1PTOC

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoC01
4RGTA 2AQ1B 4L63B 2XNAC 2TSSA 1PRTB 1ESFA 1I4QA 1DYQA 2R61A 2CHBD 3C0OA 1S5FD 1HXYD 1PTOH 3TSSA 1D5MC 1I4XA 1V1PB 5ELBA 1PTOB 1G8ZD 3BVGA 3OWEB 2XRSD 1UUPA 1L0XB 3R8BA 1RF2D 4Z9CB 1F77A 1TS4A 1MD2D 1BCPB 4UDUC 1AN8A 2RDGA 2WV6D 4DXGA 3C0MA 4K6LA 1GOZA 3KLSX 4RHSA 2O2LD 1ENFA 1HA5A 1STEA 4L6TB 1S5BD 1JR0D 2Z8LA 1LTID 1LTGD 1FD7D 1EWCA 1T5XD 3CHBD 5ELEA 4TSSA 1LT4D 3BVZA 1SJHD 1TS5A 1I4RA 1TY0A 1D5ZC 1LTBD 5ELFA 1QILA 1EEFD 2AQ3B 3EFXD 1PYWD 3W2DA 2J4XA 1KLUD 1XXGA 3DWPA 1PZJD 4ZYSA 1I4GA 5I4DA 1CHPD 5D3IB 1CK1A 1PRTF 1ET9A 1TS3A 1TS2A 1SE3A 1JQYD 3MC0B 1FNVA 4RGNA 1LO5D 2AQ2B 3EA6A 1DJRD 1RCVD 1EU4A 4RHRA 1PTOF 1Z52A 1BXTA 1UNSA 5TSSA 1RD9D 1HTLD 3BZDB 5ELDA 1L0YB 1JCKB 1AW7A 3V05A 1LTRD 1BCPF 1PRTD 1SE4A 2QILA 1EFID 1SE2A 5D3DA 1SJED 1CHQD 4RGMA 1PTOD 1V1OA 1RDPD 4DXFA 1SEBD 2XN9C 1S5DD 4OHJA 1FNUA 1BCPD 3R2TA 2G9HD 2IJ0A 1V1PA 5FK9C 2ICIA 4RCOA 2SEBD 2QEJC 1D5XC 1FGBD 4RH6A 1D6EC 1LTAD 1PREA 1EEID 3BYYB 3R2IA 1LT6D 2IPKD 1PRTC 3DWQA 4RGOS 1B44D 1ET6A 1CQVA 3G4NA 3C0NA 2NTSA 1PTOC 1KTKA 5ELCA 1JWSD 1LTTD 1LT3D 3BVMA 3G4OA 4C56C 1SBBB 1BCPC 1PZID 1PZKD 3MFGA 2XRQD 1JWUD 1I4PA 1I4HA 3GP7A 1FNWA 1HQRD 4BWGB 3URYA 3O13A 1XTCD 1SXTA 1TY2A 5FKAC 1LLRD 1KLGD 3BYTB 1B1ZA 2NTTA 2RDHA 3DWAA 1CT1D 3SEBA 1S5ED 4RFBA 1EU3A 1M4VA 1LTSD 1S5CD 4O1NA 1JWMD 1LT5D
chains in the Genus database with same CATH superfamily
3J81L 1VQJA 4IUQA 4BBSB 4OX9L 4IFDJ 3C0OA 4S3SA 1D5MC 5AJ3L 5ELNA 3F1ZA 1G2SA 3I4NG 1RTNA 1TXYA 5LMNQ 2BDNA 1VMCA 1L1OB 3F2CA 2SNMA 4JI0Q 2NUCA 4JYAL 2RDGA 1DOKA 2F0LA 4YHHQ 1GUNA 3HKZB 3C0MA 4AQYQ 1TWAH 2K33A 3KLSX 1HA5A 5FLMH 1TWAB 4G57A 3CW2C 4OELB 2OTLA 3HOYH 2Q2UA 1HTPA 1XMQQ 4GOPA 1S5BD 3HOYB 2HDLA 2Q8RE 1NSNS 3D0FA 3EIVA 3ZJYC 1AP0A 4DV5Q 5ELEA 4PG3A 3CRKC 1A2TA 3L0OA 3E9HA 5J39A 4YY3L 1PH1A 1EYGA 2JA8H 1VF5C 3OMGA 1WTPA 2H5XA 2IT1A 2JA8B 4FVMA 1SYDA 3G71A 2J4XA 4K2LA 1XXGA 3EQLC 3DWPA 4A76A 5I4DA 4X64L 2YTYA 4DKAC 5EKLA 4QF4A 1DZ1A 3UDIA 1XYIA 1IBML 2R93G 4CKCA 4CDDC 5EJWA 3A5ZB 3NBHA 4EQPA 1OXSC 1U4RA 5ELOA 1PFBA 4IUVA 1BCPF 1MKHA 1PRTD 1UAPA 3ULLA 2G9DA 1EFID 2PNRC 4UP7A 5C44G 4LUZA 3HZXA 3D3RA 4X65L 4NXML 4BA1I 5K5PA 1XPRA 1PTOD 4UP8A 2EYOA 2DUDA 4C3HG 4N9PA 1Z7TA 3SK8A 3T1YQ 1X65A 2K5DA 2JA5G 1HRJA 3R2TA 3KBXA 1KHIA 1WTHA 5M3MG 1V1PA 2B2TA 4LMQD 1HFNA 4ZK9B 3S1MH 2NVXH 3CPFA 4XDXA 4R4IA 2KHSA 3S1MB 4JI6Q 2NVXB 4O2DA 1WTQA 2K04A 2PMZB 2NTSA 3B6YA 4YWKA 2X69A 2KENA 1SE8A 4DF7A 1I6VC 4LF5L 4LF6Q 4OGQC 4IUTA 1YHAA 1PZKD 3F2UA 2F3VA 1I4HA 1HQRD 2F0JA 4QY7A 1QG7A 4DR1Q 3URYA 2DJGC 4IUPA 5GAGC 2EYHA 2F4IA 1YNXA 4LF8Q 2EJGC 5JVG3 1BVSA 3QG1A 4IOCA 1PVOA 4XIGS 4R4OA 4DR3Q 1HNWQ 3PGZA 4IFDH 4R1JA 1SJED 4L63B 3V2TA 1SROA 3K0XA 4HJ5A 5D14A 2KCCA 1DYQA 1PFNA 3AYHB 1L1OC 4KJNA 1Q7YC 4JI5Q 5ELBA 1Z6HA 1D1IA 2MJ8A 5EPLA 2JA7H 5KEEA 1VCIA 3HKSA 2JA7B 3P20A 5KGUA 2F3WA 4UDUC 1PLFA 4APVA 4A3CG 4GLAC 2HIXA 2WP8J 4MHEA 1W2BA 3KOJA 2JEBI 4DV0L 3M7NA 3S1QH 4ZKCB 1HR0L 5IT9c 3S1QB 1C0AA 2NN6H 3KLSA 3FP9A 2UXCQ 2N78A 4LF7L 1WJJA 4BS9A 2NZHA 1X56A 1KLUD 1HQMC 1FL0A 2C35B 3I91A 3MWYW 4DV3Q 1PH5A 3WWVA 2DNCA 2EY1A 3S15H 3RZOH 1BQQT 2KHIA 3E3XA 1DJRD 3EA6A 3KK7A 1XWEA 3S15B 2HUGA 3IKJA 3RZOB 3NENA 4PZ8A 1S72A 4G7OC 3SDZA 2UXBQ 1VQ9A 4JI1L 1B4OA 3PIP3 3M4YA 5HGQA 1V1OA 1RDPD 1A8VA 2B2VA 2I5HA 1JORA 1K83B 4B08A 2KJXA 3IAYA 2G9HD 2KCTA 2IJ0A 4IJHA 1ICFB 2Y0SE 4GOPB 4BY7G 3EBEA 1X6OA 4AYBB 2QKIC 3I4LA 4JI2Q 1YZ6A 3DWQA 3CC2A 5NUCA 1SR3A 3LWUA 3ONAB 2YV5A 1R9TH 4C56C 3VR3A 1STAA 5E3FA 2HDMA 1YI2A 1R9TB 1WOCA 1BBUA 1X3PA 1PZID 5KNBA 5M5WH 1GKHA 1CUKA 5KIXA 1K8GA 4BXXG 1K0RA 5M5WB 1FNWA 2HHHQ 1AEXA 2N49A 4CKEA 5FKAC 3NBHB 3HEJA 1CA6A 1I94L 4I7ZC 5C4XG 4K8JA 1IHZA 5E4WC 4JBMA 5IP9G 1JWMD 2AQ1B 3PO2H 2Z4HA 2YU9B 1Y1VG 3PO2B 4A3IH 4O0AA 1PFSA 1V1PB 4A3IB 1QOHA 1TWGH 1RF2D 1BNZA 1TWGB 4JV5L 4GNXC 3BZKA 3CRLC 3J81E 3JAMc 3J81i 1VMPA 1F9SA 4GKJQ 1NMFA 2VL6A 3L2PA 3PSIA 2BOSA 2C5CA 1H9MA 2A74C 2Z8LA 1WD1A 4A3JH 5IOCA 4DV6L 1SJHD 3CCVA 1JOKA 5M3FG 4A3JB 4A3GG 1V9PA 1GHKA 4LF9Q 1G291 5JJIA 1IZ6A 1C9OA 4M1UB 4A3DH 2K50A 2EJFC 2K7VA 3QO2A 4A3DB 4X66Q 2F1MA 1TVXA 1EU4A 2EY2A 4IPCA 4QIWE 1XMOQ 2B63H 5ELDA 3H94A 2B2YC 2B63B 1VQOA 5FO8B 3STBD 3CCMA 3H3VI 3UDGA 1FJGL 3HOZH 3E6ZX 4HMIA 1VQPA 2K05A 2NBFA 3HOZB 2PNHA 1YNNC 5IGFA 5HURA 2QA4A 4HCSA 1D5XC 1D6EC 2AKWB 3HGBA 3K57A 4B9XA 4LUVA 1B44D 5GQOA 3C0NA 3SVMA 3A8JE 5KNCA 1Q46A 1JWSD 1OXTA 1OO9B 2A6HD 1UE1A 4LF4L 4GN3B 4PZ7A 2E2JH 5BR8Q 4PZ6A 2E2JB 3LWEA 4RG1A 1J9OA 3P75A 1N36L 3M3YH 4L5TA 2EXZA 3ZYYX 3T13A 1AZQA 3NTHA 3M3YB 3SK5A 1J8IA 4HIMA 5C3EG 4N9TA 1KQSA 2I07B 3T1HL 5LHY1 3H09A 2SDFA 4O1NA 5FLXL 1CM9A 5KYLA 3Q0AA 2FMCA 2LXKA 1S5FD 4ODGA 4A3FH 4JW0A 2F0KA 1L0XB 2K5QA 2KHJA 3R8BA 4C1NI 3PF5A 4A3FB 1HUMA 1Q1BA 2EY6A 1W3SA 2PCFB 1STHA 2EXDA 3VR2A 2R7ZH 1BCPB 4JI4L 2R7ZB 1AN8A 3S9WA 5C4JH 1ILQA 1E1TA 2R92H 3S17H 3S17B 5C4JB 1WVLA 2R92B 1Z9FA 4DAMA 5IP7G 2E2DC 1U4PA 3RMHA 2BH8A 3AMUA 1M1KC 1KRTA 1MSGA 4POFA 1XNQQ 4DUZL 3CHBD 3QIAA 4DK3C 4DK6C 1EQQA 4X3TA 2AQ3B 2L1BA 1Y1WG 5KNDA 4BA2I 4PMCA 1EY0A 4Y7NH 2CCZA 3CKIB 5DLQE 4FF3A 3RLOA 2WKCA 3S1NB 4Y7NB 1SFOH 1FNVA 2M00A 4GN5A 5JPNC 1WD0A 1EYCA 2E76C 1TIID 1SFOB 1R4PB 4B3RQ 4NXNL 2EJMA 4ULLA 1ZXTA 2ZTEA 1X3FA 1SE4A 3S14H 2XWJB 3S14B 1VQKA 2QEXA 3FVQA 4BY1H 4K0KL 4DV7Q 3A7AB 4WFN3 4BY1B 2AMCB 3GTPH 3GTPB 5CV8A 1PMRA 1NTGA 2QEJC 4RH6A 3OTOQ 1KL9A 1VQ7A 4JI3Q 2IX0A 4RKBA 3GTLB 2YTVA 2Q2HA 4K5XA 3PIPA 1M8AA 1CSPA 2KA7A 2K32A 4DN4M 1JWUD 1I4PA 2EYPA 3QOJA 1WTWA 4FXGC 1P16A 1HZ9A 4DR4Q 3O13A 5GROA 4DNTB 1SXTA 1LYLA 4OX9Q 2L9HA 3KUPA 1KLGD 2F03A 1B1ZA 2ZXOA 5AJ3Q 1CT1D 2JYOA 3NE5B 1EOTA 4A3EG 2UXDL 2ZXPA 4HJ7A 4B3TL 4U673 2VB2X 2TSSA 1BBXC 3M85A 4UHVA 4MTKA 2QCPX 1UUPA 2NVTH 5DM73 4FF2A 4J6HA 5FO7B 1QNKA 4CGYB 5T1IA 4DXGA 2AWOA 1LM0A 1EIYB 1BUVT 4K5VA 2KBNA 1ZEQX 1JJGA 3EJIA 3FKIH 4HSVA 3FKIB 5E7NA 1A2UA 5IODA 4YWMA 1KABA 1MGSA 3HOUG 4WORA 2I5MX 4TSSA 3K7AH 4JBJA 3J80L 1TS5A 2KQ3A 4OWTB 3K7AB 3CCUA 4L5QA 1IBMQ 3RN5A 4H0LC 4PMBA 5EKKA 4R4TA 4JI8Q 2PW7A 1VQ4A 3WOEA 1CHPD 1TS3A 1ESRA 3Q6SA 2AQ2B 1V43A 3UI2A 2NWGA 5C0XJ 1D7QA 4K6DA 2E8GA 2MFIA 4C3IH 2JA6G 1L0WA 3OPOA 1SE2A 2A69D 4C3IB 3I56A 3X3MA 1CI3M 1BO0A 3MEFA 1DD2A 2E2IH 2L15A 5EQ0A 1E2VA 3E5SA 4KHPL 3LGJA 5IYDG 4LF5Q 1T5EA 1N33L 1K73C 4LFAL 1EEID 4IO9A 1PRTC 2IHEA 3JC66 1NY4A 4NW2A 3PUYA 1PTOC 3MFYA 3LX0A 1II3A 4JI7L 1MHWC 1EOVA 4HCEA 3CC4A 3I4OA 2XIWA 3KFUA 1HNXL 4A3LG 4ZKBB 1YJ9A 2H1EA 1N34L 4P73A 4LFCL 1ENAA 4U68A 2F4VQ 1GUSA 3NELA 4DV1Q 2X6GA 1EQTA 3TS2A 2UUAL 1E3PA 1EWIA 2K1BA 2NZ1D 5CORA 2VUMG 1EFWA 4GNXA 3GTGH 3M9BA 3GTGB 4DR5Q 3AU7A 4DV2L 4FF1A 1TS4A 5FLXE 3DEPA 4HIKA 4LFBL 1VF7A 2WIIB 4LF7Q 3C3LA 1H9KA 4RHSA 1NBWA 4CKBA 3U9SA 1JB7A 2L12A 1XNRL 3PIO3 2B8FA 2AUKA 4DR6L 5K36H 4CJ1B 2HQEA 1LTLA 4PMWA 3K81C 4C3JG 3K5MA 2HIVA 2JA9A 2R3ZA 2D0OA 4AYBG 5F2DA 3W2DA 3SE0A 3VR5A 2RSOA 1PYBA 5I9PA 4XT3B 5JAVA 3R93A 4XQNA 1Q86C 1F2MA 2B2YA 4KHVA 4BBRG 2E75C 3ND9A 5C4HA 2UUCL 3AQQA 5C0XH 3HOVH 3HOVB 1B2TA 3S16H 2F0UA 2V4DA 4NPSA 2B3GA 3BZDB 3M4OH 2F0OA 3AB9A 1GHJA 3M4OB 5C5LA 