A;  3H09 A;  5CV6 A;  1D1K A;  2OT2 A;  5JEA J;  2B2W C;  2PCF B;  2WAQ B;  1K8M A;  2CVR A;  2WAC A;  1Y1W B;  4DU9 A;  1B9M A;  1B1Z A;  3TBI B;  2IX0 A;  5CBE E;  1B2T A;  3S2H B;  4QUC A;  3PIO 3;  5JEA G;  3R2I A;  4IUQ A;  4PMC A;  2YU9 B;  1Q1E A;  2O5J C;  3WDN A;  1LT6 D;  2GA4 B;  4IUR A;  4BY1 B;  5IOC A;  4K5X A;  1W6J A;  3MWY W;  3SR1 A;  1H9M A;  3NHH A;  2K33 A;  2IW3 A;  2Y0S B;  1LT3 D;  1F77 A;  1STA A;  1SYC A;  4RCN A;  2K32 A;  4YIJ A;  3DUZ A;  1V43 A;  1JC7 A;  4KKT A;  2NN6 I;  2FFK B;  3S2D B;  1B3A A;  2WII B;  1NUC A;  2NVY B;  3RZO B;  4FXD A;  1Q3L A;  3GD7 A;  1HPC A;  5C5L A;  1DOM A;  3NXW A;  1D6E C;  1I4X A;  3UI2 A;  1PDQ A;  1LTB D;  1ENC A;  3S1M B;  1SYF A;  1HA6 A;  4H7B A;  2KEC A;  2F0D A;  3L7Z C;  2F0U A;  2PZW A;  5JVH 3;  1DYQ A;  1SYD A;  1DON A;  5T1G A;  1SMY C;  4H44 C;  4IUV A;  3JAM L;  1TWG B;  1QWY A;  3RZD B;  3I4L A;  1ZXT A;  1HQM C;  4CJ2 C;  3KLR A;  4FO2 A;  1OXU A;  1F9R A;  1QE6 A;  1WTP A;  5C0X H;  2K01 A;  3LWU A;  4ZKC B;  3VR5 A;  2XVS A;  1R4Q B;  5C4J B;  5HUR A;  5M3M B;  3C1F A;  4BY7 B;  5LHY 1;  4WFN 3;  1KDB A;  4XIG S;  1H9K A;  4KD3 A;  1MD2 D;  2R92 B;  1LAB A;  1TU2 B;  3MHB A;  4ME5 A;  1D2B A;  3HEJ A;  3MXN A;  2E2I B;  2EXZ A;  4WRD A;  1M4V A;  4L63 B;  3Q23 A;  4I7Z C;  1PRT C;  2B2W A;  3VYU A;  3FDT A;  4C3J B;  4IFD H;  1PTO D;  2XWB B;  1SE3 A;  1HTL D;  3OOC A;  4QIW B;  1SJH D;  3FKI B;  4PMB A;  1QOH A;  1HFN A;  1K83 B;  1QIL A;  5BN3 A;  2MUY A;  3CHB D;  2N55 A;  1FD7 D;  4EQN A;  3H94 A;  4ID6 A;  1A2U A;  1SJE D;  4HMJ A;  2VB2 X;  3SHL A;  1QG7 A;  3TZU A;  5C0X I;  2XIW A;  3NK9 A;  2NN6 G;  4X3U A;  3HKZ B;  5JPN C;  1JOR A;  1U4P A;  3HG9 A;  4QF4 A;  4X3S A;  4NP5 A;  4XTC S;  2DY8 A;  4PQX A;  1B50 A;  1CI3 M;  3NE5 B;  3GTO B;  5CV5 A;  1B4O A;  5ELC A;  2F0T A;  5DAU A;  4QB4 A;  1C8C A;  5KNC A;  1DZ1 A;  1MI2 A;  3PO2 B;  1KNA A;  1PTO H;  4XYO A;  3J7A V;  2QIL A;  4CKE A;  1E0B A;  3ITP A;  1SYG A;  3FEW X;  2PO4 A;  5EBD A;  4KMU C;  3KLS A;  3SK5 A;  1SXT A;  2PMZ B;  1EY9 A;  2C9O A;  2IJ0 A;  5EJW A;  1SSO A;  1Y8P B;  2TSS A;  3OMC A;  2BDO A;  1CHP D;  3A7A B;  4HMI A;  2JA5 B;  3T53 B;  2OXP A;  1HQR D;  2JXM B;  5COY A;  2QCP X;  2PYK A;  5EKI A;  2ENB A;  2XRS D;  4J6H A;  2AQ3 B;  1F2L A;  1E2V A;  1JOQ A;  1K8O A;  4BBR B;  3K0Y A;  4A3K B;  3GTL B;  1ZYR D;  3PMF A;  1MBY A;  3J80 E;  5DM6 3;  1M8A A;  3D4R A;  2X69 A;  1EQT A;  4FF3 A;  5FK9 C;  4Z9C B;  4C3J G;  1TS3 A;  2DNC A;  1EU3 A;  1YNJ D;  4M1U B;  4FVM A;  4XT3 B;  1PTO B;  5C0X J;  4OIK A;  3BS1 A;  2KA7 A;  3TDQ A;  3VR6 A;  4UDU C;  1CA5 A;  2PNR C;  3P7J A;  3G4O A;  1ENF A;  1RKN A;  3IAY A;  2AUJ D;  2EVB A;  4S3S A;  3J81 E;  1I3Q B;  5EPJ A;  5C0X G;  1DCZ A;  1FNU A;  1CK1 A;  2B2T C;  2F0V A;  4KJO A;  4CKC A;  2V4D A;  2XN9 C;  4KI0 A;  2F0O A;  1RF2 D;  3VYR A;  3DEP A;  4IFD J;  1TWH B;  4QUF A;  1STH A;  3KBX A;  5CYU A;  3EJI A;  2EYM A;  2EYF A;  4DAV A;  2KHS A;  3K59 A;  1WCM B;  5A35 A;  1DOK A;  1SEB D;  3T16 A;  4G7O C;  1SDF A;  3M7G A;  4RH6 A;  2LMC B;  4Y7N B;  3OIQ A;  2C5C A;  3PIP 3;  1G2S A;  2F4I A;  4WJW A;  1TII D;  2A68 D;  1D5X C;  1O7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...