1K3BC 2D62A 2EDGA 1VQEA 4KI0A 4GKKL 4DXFA 2HCCA 3J7AF 5IYBH 3H0GH 2LMCB 2Y0SB 5JEAJ 4WRDA 2F0SA 3H0GB 1U9RA 5J1ZA 5FJ8H 2MHVA 4CDFC 5CBEE 1KXLA 4KTAA 5C4ZA 3OMCA 4LAAA 1EY8A 3CU7A 1ET6A 1NJIC 1X9NA 2OWOA 3J81c 3C1EA 4A75A 1HUNA 2SOBA 4KKUA 2BA0A 3F8TA 1TR5A 2JXMB 1IBKQ 1SBBB 1ZKOA 2F0TA 5IWAL 1YJNA 3HOXG 3D8GA 4HJ9A 1HNZQ 2QDBA 4RWSC 2MP1A 5M5YH 2K4KA 4XQJA 3TRZA 4I7AA 1OXXK 1CTMA 5M5YB 1STGA 3A54A 4MTNA 1V8QA 2DGYA 3G6JB 2IL8A 3ERQA 4LJZC 2DN8A 1WCMH 3BYTB 1EYDA 2ZT9C 1WCMB 1HZCA 2OF1A 1KC8C 4OWWB 3I4MG 1NE3A 3DUZA 3K5LA 1ML0D 1AFPA 2OT2A 2XTIA 5C3WA 1G8ZD 4A4IA 2QGQA 4NB3A 4DV4Q 2F0PA 4XTCS 1B53A 5DEHA 4Z9CB 1MD2D 1GM5A 1IBLL 3J81j 1GUWA 3I72A 3MTSA 1SNQA 2MO1A 3NP8A 1WTOA 2V1CC 2ALYB 4L6TB 4HAEA 1JR0D 5IT9L 4A3KH 1QZGA 2WKDA 2A1AA 2A6ED 2E74C 4KY6A 2MNAA 1LT4D 5I6YA 1NMGA 1D2BA 2BE5D 1C4QA 3PMFA 4AIMA 5IYCG 1XJVA 1PFMA 2F0FA 5CBAE 1SLJA 1PRTF 1VQLA 1ET9A 2PO4A 4RKLA 5ISRA 4HJ8A 3J80i 3RLNA 2UUBL 1VDZA 1A0IA 1PTOF 2EYJA 2VS1A 1UNSA 1F9QA 4DR7L 4GNXB 4Y52H 3X3NA 1JICA 2CW0D 3T16A 4MNOA 1OXVA 4DR2L 4EGVA 2FJ2A 2E5LL 4X62L 5JEAH 2XN9C 3DEOA 4POGA 1S5DD 1SRUA 2DY8A 3GTQH 1FVIA 3GTQB 2J7ZA 2SEBD 3STBC 2L4NA 2H4OA 4LF4Q 1A62A 2EYFA 3D31A 3RN2A 1B3AA 2RKSA 5M5XH 4X6AH 3KF6A 5M5XB 2UU9Q 2YYZA 1HA6A 3L9AX 5I6WA 3TMEA 2VXWA 4A3BG 3I8ZA 4NKLA 3DM3A 1PA6A 1M90C 4KY7A 1KAWA 3MXGA 1SMYD 2ZM6Q 3A8IE 3HKZE 4KD4A 1BKBA 2NB0A 2EOTA 5LMNL 1M4VA 2A68D 4JI0L 2A6HC 1S5CD 3VA7A 4YHHL 4AQYL 3NQTA 4DPGA 2N3SA 5EBDA 3UE1A 1VQDA 3P1HA 1XMQL 1D1KA 2MUYA 2JJQA 2D0PA 4DV5L 5J22A 2GN5A 3JAML 3ULPA 3I4NH 1J5EQ 3I4NB 1K8OA 1F2YA 4MN3A 3HOWG 3K58A 2O2LD 1A3UA 1ENFA 3BZCA 3PO3G 4CJ0B 4JK1C 4DA2A 4IJLA 4OONA 3DLLA 1O7ZA 1U4LA 1B3QA 1EWCA 2B2WC 4B3SQ 4A93G 2J0TD 1D5ZC 1VQ6A 3V96A 3CCSA 4L5SA 1Y8NB 2PQAB 3A56A 1I4GA 1AH9A 2I5LX 3S2HH 1KDCA 5D3IB 4R4CA 5I2YA 3S2HB 5DNFA 3T1YL 5AFWA 5CGKA 1Z52A 1RD9D 3PIOA 1GUGA 3ER0A 2R93H 3OWFA 3Q23A 4IQZA 2F0EA 2R93B 1HR0W 1S4ZA 4JI6L 1MIUA 5C44H 4TQUS 5C44B 1HCZA 1VQBA 1YBYA 2AWNA 4N8X1 4C3HH 4LF6L 1Y69U 1IYVA 1GO3E 1EWHA 1FGBD 4ZLTF 4WJ4A 1BDOA 2JA5H 2LY7A 2IPKD 5M3MH 2JA5B 1QVGA 1E0BA 2Z4IA 1RTOA 5M3MB 1JMCA 4DR1L 2VQEL 2CWAA 4UAIA 4KJOA 1TWHH 2WFWA 1EZ8A 4LK1C 5LMUQ 1TWHB 4H7BA 1U0LA 2GVAA 3HG9A 2EPBA 1BOSA 3W5OA 4DR3L 1HNWL 4X3KA 2UXDQ 3A8KE 2F0DA 1XTCD 1SNDA 4FDBA 2ZJRA 3GV6A 2DNEA 4JI5L 3QJYA 3GO5A 3U4ZA 2QW7A 3MXNA 4A3MG 1KDAA 1EUJA 3MVVA 1PXUA 3TS0A 3EN2A 4JPBW 1H9JA 3W3AA 4LWCA 3PF4A 2RSNA 1F77A 2UXCL 4GLVB 1C48A 4IOAA 1Z47A 4QGUA 5GADC 2ATWA 4OIKA 1HZBA 3KF6B 3L7ZC 4IPHA 4B3MQ 2WB1G 4A3CH 1CKOA 1H9SB 4K5WA 4JCVE 3H3VH 4DV3L 2HCIA 4DAYA 4Q5VA 1SDFA 3CCEA 2FINB 2YTXA 1O7YA 2RBMA 2F0NA 1W6JA 1Q12A 2Q8IB 1PDQA 1FYCA 3DXJC 2UXBL 3QWNA 3AFPA 3E9IA 1Q3LA 1FGUA 3TBIB 4OO1G 1RCVD 4AYBE 1PHJA 5CV6A 5D65A 5COYA 4KK7A 4TKOB 1O7LA 2CH4A 2ES2A 2NVQH 2LFNA 2NVQB 4JI2L 3GTMH 2KCNA 3GTMB 4Q0FA 2LSSA 1HHVA 3FMCA 2EQSA 1KDBA 1O78A 2XWBB 5FK9C 1LTAD 2WAQG 2A69C 4EX5A 4BY7H 2TMPA 3G4NA 5FLXc 4BY7B 3MXPA 5CV7A 3TP6A 3BVMA 2A73B 3VYSA 4ZUIA 1PH6A 4YCUA 2XRQD 4HJAA 4WJWA 3W1BA 4ME3A 2OQ0A 3IRBA 5J3BA 3T4AC 1GUOA 1PH8A 4BXXH 4ZUJA 1N8RC 5CR3A 2K03A 4XQQA 4BBSG 3DWAA 1PH4A 1C7YA 1CKNA 4QUCA 5G3LD 4J15A 1EIGA 3BDCA 5JOBA 5C4XH 5IGDA 1X3QA 5C4XB 4WJ3M 1PRTB 1ESFA 2ZTCA 5IGEA 4GKJL 4DUYQ 4LFBQ 5IP9H 1HXYD 1PTOH 4LNQA 1I6HH 3G4SA 2KECA 5HGTA 1PTOB 3VR4A 2I46A 1I6HB 3MZ5A 1QJOA 2XRSD 3HKZG 1Y1VH 2F0WA 1XNRQ 1XPUA 1HPCA 1Y1VB 5HY6A 5FLMG 3HOYG 1S40A 2HQLA 2B39A 2HD3A 3P7JA 1SSOA 2JSOA 3H3VC 1IYUA 1QE6A 3OYYA 5DM63 4ME5A 3CMAA 2F3IA 1SYCA 3J7A5 4NDXA 1A15A 5JJKA 2JA8G 4R9WA 1QCBD 5IGCA 3JAME 2N8NA 3JAMi 4F7XA 3NXWA 2PPBC 3G7LA 4JYAQ 1XMOL 1I4RA 5GAHC 1FR3A 1LTBD 2N88A 3NSWA 1EY9A 4OXPA 1PYWD 3UE0A 2MO0A 5M3FH 4A3GH 3U50C 4A3GB 5M3FB 2NVTB 1CK1A 3MXNB 3MC0B 4TRDA 4YY3Q 4EQNA 4YCWA 1JC7A 3PUXA 1BXTA 1JOOA 4XT1B 3NHHA 1I3QH 3RZDH 3V05A 3ND8A 3TP5A 3DMUA 3RZDB 4X64Q 1F2LA 1LACA 3J7ZC 3SXHA 3K7UC 4FYDA 4E6IA 2VW9A 1SNCA 1NUCA 1X3EA 1WFQA 3IL8A 4KV6A 2ZJPA 2Z0SA 4DAYB 4X65Q 4NXMQ 1DCZA 4HTHA 5BR8L 3KBGA 2EVBA 1ENCA 2ZJQA 1LV9A 1ASYA 2GA4B 2K6AA 5ELCA 1EYAA 2IX3A 4OO1I 2RA4A 4X3SA 2VQFL 4DNIA 1JB3A 1RHPA 4J1MA 4IUNA 4M8AA 2E2IB 2CKZB 3U9OA 4IFDG 1VQMA 1B70B 1LTSD 2FXQA 4RGTA 3PCOB 1UE5A 5EAYA 2XNAC 3S24A 4CBVA 5C3EH 2ICEC 3CMEA 5C3EB 2QDLA 2JA7G 2O5JC 1EY7A 2IW3A 3BVGA 3OWEB 1WTVA 1SNOA 3TP8A 2FFKB 4ID6A 3KJPA 1K28A 3FPUB 5CYUA 2CH4W 4FO2A 3J7YW 4X3UA 2K01A 2B2WA 3K59A 2NN6G 1STEA 3QR8A 4DK1A 1XPOA 1MSHA 3BU2A 3H91A 1FD7D 4ABNA 5IP7H 1T5XD 4K14A 2OQKA 1BBWA 3BG3A 2VNUD 2CQOA 1N32L 1GVPA 3M4QA 4B3RL 1QB5D 3F2BA 3EFXD 4DV0Q 3PUZA 1XTDA 4JVZA 1HR0Q 4GLXA 1PH9A 1YJWA 4GS3A 1CKNB 4F87A 1Y1WH 1JOQA 4KLKA 2AUJD 5KRUA 1MI2A 3M7GA 1Y1WB 1LO5D 1A3TA 4V190 1Q1EA 1YNJD 1ICWA 4RHRA 3OW2A 4DV7L 2A6EC 5TSSA 3S2DH 5FOBB 1KAAA 3S2DB 2BE5C 2FMMA 3OTOL 5D3DA 2MPMA 2R6GA 2Z1CA 3A55A 4JI3L 5EPKA 3CXCA 1DOLA 3CF5A 4OHJA 1FNUA 4RA8A 2AHOB 1BCPD 3NK9A 2CW0C 1CQFA 1U4MA 4JI1Q 3H15A 4FXKC 4DR4L 2FHTA 3S16B 1CSQA 2PZWA 1E1OA 4F8MA 2B8GA 1VQ5A 1CZWA 1LABA 4ZCKA 1Y8OB 2A19A 2LS01 4BWGB 2JN4A 5JVH3 2F0GA 3KF8A 1WTXA 1STYA 1EIFA 2D5DA 3PO2G 2RQXA 2L0CA 4EVOA 2L11A 4A3IG 1LT5D 2XSCA 1YEZA 4A3EH 2F0MA 3QOLA 5EKIA 3UDXA 1WTRA 4A3EB 1ZYRD 2R61A 5LL6S 3TSSA 2P5ZX 1I94Q 1X55A 2KVMA 1EZ6A 2C9OA 1SMYC 1VQAA 3D4RA 3GD7A 4LW1A 2BCOA 3BJUA 2WV6D 2A68C 5BN5A 1SYGA 1V1QA 4EQ5A 1DONA 2PQAA 3KDFA 4JI8L 4A3JG 3RNUA 2D9UA 3WDNA 1LTGD 1SMXA 3SK4A 5GAEC 4JV5Q 3BVZA 3N6RA 4IFDI 3IFDA 3TZDA 2WB1E 3HOUH 1QILA 1EEFD 4A3DG 1IW7D 1UE7A 1YHQA 1SYBA 3BDOA 3HOUB 1GJXA 3G6EA 3CQZH 4P74A 1PZJD 3CCLA 3TQYA 3CQZB 3CCRA 1TS2A 3FPPA 1SE3A 1JQYD 1B7YB 2B63G 4DV6Q 4HSPA 3N52A 4R4QA 4JC0A 1RIPA 2PI2E 1SYFA 3HOZG 1LTRD 1K0SA 3IFTA 4RMFA 2JE6I 4A3KB 1E24A 2NN6I 2JA6H 1YVCA 2RF4A 1SEBD 4KD3A 2JA6B 3TDQA 2ENBA 1WI5A 2VQEQ 5C3XA 1DGSA 4QUFA 4C1NK 1PREA 4YCVA 1IL2A 4QIWB 3J80E 1LT6D 1FJGQ 5IYDH 5LL6X 4QCLA 1MJCA 2PZUA 3NWTA 2F4VL 1CQVA 1K3RA 3GTJH 4DV1L 2JQOA 2KEEA 3GTJB 1LTTD 1LT3D 1H95A 2F0QA 3E0EA 2NVYH 2WAQE 5C6AA 1A63A 2NVYB 1KD1C 1Q82C 3EVQA 4KY5A 1UEAB 3VDYA 1NCVA 3OW7A 1STNA 4A3LH 5M9OA 1EQVA 5CV9A 1J6QA 3CCQA 3BS1A 2PYKA 2Z6KC 3CPWA 4DR5L 4G7ZC 2NTTA 2RDHA 4NP5A 3SEBA 3GV3A 1S5ED 2K75A 1EU3A 5IIFA 3I2ZA 4JOIC 3ICEA 5IY0A 4A3FG 1I4QA 4FXDA 4B9WA 1R4QB 4ZRZA 1N36Q 3Q22A 1P8LA 1I4XA 3E0JA 1H9SA 2VB3X 3CP0A 2VUMH 2R7ZG 2VUMB 2PW5A 3NWSA 5C5MA 2R92G 1VS0A 3T1HQ 1NR2A 3NQIA 1B50A 3KJOA 4KMUC 3NUCA 3C2PA 3K5NA 1OTCA 1LTID 2JK8A 1ILPA 4DAPA 3I7FA 2DJFC 5L37A 1B9MA 4JI4Q 1K83H 3K5OA 3RUZA 2ASBA 2XGTA 3ULJA 1HFGA 1ASZA 3KF8B 4IN3A 3DHQA 5BN4A 4CDCC 1X32A 4C3JH 4C3JB 1GXDC 3CCJA 4N8FA 4P75A 2I0QA 4DUZQ 5IGBA 4KN4C 2CWPA 1CA5A 2K28A 4BBRH 1A6XA 4BBRB 4BBSH 3ERSX 2Z6BA 5EPJA 4BY1G 3SK6A 3OOCA 2EE1A 4RAUC 3R3OA 4P72A 3K0YA 2B2UC 2RDFA 4NXNQ 1K8AC 4IUUA 1A3VA 3KDFB 2LXJA 1JJCB 1IBKL 2M2LA 4RCOA 4P71A 2DY7A 5EBCA 3R2IA 1HNZL 3GQBA 4J8QA 1E22A 4IALA 3L3OC 5A2QL 1ONLA 3GTKH 4K0KQ 1DM0B 2O4XA 4IURA 3VR6A 2YU9H 3GTKB 1KTKA 2PMZE 1G91A 3Q8DA 3OHXC 1CFMA 3FRPB 4OEMB 4FNFA 2K14A 4AH6A 3TN2A 3GP7A 4FP5D 3HOXH 3HOXB 3FDTA 1IKMA 3M4PA 2X6LA 1PV4A 5KYIA 4C3HB 2F0VA 5CMDA 2KEDA 1Y14B 3DM1A 4DV4L 1AZPA 1G51A 3D4WA 1KIXA 1TY2A 4I65A 5BN3A 1F9PA 2SNSA 3PQIA 4LF8L 2CHBD 4JBKA 3I4MH 1SNMA 4F88A 3NTKA 1EY4A 3I4MB 2MQHA 5I2XA 4KKSA 4DNRB 1YHBA 2Z9HA 4B3TQ 4CJ2C 3S1RH 3FKIG 3S1RB 3TZUA 4K6LA 4KHZA 2QF7A 1SN8A 3MA2B 4HEDA 1E2ZA 1QNUA 1TU2B 1IXRA 4H02A 2OTJA 4DK0A 3SHLA 5LMNW 3CAMA 3I55A 4GOPC 1K8MA 1TY0A 4RCNA 3D6CA 4HN7A 4G4KA 3OSOA 5IGGA 1KRSA 5A35A 4K2KA 1QVFA 5IYCH 1WYDA 3KLWA 1IL8A 1PH2A 4C3IG 2IHFA 1HTLD 3MAQA 1GUTA 1VQGA 1JCKB 1YIJA 2HT1A 3T51B 2QILA 4CHTB 1KNAA 4TVAB 5JJZA 5T1GA 2JP1A 2ZTDA 2RVLA 4O42A 3HP3A 1JE4A 5I9OA 1PH7A 3I70A 2WACA 4XXEA 5IT9E 3Q24A 3D4DA 1C8CA 2UU9L 4L5RC 2EYMA 4OL7A 3VYUA 4ALPA 4P2CB 3BYYB 1E7ZA 2B29A 2K52A 2VQFQ 1PYSB 3U58A 2F0HA 1Y8PB 3CD6A 2B2TC 3NEMA 1HZAA 4KHPQ 1STBA 3KLRA 2EIFA 2ZM6L 1N33Q 3D6WA 4LFAQ 2NZOA 3SR1A 1HH2P 4IPGA 3GTOH 3GTOB 3RR5A 3H6MA 1TWFH 1O80A 1D8LA 4A3BH 2RCFA 1TWFB 1LLRD 4A3BB 1Q90A 4JI7Q 1UEBA 4IPDA 3TREA 1NAPA 1QUQA 1HNXQ 4YWLA 2PQEA 1N34Q 1RKNA 3PUWA 3T56B 2HHHL 1X3GA 2OEOA 4LFCQ 4DU9A 1J5EL 3A5UA 1TT2A 2PI2A 4PNYA 1VQNA 5FO9B 2ID0A 2BDOA 2K5NA 2UUAQ 3NBIA 3CC7A 3EROA 1Q81C 4C2MH 3NTIA 1RODA 3S1NH 4C2MB 1RJTA 1LUZA 1KNEA 4B3SL 1OXUA 3OIPA 2Q8TA 2WINB 5JJLA 1O7IA 1N32Q 1UE6A 3F2DA 4ZAIA 3KYHC 1K9MC 5K36G 3TEHB 5CV4A 5H1SE 3I3CA 2EZVA 1SYEA 1VQ8A 3HOWH 4DV2Q 3PO3H 3HOWB 3C46A 5CC4A 3PO3B 3A74A 1G6ZA 5ELFA 1U5KA 1TWCH 4A93H 1TWCB 4A93B 5C0XG 3HOVG 4ZYSA 1VQHA 4DR6Q 2KOLA 2CQAA 1B8AA 4MIUA 2K5VA 1VQFA 5EGTA 4GZYC 1YNND 3FHWA 2A8VA 4LF9L 3GTLH 2A5HA 2IX1A 2XVSA 1BF4A 2D2CC 2VZAA 2RCNA 1AW7A 2RHSB 2EY5A 1QVCA 2Y0SG 1CHQD 1RL2A 5IYBG 4X66L 4UY8C 3H0GG 3BDLA 4HIDA 2UUCQ 3GDEA 4FF4A 5FJ8G 4PV1C 3I73A 1YNJC 5LMUL 1I50H 2R7FA 3C1FA 3HRZC 2B2VC 2KUMA 1DXMA 1I50B 3NPPA 2IWHA 1NR4A 1VQCA 3FEWX 4L8JA 1PH3A 4RGOS 1L1OA 1JE5A 2L5TA 4GKKQ 1IYJB 1EL0A 2F52A 2CVRA 5JPMC 2Q2IA 1DOMA 3G4OA 1X54A 1I3QB 3G48A 4CDEC 2OXPA 4HR7B 1BCPC 3MFGA 1BR9A 1F2ZA 2BA1A 4QMGA 4DFAA 5A2QE 1AE3A 2N55A 2M9VA 2Z6KA 5G3LF 4QQBX 2IY5B 1WCMG 4UPAA 1QWYA 4LUOA 4YIJA 4JOIA 4PQXA 1EIHA 4QB4A 5IWAQ 3K6OA 4R8IA 1EQRA 2GVBA 4H44C 3LNNA 1G6PA 1QZHA 4A3MH 1MJEA 3K80C 3MHBA 4A3MB 4JBWA 4R8NA 4HMJA 4B3ML 2ZXRA 1EY5A 5DAUA 1B9NA 5E4XA 3UDFA 3PV0A 1JJ2A 4HIOA 1GOZA 3VYRA 4A3KG 4QJFA 4G7HC 1ZYRC 2F0IA 4JG2A 3RD4A 1SAPA 1CZGA 2G5DA 3J80c 1IBLQ 3SGIA 2WB1B 3U4VA 2RHQB 3MXUA 1JT8A 2EYLA 2L55A 1QUQB 1I5FA 1XNQL 2BH2A 5CV5A 3VYTA 4RGNA 1F9RA 3OIQA 2R7DA 1CKMA 2O5IC 3T53B 4H13C 3WOFA 4XYOA 1L0YB 3AFQA 4OO1H 2LKVA 4UP9A 2B2UA 5JEAG 1MBYA 1IW7C 1TQOA 2OCEA 1UWVA 4RGMA 2NYZD 2K5HA 2UUBQ 4OWXB 1Q8IA 1H9RA 3I90A 4MZ9A 1L2FA 2E2HH 3VA5A 4DR7Q 2MGSA 1EY6A 2E2HB 4DR2Q 1E2WA 2ICIA 1YITA 3TP7A 3RLFA 2E5LQ 1NNXA 4ZQ3A 4X62Q 4EQOA 3A0JA 2JEAI 4IZ8A 1SNPA 5C0XI 3MEHA 2KCMA 4DGZA 1G2TA 4ILWA 1TKWB 2Q2TA 1S3OA 2WAQB 4K8IA 4QL5A 3K8AA 2VY3A 4NMZA 1GD7A 3AEVA 4KKTA 4OIJA 5E1FA 4V0BA 1T9HA 1VQIA 3PUVA 4GN4B 5IE8A 3J7AV 2PZTA 1Q8KA 3W1GA 4DUYL 4DAVA 4XYQA 1HJPA 1IKLA 2CFMA 2K5WA 3HFZB 1W6KA 3QB3A 1N9WA 1AE2A 1XX8A 3A7LA 4RFBA 3ITPA 3HS0C 4KN7C
chains in the Genus database with same CATH topology
3J81L 4IUQA 4BBSB 4IFDJ 3C0OA 4S3SA 1D5MC 1G2SA 1RTNA 2BDNA 1VMCA 2SNMA 2NUCA 2RDGA 1DOKA 2F0LA 1GUNA 3HKZB 3C0MA 2K33A 3KLSX 1HA5A 1TWAB 4G57A 1HTPA 1S5BD 3HOYB 2HDLA 2Q8RE 1NSNS 1AP0A 5ELEA 3CRKC 1A2TA 5J39A 1VF5C 3OMGA 1WTPA 2IT1A 2JA8B 4FVMA 1SYDA 2J4XA 4K2LA 1XXGA 3EQLC 3DWPA 5I4DA 5EKLA 4QF4A 1DZ1A 1XYIA 4CKCA 5EJWA 3NBHA 4EQPA 1OXSC 1U4RA 1PFBA 4IUVA 1BCPF 1PRTD 1UAPA 2G9DA 1EFID 2PNRC 3HZXA 3D3RA 4BA1I 5K5PA 1PTOD 2EYOA 4C3HG 4N9PA 1Z7TA 3SK8A 2K5DA 1HRJA 3R2TA 3KBXA 1V1PA 2B2TA 4LMQD 1HFNA 4ZK9B 4XDXA 2KHSA 3S1MB 2NVXB 1WTQA 2K04A 2PMZB 2NTSA 2X69A 4DF7A 1I6VC 4OGQC 4IUTA 1PZKD 3F2UA 2F3VA 1I4HA 1HQRD 2F0JA 1QG7A 3URYA 4IUPA 2EYHA 2F4IA 2EJGC 5JVG3 3QG1A 4XIGS 4IFDH 1SJED 4L63B 3V2TA 5D14A 2KCCA 1DYQA 1PFNA 4KJNA 5ELBA 1Z6HA 1D1IA 2MJ8A 5EPLA 5KEEA 1VCIA 2JA7B 3P20A 5KGUA 2F3WA 4UDUC 1PLFA 2WP8J 4MHEA 2JEBI 3M7NA 4ZKCB 3S1QB 2NN6H 3KLSA 4BS9A 1KLUD 1HQMC 3I91A 3MWYW 2DNCA 2EY1A 1BQQT 3EA6A 1DJRD 3KK7A 1XWEA 3S15B 2HUGA 3IKJA 3RZOB 4G7OC 3SDZA 1B4OA 3PIP3 3M4YA 1V1OA 1RDPD 2B2VA 1JORA 1K83B 4B08A 2KJXA 3IAYA 2G9HD 2IJ0A 4AYBB 2QKIC 3I4LA 3DWQA 5NUCA 3LWUA 3ONAB 4C56C 3VR3A 1STAA 5E3FA 2HDMA 1R9TB 5KNBA 1X3PA 1PZID 5KIXA 5M5WB 1FNWA 1AEXA 4CKEA 5FKAC 3HEJA 1CA6A 4I7ZC 4K8JA 1IHZA 5E4WC 1JWMD 2AQ1B 2Z4HA 2YU9B 3PO2B 1V1PB 4A3IB 1QOHA 1RF2D 1BNZA 1TWGB 3CRLC 3J81E 1VMPA 1F9SA 2BOSA 2C5CA 1H9MA 2A74C 2Z8LA 1WD1A 5IOCA 1SJHD 4A3JB 1JOKA 1GHKA 1G291 4M1UB 2EJFC 2K7VA 3QO2A 4A3DB 2F1MA 1TVXA 1EU4A 2EY2A 5ELDA 3H94A 2B2YC 2B63B 5FO8B 3E6ZX 4HMIA 2K05A 2NBFA 3HOZB 1YNNC 5IGFA 5HURA 4HCSA 1D5XC 1D6EC 3HGBA 3K57A 4B9XA 1B44D 3C0NA 3SVMA 3A8JE 5KNCA 1JWSD 1OXTA 1OO9B 2A6HD 2E2JB 3LWEA 1J9OA 3P75A 2EXZA 3ZYYX 3T13A 1AZQA 3NTHA 3M3YB 3SK5A 1J8IA 4N9TA 2I07B 5LHY1 3H09A 2SDFA 4O1NA 5FLXL 1CM9A 5KYLA 3Q0AA 2FMCA 1S5FD 4ODGA 4C1NI 2F0KA 1L0XB 2K5QA 3R8BA 4A3FB 1HUMA 1Q1BA 2EY6A 2PCFB 1STHA 3VR2A 1BCPB 2R7ZB 1AN8A 3S9WA 1ILQA 3S17B 5C4JB 1WVLA 2R92B 2E2DC 1U4PA 3RMHA 3AMUA 1MSGA 3CHBD 3QIAA 4X3TA 2AQ3B 2L1BA 5KNDA 4BA2I 4PMCA 1EY0A 3CKIB 4FF3A 2WKCA 3S1NB 4Y7NB 1FNVA 2M00A 5JPNC 1WD0A 1EYCA 2E76C 1TIID 1SFOB 1R4PB 2EJMA 4ULLA 1ZXTA 1SE4A 2XWJB 3S14B 3FVQA 3A7AB 4WFN3 4BY1B 3GTPB 5CV8A 1PMRA 2QEJC 4RH6A 2IX0A 4RKBA 3GTLB 4K5XA 1M8AA 2KA7A 2K32A 4DN4M 1JWUD 1I4PA 2EYPA 3QOJA 1WTWA 4FXGC 3O13A 4DNTB 1SXTA 2L9HA 3KUPA 1KLGD 2F03A 1B1ZA 2ZXOA 1CT1D 2JYOA 3NE5B 1EOTA 2ZXPA 4U673 2VB2X 2TSSA 1BBXC 3M85A 2QCPX 1UUPA 5DM73 4FF2A 4J6HA 5FO7B 1QNKA 4CGYB 5T1IA 4DXGA 2AWOA 1BUVT 4K5VA 1ZEQX 3EJIA 4HSVA 3FKIB 1A2UA 5IODA 1KABA 1MGSA 4WORA 4TSSA 3J80L 1TS5A 2KQ3A 3K7AB 4H0LC 4PMBA 5EKKA 2PW7A 3WOEA 1CHPD 1TS3A 1ESRA 3Q6SA 2AQ2B 1V43A 3UI2A 2NWGA 5C0XJ 4K6DA 3OPOA 1SE2A 2A69D 4C3IB 3X3MA 1CI3M 1BO0A 1DD2A 5EQ0A 1E2VA 3E5SA 1T5EA 1EEID 1PRTC 4NW2A 3PUYA 1PTOC 3MFYA 3LX0A 1II3A 4HCEA 2XIWA 4ZKBB 2H1EA 1ENAA 4U68A 1GUSA 2X6GA 1EQTA 2K1BA 2NZ1D 5CORA 3GTGB 3AU7A 4FF1A 1TS4A 5FLXE 3DEPA 1VF7A 2WIIB 3C3LA 1H9KA 4RHSA 4CKBA 3U9SA 2L12A 3PIO3 2B8FA 2AUKA 5K36H 4CJ1B 2HQEA 4PMWA 4C3JG 3K5MA 2R3ZA 5F2DA 3W2DA 3SE0A 3VR5A 2RSOA 5I9PA 4XT3B 5JAVA 3R93A 4XQNA 1F2MA 2B2YA 4KHVA 2E75C 3ND9A 5C4HA 5C0XH 3HOVB 1B2TA 2F0UA 2V4DA 3BZDB 2F0OA 3AB9A 1GHJA 3M4OB 5C5LA 2D62A 2EDGA 4KI0A 4DXFA 2HCCA 3J7AF 5JEAJ 2LMCB 2Y0SB 4WRDA 2F0SA 3H0GB 1U9RA 5J1ZA 2MHVA 5CBEE 4KTAA 5C4ZA 3OMCA 4LAAA 1EY8A 3CU7A 1ET6A 3C1EA 1HUNA 2SOBA 4KKUA 2BA0A 2JXMB 1TR5A 1SBBB 1ZKOA 2F0TA 3D8GA 2QDBA 4RWSC 2MP1A 4XQJA 1OXXK 1CTMA 5M5YB 1STGA 3A54A 1V8QA 3G6JB 2IL8A 3ERQA 4LJZC 2DN8A 3BYTB 1EYDA 2ZT9C 1WCMB 2OF1A 3DUZA 3K5LA 1ML0D 1AFPA 2OT2A 5C3WA 1G8ZD 2F0PA 4XTCS 1B53A 5DEHA 4Z9CB 1MD2D 1GUWA 3I72A 3MTSA 1SNQA 3NP8A 1WTOA 4L6TB 4HAEA 1JR0D 5IT9L 2WKDA 2A6ED 2E74C 4KY6A 1LT4D 5I6YA 1D2BA 2BE5D 1C4QA 3PMFA 1PFMA 2F0FA 5CBAE 1PRTF 1ET9A 2PO4A 4RKLA 5ISRA 1VDZA 1PTOF 2EYJA 1UNSA 1F9QA 3X3NA 1JICA 2CW0D 3T16A 1OXVA 4EGVA 2FJ2A 5JEAH 2XN9C 3DEOA 1S5DD 2DY8A 3GTQB 2J7ZA 2SEBD 2L4NA 2H4OA 2EYFA 3D31A 1B3AA 2RKSA 5M5XB 2YYZA 1HA6A 3L9AX 5I6WA 3TMEA 2VXWA 3I8ZA 4NKLA 4KY7A 3MXGA 1SMYD 3A8IE 4KD4A 2NB0A 2EOTA 1M4VA 2A68D 2A6HC 1S5CD 3VA7A 3NQTA 5EBDA 3P1HA 1D1KA 2MUYA 5J22A 3JAML 3I4NB 1K8OA 1F2YA 4MN3A 3K58A 2O2LD 1A3UA 1ENFA 4CJ0B 4JK1C 4DA2A 1O7ZA 1U4LA 1EWCA 2B2WC 2J0TD 1D5ZC 3V96A 1Y8NB 3A56A 1I4GA 1KDCA 5D3IB 5I2YA 3S2HB 5DNFA 5AFWA 5CGKA 1Z52A 1RD9D 1GUGA 3OWFA 3Q23A 4IQZA 2F0EA 2R93B 1S4ZA 4TQUS 5C44B 1HCZA 2AWNA 1Y69U 1IYVA 1EWHA 1FGBD 4ZLTF 1BDOA 2LY7A 2IPKD 2JA5B 1E0BA 2Z4IA 1RTOA 5M3MB 4UAIA 4KJOA 1EZ8A 4LK1C 1TWHB 4H7BA 3HG9A 2EPBA 1BOSA 4X3KA 3A8KE 2F0DA 1XTCD 1SNDA 3GV6A 2DNEA 3QJYA 3GO5A 3MXNA 1KDAA 3MVVA 1PXUA 1H9JA 3W3AA 2RSNA 1F77A 1C48A 1Z47A 4OIKA 3L7ZC 1H9SB 4K5WA 2HCIA 4DAYA 4Q5VA 1SDFA 2FINB 1O7YA 2RBMA 2F0NA 1W6JA 1Q12A 2Q8IB 1PDQA 1FYCA 3DXJC 3QWNA 1Q3LA 3TBIB 4OO1G 1RCVD 5CV6A 5D65A 5COYA 4KK7A 4TKOB 1O7LA 2LFNA 2NVQB 2KCNA 3GTMB 4Q0FA 1HHVA 3FMCA 1KDBA 1O78A 2XWBB 5FK9C 1LTAD 2A69C 2TMPA 3G4NA 4BY7B 3MXPA 5CV7A 3TP6A 3BVMA 2A73B 3VYSA 4ZUIA 2XRQD 4WJWA 3T4AC 1GUOA 4ZUJA 5CR3A 2K03A 4XQQA 3DWAA 4QUCA 5G3LD 1EIGA 3BDCA 5JOBA 5IGDA 1X3QA 5C4XB 1PRTB 1ESFA 5IGEA 1HXYD 1PTOH 2KECA 5HGTA 1PTOB 3VR4A 2I46A 1I6HB 3MZ5A 1QJOA 2XRSD 2F0WA 1HPCA 1Y1VB 2B39A 3P7JA 1SSOA 2JSOA 3H3VC 1IYUA 1QE6A 5DM63 4ME5A 1SYCA 4NDXA 1A15A 4R9WA 1QCBD 5IGCA 3JAME 4F7XA 3NXWA 2PPBC 3G7LA 1I4RA 1FR3A 1LTBD 2N88A 3NSWA 1EY9A 1PYWD 4A3GB 5M3FB 2NVTB 1CK1A 3MC0B 4TRDA 4EQNA 1JC7A 3PUXA 1BXTA 1JOOA 4XT1B 3NHHA 3V05A 3ND8A 3TP5A 3DMUA 3RZDB 1F2LA 1LACA 3SXHA 4FYDA 4E6IA 1SNCA 1NUCA 3IL8A 4KV6A 1DCZA 4HTHA 3KBGA 2EVBA 1ENCA 1LV9A 2GA4B 2K6AA 5ELCA 1EYAA 2IX3A 4OO1I 2RA4A 4X3SA 1JB3A 1RHPA 4J1MA 4IUNA 4M8AA 2E2IB 3U9OA 4IFDG 1LTSD 4RGTA 2XNAC 4CBVA 2ICEC 5C3EB 2O5JC 1EY7A 2IW3A 3BVGA 3OWEB 1WTVA 1SNOA 3TP8A 2FFKB 4ID6A 3FPUB 5CYUA 4FO2A 3J7YW 4X3UA 2K01A 2B2WA 3K59A 2NN6G 1STEA 4DK1A 1MSHA 3H91A 1FD7D 4ABNA 1T5XD 4K14A 3BG3A 2VNUD 1QB5D 3EFXD 3PUZA 4F87A 1JOQA 2AUJD 5KRUA 1MI2A 3M7GA 1Y1WB 1LO5D 1A3TA 4V190 1Q1EA 1YNJD 1ICWA 4RHRA 2A6EC 5TSSA 5FOBB 1KAAA 3S2DB 2BE5C 2FMMA 5D3DA 2MPMA 2R6GA 2Z1CA 3A55A 5EPKA 1DOLA 4OHJA 1FNUA 4RA8A 1BCPD 2CW0C 3NK9A 1CQFA 1U4MA 4FXKC 2FHTA 3S16B 2PZWA 4F8MA 2B8GA 1CZWA 1LABA 1Y8OB 2LS01 4BWGB 5JVH3 2F0GA 3KF8A 1WTXA 1STYA 2D5DA 2RQXA 2L0CA 4EVOA 2L11A 1LT5D 2XSCA 2F0MA 3QOLA 5EKIA 1WTRA 4A3EB 1ZYRD 2R61A 5LL6S 3TSSA 2KVMA 1EZ6A 2C9OA 1SMYC 3D4RA 3GD7A 2BCOA 2WV6D 2A68C 5BN5A 1SYGA 1DONA 2D9UA 3WDNA 1LTGD 3SK4A 3BVZA 3N6RA 4IFDI 3IFDA 3TZDA 1QILA 1EEFD 1IW7D 1SYBA 3BDOA 3HOUB 1GJXA 1PZJD 3CQZB 1TS2A 3FPPA 1SE3A 1JQYD 4HSPA 3N52A 1SYFA 1LTRD 3IFTA 2JE6I 4A3KB 2NN6I 1SEBD 4KD3A 2JA6B 3TDQA 2ENBA 5C3XA 4QUFA 4C1NK 1PREA 4QIWB 3J80E 1LT6D 5LL6X 4QCLA 2PZUA 3NWTA 1CQVA 2KEEA 3GTJB 1LTTD 1LT3D 2F0QA 5C6AA 2NVYB 3EVQA 4KY5A 1UEAB 1NCVA 3OW7A 1STNA 5M9OA 1EQVA 5CV9A 3BS1A 2PYKA 4G7ZC 2NTTA 2RDHA 3SEBA 4NP5A 3GV3A 1S5ED 1EU3A 5IIFA 1I4QA 4FXDA 4B9WA 1R4QB 4ZRZA 3Q22A 1I4XA 3E0JA 1H9SA 2VB3X 2VUMB 2PW5A 3NWSA 5C5MA 1NR2A 3NQIA 1B50A 4KMUC 3NUCA 3C2PA 3K5NA 1LTID 1ILPA 4DAPA 1B9MA 3K5OA 3RUZA 1HFGA 4IN3A 3DHQA 5BN4A 1X32A 4C3JB 1GXDC 5IGBA 4KN4C 1CA5A 2K28A 1A6XA 4BBRB 5EPJA 3SK6A 3OOCA 2EE1A 4RAUC 3R3OA 3K0YA 2B2UC 2RDFA 4IUUA 1A3VA 2M2LA 4RCOA 2DY7A 5EBCA 3R2IA 3GQBA 4J8QA 4IALA 3L3OC 5A2QL 1ONLA 1DM0B 2O4XA 4IURA 3VR6A 3GTKB 1KTKA 1G91A 3OHXC 1CFMA 3FRPB 4FNFA 3TN2A 3GP7A 4FP5D 3HOXB 3FDTA 1IKMA 2X6LA 5KYIA 4C3HB 2F0VA 5CMDA 2KEDA 3DM1A 1AZPA 3D4WA 1TY2A 4I65A 5BN3A 1F9PA 2SNSA 2CHBD 1SNMA 4F88A 3NTKA 1EY4A 3I4MB 5I2XA 4KKSA 4DNRB 4CJ2C 3S1RB 3TZUA 4K6LA 4KHZA 2QF7A 3MA2B 4HEDA 1E2ZA 1QNUA 1TU2B 4DK0A 3SHLA 1K8MA 1TY0A 4RCNA 3D6CA 4HN7A 4G4KA 3OSOA 5IGGA 5A35A 4K2KA 1IL8A 4C3IG 1HTLD 3MAQA 1GUTA 1JCKB 3T51B 2QILA 4CHTB 1KNAA 5JJZA 5T1GA 2JP1A 2RVLA 4O42A 3HP3A 5I9OA 1JE4A 3I70A 2WACA 4XXEA 5IT9E 3Q24A 3D4DA 1C8CA 2EYMA 4OL7A 3VYUA 4P2CB 3BYYB 2F0HA 1Y8PB 2B2TC 1STBA 3KLRA 3D6WA 3SR1A 3GTOB 3H6MA 1O80A 1TWFB 1LLRD 4A3BB 1Q90A 1NAPA 2PQEA 1RKNA 3PUWA 3T56B 2OEOA 4DU9A 1TT2A 4PNYA 5FO9B 2ID0A 2BDOA 3NBIA 3EROA 3NTIA 1RODA 4C2MB 1RJTA 1KNEA 1OXUA 3OIPA 2Q8TA 2WINB 4ZAIA 5K36G 5CV4A 3I3CA 2EZVA 1SYEA 3HOWB 3C46A 5CC4A 3PO3B 1G6ZA 5ELFA 1TWCB 4A93B 5C0XG 4ZYSA 2KOLA 2CQAA 4MIUA 5EGTA 4GZYC 1YNND 2A5HA 2IX1A 2XVSA 1BF4A 2D2CC 1AW7A 2EY5A 1CHQD 3BDLA 4FF4A 4PV1C 3I73A 1YNJC 3HRZC 3C1FA 2B2VC 2KUMA 1DXMA 1I50B 3NPPA 2IWHA 1NR4A 3FEWX 4L8JA 4RGOS 2L5TA 1EL0A 2CVRA 5JPMC 1DOMA 3G4OA 1I3QB 2OXPA 4HR7B 1BCPC 3MFGA 1BR9A 1F2ZA 2BA1A 4QMGA 4DFAA 5A2QE 2N55A 2M9VA 5G3LF 1QWYA 4YIJA 4PQXA 1EIHA 4QB4A 3K6OA 4R8IA 4H44C 3LNNA 3MHBA 4A3MB 4JBWA 4R8NA 4HMJA 2ZXRA 1EY5A 5DAUA 1B9NA 5E4XA 3PV0A 1GOZA 3VYRA 4G7HC 1ZYRC 2F0IA 3RD4A 1SAPA 1CZGA 2WB1B 3MXUA 2EYLA 2L55A 5CV5A 3VYTA 4RGNA 1F9RA 3OIQA 2O5IC 3T53B 4H13C 3WOFA 4XYOA 1L0YB 4OO1H 2LKVA 2B2UA 5JEAG 1MBYA 1IW7C 1TQOA 4RGMA 2NYZD 1Q8IA 1H9RA 3I90A 3VA5A 2MGSA 1EY6A 2E2HB 1E2WA 2ICIA 3TP7A 3RLFA 4ZQ3A 4EQOA 2JEAI 4IZ8A 1SNPA 5C0XI 3MEHA 4DGZA 1G2TA 4ILWA 1TKWB 2WAQB 4K8IA 4NMZA 4KKTA 4OIJA 5E1FA 4V0BA 3PUVA 3J7AV 2PZTA 4DAVA 4XYQA 1IKLA 2K5WA 3QB3A 1W6KA 1XX8A 3A7LA 4RFBA 3ITPA 3HS0C 4KN7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGT A;  2AQ1 B;  4L63 B;  2XNA C;  2TSS A;  1PRT B;  1ESF A;  1I4Q A;  1DYQ A;  2R61 A;  2CHB D;  3C0O A;  1S5F D;  1HXY D;  1PTO H;  3TSS A;  1D5M C;  1I4X A;  1V1P B;  5ELB A;  1PTO B;  1G8Z D;  3BVG A;  3OWE B;  2XRS D;  1UUP A;  1L0X B;  3R8B A;  1RF2 D;  4Z9C B;  1F77 A;  1TS4 A;  1MD2 D;  1BCP B;  4UDU C;  1AN8 A;  2RDG A;  2WV6 D;  4DXG A;  3C0M A;  4K6L A;  1GOZ A;  3KLS X;  4RHS A;  2O2L D;  1ENF A;  1HA5 A;  1STE A;  4L6T B;  1S5B D;  1JR0 D;  2Z8L A;  1LTI D;  1LTG D;  1FD7 D;  1EWC A;  1T5X D;  3CHB D;  5ELE A;  4TSS A;  1LT4 D;  3BVZ A;  1SJH D;  1TS5 A;  1I4R A;  1TY0 A;  1D5Z C;  1LTB D;  5ELF A;  1QIL A;  1EEF D;  2AQ3 B;  3EFX D;  1PYW D;  3W2D A;  2J4X A;  1KLU D;  1XXG A;  3DWP A;  1PZJ D;  4ZYS A;  1I4G A;  5I4D A;  1CHP D;  5D3I B;  1CK1 A;  1PRT F;  1ET9 A;  1TS3 A;  1TS2 A;  1SE3 A;  1JQY D;  3MC0 B;  1FNV A;  4RGN A;  1LO5 D;  2AQ2 B;  3EA6 A;  1DJR D;  1RCV D;  1EU4 A;  4RHR A;  1PTO F;  1Z52 A;  1BXT A;  1UNS A;  5TSS A;  1RD9 D;  1HTL D;  3BZD B;  5ELD A;  1L0Y B;  1JCK B;  1AW7 A;  3V05 A;  1LTR D;  1BCP F;  1PRT D;  1SE4 A;  2QIL A;  1EFI D;  1SE2 A;  5D3D A;  1SJE D;  1CHQ D;  4RGM A;  1PTO D;  1V1O A;  1RDP D;  4DXF A;  1SEB D;  2XN9 C;  1S5D D;  4OHJ A;  1FNU A;  1BCP D;  3R2T A;  2G9H D;  2IJ0 A;  1V1P A;  5FK9 C;  2ICI A;  4RCO A;  2SEB D;  2QEJ C;  1D5X C;  1FGB D;  4RH6 A;  1D6E C;  1LTA D;  1PRE A;  1EEI D;  3BYY B;  3R2I A;  1LT6 D;  2IPK D;  1PRT C;  3DWQ A;  4RGO S;  1B44 D;  1ET6 A;  1CQV A;  3G4N A;  3C0N A;  2NTS A;  1PTO C;  1KTK A;  5ELC A;  1JWS D;  1LTT D;  1LT3 D;  3BVM A;  3G4O A;  4C56 C;  1SBB B;  1BCP C;  1PZI D;  1PZK D;  3MFG A;  2XRQ D;  1JWU D;  1I4P A;  1I4H A;  3GP7 A;  1FNW A;  1HQR D;  4BWG B;  3URY A;  3O13 A;  1XTC D;  1SXT A;  1TY2 A;  5FKA C;  1LLR D;  1KLG D;  3BYT B;  1B1Z A;  2NTT A;  2RDH A;  3DWA A;  1CT1 D;  3SEB A;  1S5E D;  4RFB A;  1EU3 A;  1M4V A;  1LTS D;  1S5C D;  4O1N A;  1JWM D;  1LT5 D; 
#chains in the Genus database with same CATH topology
 3J81 L;  1VQJ A;  4IUQ A;  4BBS B;  4OX9 L;  4IFD J;  3C0O A;  4S3S A;  1D5M C;  5AJ3 L;  5ELN A;  3F1Z A;  1G2S A;  3I4N G;  1RTN A;  1TXY A;  5LMN Q;  2BDN A;  1VMC A;  1L1O B;  3F2C A;  2SNM A;  4JI0 Q;  2NUC A;  4JYA L;  2RDG A;  1DOK A;  2F0L A;  4YHH Q;  1GUN A;  3HKZ B;  3C0M A;  4AQY Q;  1TWA H;  2K33 A;  3KLS X;  1HA5 A;  5FLM H;  1TWA B;  4G57 A;  3CW2 C;  4OEL B;  2OTL A;  3HOY H;  2Q2U A;  1HTP A;  1XMQ Q;  4GOP A;  1S5B D;  3HOY B;  2HDL A;  2Q8R E;  1NSN S;  3D0F A;  3EIV A;  3ZJY C;  1AP0 A;  4DV5 Q;  5ELE A;  4PG3 A;  3CRK C;  1A2T A;  3L0O A;  3E9H A;  5J39 A;  4YY3 L;  1PH1 A;  1EYG A;  2JA8 H;  1VF5 C;  3OMG A;  1WTP A;  2H5X A;  2IT1 A;  2JA8 B;  4FVM A;  1SYD A;  3G71 A;  2J4X A;  4K2L A;  1XXG A;  3EQL C;  3DWP A;  4A76 A;  5I4D A;  4X64 L;  2YTY A;  4DKA C;  5EKL A;  4QF4 A;  1DZ1 A;  3UDI A;  1XYI A;  1IBM L;  2R93 G;  4CKC A;  4CDD C;  5EJW A;  3A5Z B;  3NBH A;  4EQP A;  1OXS C;  1U4R A;  5ELO A;  1PFB A;  4IUV A;  1BCP F;  1MKH A;  1PRT D;  1UAP A;  3ULL A;  2G9D A;  1EFI D;  2PNR C;  4UP7 A;  5C44 G;  4LUZ A;  3HZX A;  3D3R A;  4X65 L;  4NXM L;  4BA1 I;  5K5P A;  1XPR A;  1PTO D;  4UP8 A;  2EYO A;  2DUD A;  4C3H G;  4N9P A;  1Z7T A;  3SK8 A;  3T1Y Q;  1X65 A;  2K5D A;  2JA5 G;  1HRJ A;  3R2T A;  3KBX A;  1KHI A;  1WTH A;  5M3M G;  1V1P A;  2B2T A;  4LMQ D;  1HFN A;  4ZK9 B;  3S1M H;  2NVX H;  3CPF A;  4XDX A;  4R4I A;  2KHS A;  3S1M B;  4JI6 Q;  2NVX B;  4O2D A;  1WTQ A;  2K04 A;  2PMZ B;  2NTS A;  3B6Y A;  4YWK A;  2X69 A;  2KEN A;  1SE8 A;  4DF7 A;  1I6V C;  4LF5 L;  4LF6 Q;  4OGQ C;  4IUT A;  1YHA A;  1PZK D;  3F2U A;  2F3V A;  1I4H A;  1HQR D;  2F0J A;  4QY7 A;  1QG7 A;  4DR1 Q;  3URY A;  2DJG C;  4IUP A;  5GAG C;  2EYH A;  2F4I A;  1YNX A;  4LF8 Q;  2EJG C;  5JVG 3;  1BVS A;  3QG1 A;  4IOC A;  1PVO A;  4XIG S;  4R4O A;  4DR3 Q;  1HNW Q;  3PGZ A;  4IFD H;  4R1J A;  1SJE D;  4L63 B;  3V2T A;  1SRO A;  3K0X A;  4HJ5 A;  5D14 A;  2KCC A;  1DYQ A;  1PFN A;  3AYH B;  1L1O C;  4KJN A;  1Q7Y C;  4JI5 Q;  5ELB A;  1Z6H A;  1D1I A;  2MJ8 A;  5EPL A;  2JA7 H;  5KEE A;  1VCI A;  3HKS A;  2JA7 B;  3P20 A;  5KGU A;  2F3W A;  4UDU C;  1PLF A;  4APV A;  4A3C G;  4GLA C;  2HIX A;  2WP8 J;  4MHE A;  1W2B A;  3KOJ A;  2JEB I;  4DV0 L;  3M7N A;  3S1Q H;  4ZKC B;  1HR0 L;  5IT9 c;  3S1Q B;  1C0A A;  2NN6 H;  3KLS A;  3FP9 A;  2UXC Q;  2N78 A;  4LF7 L;  1WJJ A;  4BS9 A;  2NZH A;  1X56 A;  1KLU D;  1HQM C;  1FL0 A;  2C35 B;  3I91 A;  3MWY W;  4DV3 Q;  1PH5 A;  3WWV A;  2DNC A;  2EY1 A;  3S15 H;  3RZO H;  1BQQ T;  2KHI A;  3E3X A;  1DJR D;  3EA6 A;  3KK7 A;  1XWE A;  3S15 B;  2HUG A;  3IKJ A;  3RZO B;  3NEN A;  4PZ8 A;  1S72 A;  4G7O C;  3SDZ A;  2UXB Q;  1VQ9 A;  4JI1 L;  1B4O A;  3PIP 3;  3M4Y A;  5HGQ A;  1V1O A;  1RDP D;  1A8V A;  2B2V A;  2I5H A;  1JOR A;  1K83 B;  4B08 A;  2KJX A;  3IAY A;  2G9H D;  2KCT A;  2IJ0 A;  4IJH A;  1ICF B;  2Y0S E;  4GOP B;  4BY7 G;  3EBE A;  1X6O A;  4AYB B;  2QKI C;  3I4L A;  4JI2 Q;  1YZ6 A;  3DWQ A;  3CC2 A;  5NUC A;  1SR3 A;  3LWU A;  3ONA B;  2YV5 A;  1R9T H;  4C56 C;  3VR3 A;  1STA A;  5E3F A;  2HDM A;  1YI2 A;  1R9T B;  1WOC A;  1BBU A;  1X3P A;  1PZI D;  5KNB A;  5M5W H;  1GKH A;  1CUK A;  5KIX A;  1K8G A;  4BXX G;  1K0R A;  5M5W B;  1FNW A;  2HHH Q;  1AEX A;  2N49 A;  4CKE A;  5FKA C;  3NBH B;  3HEJ A;  1CA6 A;  1I94 L;  4I7Z C;  5C4X G;  4K8J A;  1IHZ A;  5E4W C;  4JBM A;  5IP9 G;  1JWM D;  2AQ1 B;  3PO2 H;  2Z4H A;  2YU9 B;  1Y1V G;  3PO2 B;  4A3I H;  4O0A A;  1PFS A;  1V1P B;  4A3I B;  1QOH A;  1TWG H;  1RF2 D;  1BNZ A;  1TWG B;  4JV5 L;  4GNX C;  3BZK A;  3CRL C;  3J81 E;  3JAM c;  3J81 i;  1VMP A;  1F9S A;  4GKJ Q;  1NMF A;  2VL6 A;  3L2P A;  3PSI A;  2BOS A;  2C5C A;  1H9M A;  2A74 C;  2Z8L A;  1WD1 A;  4A3J H;  5IOC A;  4DV6 L;  1SJH D;  3CCV A;  1JOK A;  5M3F G;  4A3J B;  4A3G G;  1V9P A;  1GHK A;  4LF9 Q;  1G29 1;  5JJI A;  1IZ6 A;  1C9O A;  4M1U B;  4A3D H;  2K50 A;  2EJF C;  2K7V A;  3QO2 A;  4A3D B;  4X66 Q;  2F1M A;  1TVX A;  1EU4 A;  2EY2 A;  4IPC A;  4QIW E;  1XMO Q;  2B63 H;  5ELD A;  3H94 A;  2B2Y C;  2B63 B;  1VQO A;  5FO8 B;  3STB D;  3CCM A;  3H3V I;  3UDG A;  1FJG L;  3HOZ H;  3E6Z X;  4HMI A;  1VQP A;  2K05 A;  2NBF A;  3HOZ B;  2PNH A;  1YNN C;  5IGF A;  5HUR A;  2QA4 A;  4HCS A;  1D5X C;  1D6E C;  2AKW B;  3HGB A;  3K57 A;  4B9X A;  4LUV A;  1B44 D;  5GQO A;  3C0N A;  3SVM A;  3A8J E;  5KNC A;  1Q46 A;  1JWS D;  1OXT A;  1OO9 B;  2A6H D;  1UE1 A;  4LF4 L;  4GN3 B;  4PZ7 A;  2E2J H;  5BR8 Q;  4PZ6 A;  2E2J B;  3LWE A;  4RG1 A;  1J9O A;  3P75 A;  1N36 L;  3M3Y H;  4L5T A;  2EXZ A;  3ZYY X;  3T13 A;  1AZQ A;  3NTH A;  3M3Y B;  3SK5 A;  1J8I A;  4HIM A;  5C3E G;  4N9T A;  1KQS A;  2I07 B;  3T1H L;  5LHY 1;  3H09 A;  2SDF A;  4O1N A;  5FLX L;  1CM9 A;  5KYL A;  3Q0A A;  2FMC A;  2LXK A;  1S5F D;  4ODG A;  4A3F H;  4JW0 A;  2F0K A;  1L0X B;  2K5Q A;  2KHJ A;  3R8B A;  4C1N I;  3PF5 A;  4A3F B;  1HUM A;  1Q1B A;  2EY6 A;  1W3S A;  2PCF B;  1STH A;  2EXD A;  3VR2 A;  2R7Z H;  1BCP B;  4JI4 L;  2R7Z B;  1AN8 A;  3S9W A;  5C4J H;  1ILQ A;  1E1T A;  2R92 H;  3S17 H;  3S17 B;  5C4J B;  1WVL A;  2R92 B;  1Z9F A;  4DAM A;  5IP7 G;  2E2D C;  1U4P A;  3RMH A;  2BH8 A;  3AMU A;  1M1K C;  1KRT A;  1MSG A;  4POF A;  1XNQ Q;  4DUZ L;  3CHB D;  3QIA A;  4DK3 C;  4DK6 C;  1EQQ A;  4X3T A;  2AQ3 B;  2L1B A;  1Y1W G;  5KND A;  4BA2 I;  4PMC A;  1EY0 A;  4Y7N H;  2CCZ A;  3CKI B;  5DLQ E;  4FF3 A;  3RLO A;  2WKC A;  3S1N B;  4Y7N B;  1SFO H;  1FNV A;  2M00 A;  4GN5 A;  5JPN C;  1WD0 A;  1EYC A;  2E76 C;  1TII D;  1SFO B;  1R4P B;  4B3R Q;  4NXN L;  2EJM A;  4ULL A;  1ZXT A;  2ZTE A;  1X3F A;  1SE4 A;  3S14 H;  2XWJ B;  3S14 B;  1VQK A;  2QEX A;  3FVQ A;  4BY1 H;  4K0K L;  4DV7 Q;  3A7A B;  4WFN 3;  4BY1 B;  2AMC B;  3GTP H;  3GTP B;  5CV8 A;  1PMR A;  1NTG A;  2QEJ C;  4RH6 A;  3OTO Q;  1KL9 A;  1VQ7 A;  4JI3 Q;  2IX0 A;  4RKB A;  3GTL B;  2YTV A;  2Q2H A;  4K5X A;  3PIP A;  1M8A A;  1CSP A;  2KA7 A;  2K32 A;  4DN4 M;  1JWU D;  1I4P A;  2EYP A;  3QOJ A;  1WTW A;  4FXG C;  1P16 A;  1HZ9 A;  4DR4 Q;  3O13 A;  5GRO A;  4DNT B;  1SXT A;  1LYL A;  4OX9 Q;  2L9H A;  3KUP A;  1KLG D;  2F03 A;  1B1Z A;  2ZXO A;  5AJ3 Q;  1CT1 D;  2JYO A;  3NE5 B;  1EOT A;  4A3E G;  2UXD L;  2ZXP A;  4HJ7 A;  4B3T L;  4U67 3;  2VB2 X;  2TSS A;  1BBX C;  3M85 A;  4UHV A;  4MTK A;  2QCP X;  1UUP A;  2NVT H;  5DM7 3;  4FF2 A;  4J6H A;  5FO7 B;  1QNK A;  4CGY B;  5T1I A;  4DXG A;  2AWO A;  1LM0 A;  1EIY B;  1BUV T;  4K5V A;  2KBN A;  1ZEQ X;  1JJG A;  3EJI A;  3FKI H;  4HSV A;  3FKI B;  5E7N A;  1A2U A;  5IOD A;  4YWM A;  1KAB A;  1MGS A;  3HOU G;  4WOR A;  2I5M X;  4TSS A;  3K7A H;  4JBJ A;  3J80 L;  1TS5 A;  2KQ3 A;  4OWT B;  3K7A B;  3CCU A;  4L5Q A;  1IBM Q;  3RN5 A;  4H0L C;  4PMB A;  5EKK A;  4R4T A;  4JI8 Q;  2PW7 A;  1VQ4 A;  3WOE A;  1CHP D;  1TS3 A;  1ESR A;  3Q6S A;  2AQ2 B;  1V43 A;  3UI2 A;  2NWG A;  5C0X J;  1D7Q A;  4K6D A;  2E8G A;  2MFI A;  4C3I H;  2JA6 G;  1L0W A;  3OPO A;  1SE2 A;  2A69 D;  4C3I B;  3I56 A;  3X3M A;  1CI3 M;  1BO0 A;  3MEF A;  1DD2 A;  2E2I H;  2L15 A;  5EQ0 A;  1E2V A;  3E5S A;  4KHP L;  3LGJ A;  5IYD G;  4LF5 Q;  1T5E A;  1N33 L;  1K73 C;  4LFA L;  1EEI D;  4IO9 A;  1PRT C;  2IHE A;  3JC6 6;  1NY4 A;  4NW2 A;  3PUY A;  1PTO C;  3MFY A;  3LX0 A;  1II3 A;  4JI7 L;  1MHW C;  1EOV A;  4HCE A;  3CC4 A;  3I4O A;  2XIW A;  3KFU A;  1HNX L;  4A3L G;  4ZKB B;  1YJ9 A;  2H1E A;  1N34 L;  4P73 A;  4LFC L;  1ENA A;  4U68 A;  2F4V Q;  1GUS A;  3NEL A;  4DV1 Q;  2X6G A;  1EQT A;  3TS2 A;  2UUA L;  1E3P A;  1EWI A;  2K1B A;  2NZ1 D;  5COR A;  2VUM G;  1EFW A;  4GNX A;  3GTG H;  3M9B A;  3GTG B;  4DR5 Q;  3AU7 A;  4DV2 L;  4FF1 A;  1TS4 A;  5FLX E;  3DEP A;  4HIK A;  4LFB L;  1VF7 A;  2WII B;  4LF7 Q;  3C3L A;  1H9K A;  4RHS A;  1NBW A;  4CKB A;  3U9S A;  1JB7 A;  2L12 A;  1XNR L;  3PIO 3;  2B8F A;  2AUK A;  4DR6 L;  5K36 H;  4CJ1 B;  2HQE A;  1LTL A;  4PMW A;  3K81 C;  4C3J G;  3K5M A;  2HIV A;  2JA9 A;  2R3Z A;  2D0O A;  4AYB G;  5F2D A;  3W2D A;  3SE0 A;  3VR5 A;  2RSO A;  1PYB A;  5I9P A;  4XT3 B;  5JAV A;  3R93 A;  4XQN A;  1Q86 C;  1F2M A;  2B2Y A;  4KHV A;  4BBR G;  2E75 C;  3ND9 A;  5C4H A;  2UUC L;  3AQQ A;  5C0X H;  3HOV H;  3HOV B;  1B2T A;  3S16 H;  2F0U A;  2V4D A;  4NPS A;  2B3G A;  3BZD B;  3M4O H;  2F0O A;  3AB9 A;  1GHJ A;  3M4O B;  5C5L A;  1K3B C;  2D62 A;  2EDG A;  1VQE A;  4KI0 A;  4GKK L;  4DXF A;  2HCC A;  3J7A F;  5IYB H;  3H0G H;  2LMC B;  2Y0S B;  5JEA J;  4WRD A;  2F0S A;  3H0G B;  1U9R A;  5J1Z A;  5FJ8 H;  2MHV A;  4CDF C;  5CBE E;  1KXL A;  4KTA A;  5C4Z A;  3OMC A;  4LAA A;  1EY8 A;  3CU7 A;  1ET6 A;  1NJI C;  1X9N A;  2OWO A;  3J81 c;  3C1E A;  4A75 A;  1HUN A;  2SOB A;  4KKU A;  2BA0 A;  3F8T A;  1TR5 A;  2JXM B;  1IBK Q;  1SBB B;  1ZKO A;  2F0T A;  5IWA L;  1YJN A;  3HOX G;  3D8G A;  4HJ9 A;  1HNZ Q;  2QDB A;  4RWS C;  2MP1 A;  5M5Y H;  2K4K A;  4XQJ A;  3TRZ A;  4I7A A;  1OXX K;  1CTM A;  5M5Y B;  1STG A;  3A54 A;  4MTN A;  1V8Q A;  2DGY A;  3G6J B;  2IL8 A;  3ERQ A;  4LJZ C;  2DN8 A;  1WCM H;  3BYT B;  1EYD A;  2ZT9 C;  1WCM B;  1HZC A;  2OF1 A;  1KC8 C;  4OWW B;  3I4M G;  1NE3 A;  3DUZ A;  3K5L A;  1ML0 D;  1AFP A;  2OT2 A;  2XTI A;  5C3W A;  1G8Z D;  4A4I A;  2QGQ A;  4NB3 A;  4DV4 Q;  2F0P A;  4XTC S;  1B53 A;  5DEH A;  4Z9C B;  1MD2 D;  1GM5 A;  1IBL L;  3J81 j;  1GUW A;  3I72 A;  3MTS A;  1SNQ A;  2MO1 A;  3NP8 A;  1WTO A;  2V1C C;  2ALY B;  4L6T B;  4HAE A;  1JR0 D;  5IT9 L;  4A3K H;  1QZG A;  2WKD A;  2A1A A;  2A6E D;  2E74 C;  4KY6 A;  2MNA A;  1LT4 D;  5I6Y A;  1NMG A;  1D2B A;  2BE5 D;  1C4Q A;  3PMF A;  4AIM A;  5IYC G;  1XJV A;  1PFM A;  2F0F A;  5CBA E;  1SLJ A;  1PRT F;  1VQL A;  1ET9 A;  2PO4 A;  4RKL A;  5ISR A;  4HJ8 A;  3J80 i;  3RLN A;  2UUB L;  1VDZ A;  1A0I A;  1PTO F;  2EYJ A;  2VS1 A;  1UNS A;  1F9Q A;  4DR7 L;  4GNX B;  4Y52 H;  3X3N A;  1JIC A;  2CW0 D;  3T16 A;  4MNO A;  1OXV A;  4DR2 L;  4EGV A;  2FJ2 A;  2E5L L;  4X62 L;  5JEA H;  2XN9 C;  3DEO A;  4POG A;  1S5D D;  1SRU A;  2DY8 A;  3GTQ H;  1FVI A;  3GTQ B;  2J7Z A;  2SEB D;  3STB C;  2L4N A;  2H4O A;  4LF4 Q;  1A62 A;  2EYF A;  3D31 A;  3RN2 A;  1B3A A;  2RKS A;  5M5X H;  4X6A H;  3KF6 A;  5M5X B;  2UU9 Q;  2YYZ A;  1HA6 A;  3L9A X;  5I6W A;  3TME A;  2VXW A;  4A3B G;  3I8Z A;  4NKL A;  3DM3 A;  1PA6 A;  1M90 C;  4KY7 A;  1KAW A;  3MXG A;  1SMY D;  2ZM6 Q;  3A8I E;  3HKZ E;  4KD4 A;  1BKB A;  2NB0 A;  2EOT A;  5LMN L;  1M4V A;  2A68 D;  4JI0 L;  2A6H C;  1S5C D;  3VA7 A;  4YHH L;  4AQY L;  3NQT A;  4DPG A;  2N3S A;  5EBD A;  3UE1 A;  1VQD A;  3P1H A;  1XMQ L;  1D1K A;  2MUY A;  2JJQ A;  2D0P A;  4DV5 L;  5J22 A;  2GN5 A;  3JAM L;  3ULP A;  3I4N H;  1J5E Q;  3I4N B;  1K8O A;  1F2Y A;  4MN3 A;  3HOW G;  3K58 A;  2O2L D;  1A3U A;  1ENF A;  3BZC A;  3PO3 G;  4CJ0 B;  4JK1 C;  4DA2 A;  4IJL A;  4OON A;  3DLL A;  1O7Z A;  1U4L A;  1B3Q A;  1EWC A;  2B2W C;  4B3S Q;  4A93 G;  2J0T D;  1D5Z C;  1VQ6 A;  3V96 A;  3CCS A;  4L5S A;  1Y8N B;  2PQA B;  3A56 A;  1I4G A;  1AH9 A;  2I5L X;  3S2H H;  1KDC A;  5D3I B;  4R4C A;  5I2Y A;  3S2H B;  5DNF A;  3T1Y L;  5AFW A;  5CGK A;  1Z52 A;  1RD9 D;  3PIO A;  1GUG A;  3ER0 A;  2R93 H;  3OWF A;  3Q23 A;  4IQZ A;  2F0E A;  2R93 B;  1HR0 W;  1S4Z A;  4JI6 L;  1MIU A;  5C44 H;  4TQU S;  5C44 B;  1HCZ A;  1VQB A;  1YBY A;  2AWN A;  4N8X 1;  4C3H H;  4LF6 L;  1Y69 U;  1IYV A;  1GO3 E;  1EWH A;  1FGB D;  4ZLT F;  4WJ4 A;  1BDO A;  2JA5 H;  2LY7 A;  2IPK D;  5M3M H;  2JA5 B;  1QVG A;  1E0B A;  2Z4I A;  1RTO A;  5M3M B;  1JMC A;  4DR1 L;  2VQE L;  2CWA A;  4UAI A;  4KJO A;  1TWH H;  2WFW A;  1EZ8 A;  4LK1 C;  5LMU Q;  1TWH B;  4H7B A;  1U0L A;  2GVA A;  3HG9 A;  2EPB A;  1BOS A;  3W5O A;  4DR3 L;  1HNW L;  4X3K A;  2UXD Q;  3A8K E;  2F0D A;  1XTC D;  1SND A;  4FDB A;  2ZJR A;  3GV6 A;  2DNE A;  4JI5 L;  3QJY A;  3GO5 A;  3U4Z A;  2QW7 A;  3MXN A;  4A3M G;  1KDA A;  1EUJ A;  3MVV A;  1PXU A;  3TS0 A;  3EN2 A;  4JPB W;  1H9J A;  3W3A A;  4LWC A;  3PF4 A;  2RSN A;  1F77 A;  2UXC L;  4GLV B;  1C48 A;  4IOA A;  1Z47 A;  4QGU A;  5GAD C;  2ATW A;  4OIK A;  1HZB A;  3KF6 B;  3L7Z C;  4IPH A;  4B3M Q;  2WB1 G;  4A3C H;  1CKO A;  1H9S B;  4K5W A;  4JCV E;  3H3V H;  4DV3 L;  2HCI A;  4DAY A;  4Q5V A;  1SDF A;  3CCE A;  2FIN B;  2YTX A;  1O7Y A;  2RBM A;  2F0N A;  1W6J A;  1Q12 A;  2Q8I B;  1PDQ A;  1FYC A;  3DXJ C;  2UXB L;  3QWN A;  3AFP A;  3E9I A;  1Q3L A;  1FGU A;  3TBI B;  4OO1 G;  1RCV D;  4AYB E;  1PHJ A;  5CV6 A;  5D65 A;  5COY A;  4KK7 A;  4TKO B;  1O7L A;  2CH4 A;  2ES2 A;  2NVQ H;  2LFN A;  2NVQ B;  4JI2 L;  3GTM H;  2KCN A;  3GTM B;  4Q0F A;  2LSS A;  1HHV A;  3FMC A;  2EQS A;  1KDB A;  1O78 A;  2XWB B;  5FK9 C;  1LTA D;  2WAQ G;  2A69 C;  4EX5 A;  4BY7 H;  2TMP A;  3G4N A;  5FLX c;  4BY7 B;  3MXP A;  5CV7 A;  3TP6 A;  3BVM A;  2A73 B;  3VYS A;  4ZUI A;  1PH6 A;  4YCU A;  2XRQ D;  4HJA A;  4WJW A;  3W1B A;  4ME3 A;  2OQ0 A;  3IRB A;  5J3B A;  3T4A C;  1GUO A;  1PH8 A;  4BXX H;  4ZUJ A;  1N8R C;  5CR3 A;  2K03 A;  4XQQ A;  4BBS G;  3DWA A;  1PH4 A;  1C7Y A;  1CKN A;  4QUC A;  5G3L D;  4J15 A;  1EIG A;  3BDC A;  5JOB A;  5C4X H;  5IGD A;  1X3Q A;  5C4X B;  4WJ3 M;  1PRT B;  1ESF A;  2ZTC A;  5IGE A;  4GKJ L;  4DUY Q;  4LFB Q;  5IP9 H;  1HXY D;  1PTO H;  4LNQ A;  1I6H H;  3G4S A;  2KEC A;  5HGT A;  1PTO B;  3VR4 A;  2I46 A;  1I6H B;  3MZ5 A;  1QJO A;  2XRS D;  3HKZ G;  1Y1V H;  2F0W A;  1XNR Q;  1XPU A;  1HPC A;  1Y1V B;  5HY6 A;  5FLM G;  3HOY G;  1S40 A;  2HQL A;  2B39 A;  2HD3 A;  3P7J A;  1SSO A;  2JSO A;  3H3V C;  1IYU A;  1QE6 A;  3OYY A;  5DM6 3;  4ME5 A;  3CMA A;  2F3I A;  1SYC A;  3J7A 5;  4NDX A;  1A15 A;  5JJK A;  2JA8 G;  4R9W A;  1QCB D;  5IGC A;  3JAM E;  2N8N A;  3JAM i;  4F7X A;  3NXW A;  2PPB C;  3G7L A;  4JYA Q;  1XMO L;  1I4R A;  5GAH C;  1FR3 A;  1LTB D;  2N88 A;  3NSW A;  1EY9 A;  4OXP A;  1PYW D;  3UE0 A;  2MO0 A;  5M3F H;  4A3G H;  3U50 C;  4A3G B;  5M3F B;  2NVT B;  1CK1 A;  3MXN B;  3MC0 B;  4TRD A;  4YY3 Q;  4EQN A;  4YCW A;  1JC7 A;  3PUX A;  1BXT A;  1JOO A;  4XT1 B;  3NHH A;  1I3Q H;  3RZD H;  3V05 A;  3ND8 A;  3TP5 A;  3DMU A;  3RZD B;  4X64 Q;  1F2L A;  1LAC A;  3J7Z C;  3SXH A;  3K7U C;  4FYD A;  4E6I A;  2VW9 A;  1SNC A;  1NUC A;  1X3E A;  1WFQ A;  3IL8 A;  4KV6 A;  2ZJP A;  2Z0S A;  4DAY B;  4X65 Q;  4NXM Q;  1DCZ A;  4HTH A;  5BR8 L;  3KBG A;  2EVB A;  1ENC A;  2ZJQ A;  1LV9 A;  1ASY A;  2GA4 B;  2K6A A;  5ELC A;  1EYA A;  2IX3 A;  4OO1 I;  2RA4 A;  4X3S A;  2VQF L;  4DNI A;  1JB3 A;  1RHP A;  4J1M A;  4IUN A;  4M8A A;  2E2I B;  2CKZ B;  3U9O A;  4IFD G;  1VQM A;  1B70 B;  1LTS D;  2FXQ A;  4RGT A;  3PCO B;  1UE5 A;  5EAY A;  2XNA C;  3S24 A;  4CBV A;  5C3E H;  2ICE C;  3CME A;  5C3E B;  2QDL A;  2JA7 G;  2O5J C;  1EY7 A;  2IW3 A;  3BVG A;  3OWE B;  1WTV A;  1SNO A;  3TP8 A;  2FFK B;  4ID6 A;  3KJP A;  1K28 A;  3FPU B;  5CYU A;  2CH4 W;  4FO2 A;  3J7Y W;  4X3U A;  2K01 A;  2B2W A;  3K59 A;  2NN6 G;  1STE A;  3QR8 A;  4DK1 A;  1XPO A;  1MSH A;  3BU2 A;  3H91 A;  1FD7 D;  4ABN A;  5IP7 H;  1T5X D;  4K14 A;  2OQK A;  1BBW A;  3BG3 A;  2VNU D;  2CQO A;  1N32 L;  1GVP A;  3M4Q A;  4B3R L;  1QB5 D;  3F2B A;  3EFX D;  4DV0 Q;  3PUZ A;  1XTD A;  4JVZ A;  1HR0 Q;  4GLX A;  1PH9 A;  1YJW A;  4GS3 A;  1CKN B;  4F87 A;  1Y1W H;  1JOQ A;  4KLK A;  2AUJ D;  5KRU A;  1MI2 A;  3M7G A;  1Y1W B;  1LO5 D;  1A3T A;  4V19 0;  1Q1E A;  1YNJ D;  1ICW A;  4RHR A;  3OW2 A;  4DV7 L;  2A6E C;  5TSS A;  3S2D H;  5FOB B;  1KAA A;  3S2D B;  2BE5 C;  2FMM A;  3OTO L;  5D3D A;  2MPM A;  2R6G A;  2Z1C A;  3A55 A;  4JI3 L;  5EPK A;  3CXC A;  1DOL A;  3CF5 A;  4OHJ A;  1FNU A;  4RA8 A;  2AHO B;  1BCP D;  3NK9 A;  2CW0 C;  1CQF A;  1U4M A;  4JI1 Q;  3H15 A;  4FXK C;  4DR4 L;  2FHT A;  3S16 B;  1CSQ A;  2PZW A;  1E1O A;  4F8M A;  2B8G A;  1VQ5 A;  1CZW A;  1LAB A;  4ZCK A;  1Y8O B;  2A19 A;  2LS0 1;  4BWG B;  2JN4 A;  5JVH 3;  2F0G A;  3KF8 A;  1WTX A;  1STY A;  1EIF A;  2D5D A;  3PO2 G;  2RQX A;  2L0C A;  4EVO A;  2L11 A;  4A3I G;  1LT5 D;  2XSC A;  1YEZ A;  4A3E H;  2F0M A;  3QOL A;  5EKI A;  3UDX A;  1WTR A;  4A3E B;  1ZYR D;  2R61 A;  5LL6 S;  3TSS A;  2P5Z X;  1I94 Q;  1X55 A;  2KVM A;  1EZ6 A;  2C9O A;  1SMY C;  1VQA A;  3D4R A;  3GD7 A;  4LW1 A;  2BCO A;  3BJU A;  2WV6 D;  2A68 C;  5BN5 A;  1SYG A;  1V1Q A;  4EQ5 A;  1DON A;  2PQA A;  3KDF A;  4JI8 L;  4A3J G;  3RNU A;  2D9U A;  3WDN A;  1LTG D;  1SMX A;  3SK4 A;  5GAE C;  4JV5 Q;  3BVZ A;  3N6R A;  4IFD I;  3IFD A;  3TZD A;  2WB1 E;  3HOU H;  1QIL A;  1EEF D;  4A3D G;  1IW7 D;  1UE7 A;  1YHQ A;  1SYB A;  3BDO A;  3HOU B;  1GJX A;  3G6E A;  3CQZ H;  4P74 A;  1PZJ D;  3CCL A;  3TQY A;  3CQZ B;  3CCR A;  1TS2 A;  3FPP A;  1SE3 A;  1JQY D;  1B7Y B;  2B63 G;  4DV6 Q;  4HSP A;  3N52 A;  4R4Q A;  4JC0 A;  1RIP A;  2PI2 E;  1SYF A;  3HOZ G;  1LTR D;  1K0S A;  3IFT A;  4RMF A;  2JE6 I;  4A3K B;  1E24 A;  2NN6 I;  2JA6 H;  1YVC A;  2RF4 A;  1SEB D;  4KD3 A;  2JA6 B;  3TDQ A;  2ENB A;  1WI5 A;  2VQE Q;  5C3X A;  1DGS A;  4QUF A;  4C1N K;  1PRE A;  4YCV A;  1IL2 A;  4QIW B;  3J80 E;  1LT6 D;  1FJG Q;  5IYD H;  5LL6 X;  4QCL A;  1MJC A;  2PZU A;  3NWT A;  2F4V L;  1CQV A;  1K3R A;  3GTJ H;  4DV1 L;  2JQO A;  2KEE A;  3GTJ B;  1LTT D;  1LT3 D;  1H95 A;  2F0Q A;  3E0E A;  2NVY H;  2WAQ E;  5C6A A;  1A63 A;  2NVY B;  1KD1 C;  1Q82 C;  3EVQ A;  4KY5 A;  1UEA B;  3VDY A;  1NCV A;  3OW7 A;  1STN A;  4A3L H;  5M9O A;  1EQV A;  5CV9 A;  1J6Q A;  3CCQ A;  3BS1 A;  2PYK A;  2Z6K C;  3CPW A;  4DR5 L;  4G7Z C;  2NTT A;  2RDH A;  4NP5 A;  3SEB A;  3GV3 A;  1S5E D;  2K75 A;  1EU3 A;  5IIF A;  3I2Z A;  4JOI C;  3ICE A;  5IY0 A;  4A3F G;  1I4Q A;  4FXD A;  4B9W A;  1R4Q B;  4ZRZ A;  1N36 Q;  3Q22 A;  1P8L A;  1I4X A;  3E0J A;  1H9S A;  2VB3 X;  3CP0 A;  2VUM H;  2R7Z G;  2VUM B;  2PW5 A;  3NWS A;  5C5M A;  2R92 G;  1VS0 A;  3T1H Q;  1NR2 A;  3NQI A;  1B50 A;  3KJO A;  4KMU C;  3NUC A;  3C2P A;  3K5N A;  1OTC A;  1LTI D;  2JK8 A;  1ILP A;  4DAP A;  3I7F A;  2DJF C;  5L37 A;  1B9M A;  4JI4 Q;  1K83 H;  3K5O A;  3RUZ A;  2ASB A;  2XGT A;  3ULJ A;  1HFG A;  1ASZ A;  3KF8 B;  4IN3 A;  3DHQ A;  5BN4 A;  4CDC C;  1X32 A;  4C3J H;  4C3J B;  1GXD C;  3CCJ A;  4N8F A;  4P75 A;  2I0Q A;  4DUZ Q;  5IGB A;  4KN4 C;  2CWP A;  1CA5 A;  2K28 A;  4BBR H;  1A6X A;  4BBR B;  4BBS H;  3ERS X;  2Z6B A;  5EPJ A;  4BY1 G;  3SK6 A;  3OOC A;  2EE1 A;  4RAU C;  3R3O A;  4P72 A;  3K0Y A;  2B2U C;  2RDF A;  4NXN Q;  1K8A C;  4IUU A;  1A3V A;  3KDF B;  2LXJ A;  1JJC B;  1IBK L;  2M2L A;  4RCO A;  4P71 A;  2DY7 A;  5EBC A;  3R2I A;  1HNZ L;  3GQB A;  4J8Q A;  1E22 A;  4IAL A;  3L3O C;  5A2Q L;  1ONL A;  3GTK H;  4K0K Q;  1DM0 B;  2O4X A;  4IUR A;  3VR6 A;  2YU9 H;  3GTK B;  1KTK A;  2PMZ E;  1G91 A;  3Q8D A;  3OHX C;  1CFM A;  3FRP B;  4OEM B;  4FNF A;  2K14 A;  4AH6 A;  3TN2 A;  3GP7 A;  4FP5 D;  3HOX H;  3HOX B;  3FDT A;  1IKM A;  3M4P A;  2X6L A;  1PV4 A;  5KYI A;  4C3H B;  2F0V A;  5CMD A;  2KED A;  1Y14 B;  3DM1 A;  4DV4 L;  1AZP A;  1G51 A;  3D4W A;  1KIX A;  1TY2 A;  4I65 A;  5BN3 A;  1F9P A;  2SNS A;  3PQI A;  4LF8 L;  2CHB D;  4JBK A;  3I4M H;  1SNM A;  4F88 A;  3NTK A;  1EY4 A;  3I4M B;  2MQH A;  5I2X A;  4KKS A;  4DNR B;  1YHB A;  2Z9H A;  4B3T Q;  4CJ2 C;  3S1R H;  3FKI G;  3S1R B;  3TZU A;  4K6L A;  4KHZ A;  2QF7 A;  1SN8 A;  3MA2 B;  4HED A;  1E2Z A;  1QNU A;  1TU2 B;  1IXR A;  4H02 A;  2OTJ A;  4DK0 A;  3SHL A;  5LMN W;  3CAM A;  3I55 A;  4GOP C;  1K8M A;  1TY0 A;  4RCN A;  3D6C A;  4HN7 A;  4G4K A;  3OSO A;  5IGG A;  1KRS A;  5A35 A;  4K2K A;  1QVF A;  5IYC H;  1WYD A;  3KLW A;  1IL8 A;  1PH2 A;  4C3I G;  2IHF A;  1HTL D;  3MAQ A;  1GUT A;  1VQG A;  1JCK B;  1YIJ A;  2HT1 A;  3T51 B;  2QIL A;  4CHT B;  1KNA A;  4TVA B;  5JJZ A;  5T1G A;  2JP1 A;  2ZTD A;  2RVL A;  4O42 A;  3HP3 A;  1JE4 A;  5I9O A;  1PH7 A;  3I70 A;  2WAC A;  4XXE A;  5IT9 E;  3Q24 A;  3D4D A;  1C8C A;  2UU9 L;  4L5R C;  2EYM A;  4OL7 A;  3VYU A;  4ALP A;  4P2C B;  3BYY B;  1E7Z A;  2B29 A;  2K52 A;  2VQF Q;  1PYS B;  3U58 A;  2F0H A;  1Y8P B;  3CD6 A;  2B2T C;  3NEM A;  1HZA A;  4KHP Q;  1STB A;  3KLR A;  2EIF A;  2ZM6 L;  1N33 Q;  3D6W A;  4LFA Q;  2NZO A;  3SR1 A;  1HH2 P;  4IPG A;  3GTO H;  3GTO B;  3RR5 A;  3H6M A;  1TWF H;  1O80 A;  1D8L A;  4A3B H;  2RCF A;  1TWF B;  1LLR D;  4A3B B;  1Q90 A;  4JI7 Q;  1UEB A;  4IPD A;  3TRE A;  1NAP A;  1QUQ A;  1HNX Q;  4YWL A;  2PQE A;  1N34 Q;  1RKN A;  3PUW A;  3T56 B;  2HHH L;  1X3G A;  2OEO A;  4LFC Q;  4DU9 A;  1J5E L;  3A5U A;  1TT2 A;  2PI2 A;  4PNY A;  1VQN A;  5FO9 B;  2ID0 A;  2BDO A;  2K5N A;  2UUA Q;  3NBI A;  3CC7 A;  3ERO A;  1Q81 C;  4C2M H;  3NTI A;  1ROD A;  3S1N H;  4C2M B;  1RJT A;  1LUZ A;  1KNE A;  4B3S L;  1OXU A;  3OIP A;  2Q8T A;  2WIN B;  5JJL A;  1O7I A;  1N32 Q;  1UE6 A;  3F2D A;  4ZAI A;  3KYH C;  1K9M C;  5K36 G;  3TEH B;  5CV4 A;  5H1S E;  3I3C A;  2EZV A;  1SYE A;  1VQ8 A;  3HOW H;  4DV2 Q;  3PO3 H;  3HOW B;  3C46 A;  5CC4 A;  3PO3 B;  3A74 A;  1G6Z A;  5ELF A;  1U5K A;  1TWC H;  4A93 H;  1TWC B;  4A93 B;  5C0X G;  3HOV G;  4ZYS A;  1VQH A;  4DR6 Q;  2KOL A;  2CQA A;  1B8A A;  4MIU A;  2K5V A;  1VQF A;  5EGT A;  4GZY C;  1YNN D;  3FHW A;  2A8V A;  4LF9 L;  3GTL H;  2A5H A;  2IX1 A;  2XVS A;  1BF4 A;  2D2C C;  2VZA A;  2RCN A;  1AW7 A;  2RHS B;  2EY5 A;  1QVC A;  2Y0S G;  1CHQ D;  1RL2 A;  5IYB G;  4X66 L;  4UY8 C;  3H0G G;  3BDL A;  4HID A;  2UUC Q;  3GDE A;  4FF4 A;  5FJ8 G;  4PV1 C;  3I73 A;  1YNJ C;  5LMU L;  1I50 H;  2R7F A;  3C1F A;  3HRZ C;  2B2V C;  2KUM A;  1DXM A;  1I50 B;  3NPP A;  2IWH A;  1NR4 A;  1VQC A;  3FEW X;  4L8J A;  1PH3 A;  4RGO S;  1L1O A;  1JE5 A;  2L5T A;  4GKK Q;  1IYJ B;  1EL0 A;  2F52 A;  2CVR A;  5JPM C;  2Q2I A;  1DOM A;  3G4O A;  1X54 A;  1I3Q B;  3G48 A;  4CDE C;  2OXP A;  4HR7 B;  1BCP C;  3MFG A;  1BR9 A;  1F2Z A;  2BA1 A;  4QMG A;  4DFA A;  5A2Q E;  1AE3 A;  2N55 A;  2M9V A;  2Z6K A;  5G3L F;  4QQB X;  2IY5 B;  1WCM G;  4UPA A;  1QWY A;  4LUO A;  4YIJ A;  4JOI A;  4PQX A;  1EIH A;  4QB4 A;  5IWA Q;  3K6O A;  4R8I A;  1EQR A;  2GVB A;  4H44 C;  3LNN A;  1G6P A;  1QZH A;  4A3M H;  1MJE A;  3K80 C;  3MHB A;  4A3M B;  4JBW A;  4R8N A;  4HMJ A;  4B3M L;  2ZXR A;  1EY5 A;  5DAU A;  1B9N A;  5E4X A;  3UDF A;  3PV0 A;  1JJ2 A;  4HIO A;  1GOZ A;  3VYR A;  4A3K G;  4QJF A;  4G7H C;  1ZYR C;  2F0I A;  4JG2 A;  3RD4 A;  1SAP A;  1CZG A;  2G5D A;  3J80 c;  1IBL Q;  3SGI A;  2WB1 B;  3U4V A;  2RHQ B;  3MXU A;  1JT8 A;  2EYL A;  2L55 A;  1QUQ B;  1I5F A;  1XNQ L;  2BH2 A;  5CV5 A;  3VYT A;  4RGN A;  1F9R A;  3OIQ A;  2R7D A;  1CKM A;  2O5I C;  3T53 B;  4H13 C;  3WOF A;  4XYO A;  1L0Y B;  3AFQ A;  4OO1 H;  2LKV A;  4UP9 A;  2B2U A;  5JEA G;  1MBY A;  1IW7 C;  1TQO A;  2OCE A;  1UWV A;  4RGM A;  2NYZ D;  2K5H A;  2UUB Q;  4OWX B;  1Q8I A;  1H9R A;  3I90 A;  4MZ9 A;  1L2F A;  2E2H H;  3VA5 A;  4DR7 Q;  2MGS A;  1EY6 A;  2E2H B;  4DR2 Q;  1E2W A;  2ICI A;  1YIT A;  3TP7 A;  3RLF A;  2E5L Q;  1NNX A;  4ZQ3 A;  4X62 Q;  4EQO A;  3A0J A;  2JEA I;  4IZ8 A;  1SNP A;  5C0X I;  3MEH A;  2KCM A;  4DGZ A;  1G2T A;  4ILW A;  1TKW B;  2Q2T A;  1S3O A;  2WAQ B;  4K8I A;  4QL5 A;  3K8A A;  2VY3 A;  4NMZ A;  1GD7 A;  3AEV A;  4KKT A;  4OIJ A;  5E1F A;  4V0B A;  1T9H A;  1VQI A;  3PUV A;  4GN4 B;  5IE8 A;  3J7A V;  2PZT A;  1Q8K A;  3W1G A;  4DUY L;  4DAV A;  4XYQ A;  1HJP A;  1IKL A;  2CFM A;  2K5W A;  3HFZ B;  1W6K A;  3QB3 A;  1N9W A;  1AE2 A;  1XX8 A;  3A7L A;  4RFB A;  3ITP A;  3HS0 C;  4KN7 C; 
#chains in the Genus database with same CATH homology
 3J81 L;  4IUQ A;  4BBS B;  4IFD J;  3C0O A;  4S3S A;  1D5M C;  1G2S A;  1RTN A;  2BDN A;  1VMC A;  2SNM A;  2NUC A;  2RDG A;  1DOK A;  2F0L A;  1GUN A;  3HKZ B;  3C0M A;  2K33 A;  3KLS X;  1HA5 A;  1TWA B;  4G57 A;  1HTP A;  1S5B D;  3HOY B;  2HDL A;  2Q8R E;  1NSN S;  1AP0 A;  5ELE A;  3CRK C;  1A2T A;  5J39 A;  1VF5 C;  3OMG A;  1WTP A;  2IT1 A;  2JA8 B;  4FVM A;  1SYD A;  2J4X A;  4K2L A;  1XXG A;  3EQL C;  3DWP A;  5I4D A;  5EKL A;  4QF4 A;  1DZ1 A;  1XYI A;  4CKC A;  5EJW A;  3NBH A;  4EQP A;  1OXS C;  1U4R A;  1PFB A;  4IUV A;  1BCP F;  1PRT D;  1UAP A;  2G9D A;  1EFI D;  2PNR C;  3HZX A;  3D3R A;  4BA1 I;  5K5P A;  1PTO D;  2EYO A;  4C3H G;  4N9P A;  1Z7T A;  3SK8 A;  2K5D A;  1HRJ A;  3R2T A;  3KBX A;  1V1P A;  2B2T A;  4LMQ D;  1HFN A;  4ZK9 B;  4XDX A;  2KHS A;  3S1M B;  2NVX B;  1WTQ A;  2K04 A;  2PMZ B;  2NTS A;  2X69 A;  4DF7 A;  1I6V C;  4OGQ C;  4IUT A;  1PZK D;  3F2U A;  2F3V A;  1I4H A;  1HQR D;  2F0J A;  1QG7 A;  3URY A;  4IUP A;  2EYH A;  2F4I A;  2EJG C;  5JVG 3;  3QG1 A;  4XIG S;  4IFD H;  1SJE D;  4L63 B;  3V2T A;  5D14 A;  2KCC A;  1DYQ A;  1PFN A;  4KJN A;  5ELB A;  1Z6H A;  1D1I A;  2MJ8 A;  5EPL A;  5KEE A;  1VCI A;  2JA7 B;  3P20 A;  5KGU A;  2F3W A;  4UDU C;  1PLF A;  2WP8 J;  4MHE A;  2JEB I;  3M7N A;  4ZKC B;  3S1Q B;  2NN6 H;  3KLS A;  4BS9 A;  1KLU D;  1HQM C;  3I91 A;  3MWY W;  2DNC A;  2EY1 A;  1BQQ T;  3EA6 A;  1DJR D;  3KK7 A;  1XWE A;  3S15 B;  2HUG A;  3IKJ A;  3RZO B;  4G7O C;  3SDZ A;  1B4O A;  3PIP 3;  3M4Y A;  1V1O A;  1RDP D;  2B2V A;  1JOR A;  1K83 B;  4B08 A;  2KJX A;  3IAY A;  2G9H D;  2IJ0 A;  4AYB B;  2QKI C;  3I4L A;  3DWQ A;  5NUC A;  3LWU A;  3ONA B;  4C56 C;  3VR3 A;  1STA A;  5E3F A;  2HDM A;  1R9T B;  5KNB A;  1X3P A;  1PZI D;  5KIX A;  5M5W B;  1FNW A;  1AEX A;  4CKE A;  5FKA C;  3HEJ A;  1CA6 A;  4I7Z C;  4K8J A;  1IHZ A;  5E4W C;  1JWM D;  2AQ1 B;  2Z4H A;  2YU9 B;  3PO2 B;  1V1P B;  4A3I B;  1QOH A;  1RF2 D;  1BNZ A;  1TWG B;  3CRL C;  3J81 E;  1VMP A;  1F9S A;  2BOS A;  2C5C A;  1H9M A;  2A74 C;  2Z8L A;  1WD1 A;  5IOC A;  1SJH D;  4A3J B;  1JOK A;  1GHK A;  1G29 1;  4M1U B;  2EJF C;  2K7V A;  3QO2 A;  4A3D B;  2F1M A;  1TVX A;  1EU4 A;  2EY2 A;  5ELD A;  3H94 A;  2B2Y C;  2B63 B;  5FO8 B;  3E6Z X;  4HMI A;  2K05 A;  2NBF A;  3HOZ B;  1YNN C;  5IGF A;  5HUR A;  4HCS A;  1D5X C;  1D6E C;  3HGB A;  3K57 A;  4B9X A;  1B44 D;  3C0N A;  3SVM A;  3A8J E;  5KNC A;  1JWS D;  1OXT A;  1OO9 B;  2A6H D;  2E2J B;  3LWE A;  1J9O A;  3P75 A;  2EXZ A;  3ZYY X;  3T13 A;  1AZQ A;  3NTH A;  3M3Y B;  3SK5 A;  1J8I A;  4N9T A;  2I07 B;  5LHY 1;  3H09 A;  2SDF A;  4O1N A;  5FLX L;  1CM9 A;  5KYL A;  3Q0A A;  2FMC A;  1S5F D;  4ODG A;  4C1N I;  2F0K A;  1L0X B;  2K5Q A;  3R8B A;  4A3F B;  1HUM A;  1Q1B A;  2EY6 A;  2PCF B;  1STH A;  3VR2 A;  1BCP B;  2R7Z B;  1AN8 A;  3S9W A;  1ILQ A;  3S17 B;  5C4J B;  1WVL A;  2R92 B;  2E2D C;  1U4P A;  3RMH A;  3AMU A;  1MSG A;  3CHB D;  3QIA A;  4X3T A;  2AQ3 B;  2L1B A;  5KND A;  4BA2 I;  4PMC A;  1EY0 A;  3CKI B;  4FF3 A;  2WKC A;  3S1N B;  4Y7N B;  1FNV A;  2M00 A;  5JPN C;  1WD0 A;  1EYC A;  2E76 C;  1TII D;  1SFO B;  1R4P B;  2EJM A;  4ULL A;  1ZXT A;  1SE4 A;  2XWJ B;  3S14 B;  3FVQ A;  3A7A B;  4WFN 3;  4BY1 B;  3GTP B;  5CV8 A;  1PMR A;  2QEJ C;  4RH6 A;  2IX0 A;  4RKB A;  3GTL B;  4K5X A;  1M8A A;  2KA7 A;  2K32 A;  4DN4 M;  1JWU D;  1I4P A;  2EYP A;  3QOJ A;  1WTW A;  4FXG C;  3O13 A;  4DNT B;  1SXT A;  2L9H A;  3KUP A;  1KLG D;  2F03 A;  1B1Z A;  2ZXO A;  1CT1 D;  2JYO A;  3NE5 B;  1EOT A;  2ZXP A;  4U67 3;  2VB2 X;  2TSS A;  1BBX C;  3M85 A;  2QCP X;  1UUP A;  5DM7 3;  4FF2 A;  4J6H A;  5FO7 B;  1QNK A;  4CGY B;  5T1I A;  4DXG A;  2AWO A;  1BUV T;  4K5V A;  1ZEQ X;  3EJI A;  4HSV A;  3FKI B;  1A2U A;  5IOD A;  1KAB A;  1MGS A;  4WOR A;  4TSS A;  3J80 L;  1TS5 A;  2KQ3 A;  3K7A B;  4H0L C;  4PMB A;  5EKK A;  2PW7 A;  3WOE A;  1CHP D;  1TS3 A;  1ESR A;  3Q6S A;  2AQ2 B;  1V43 A;  3UI2 A;  2NWG A;  5C0X J;  4K6D A;  3OPO A;  1SE2 A;  2A69 D;  4C3I B;  3X3M A;  1CI3 M;  1BO0 A;  1DD2 A;  5EQ0 A;  1E2V A;  3E5S A;  1T5E A;  1EEI D;  1PRT C;  4NW2 A;  3PUY A;  1PTO C;  3MFY A;  3LX0 A;  1II3 A;  4HCE A;  2XIW A;  4ZKB B;  2H1E A;  1ENA A;  4U68 A;  1GUS A;  2X6G A;  1EQT A;  2K1B A;  2NZ1 D;  5COR A;  3GTG B;  3AU7 A;  4FF1 A;  1TS4 A;  5FLX E;  3DEP A;  1VF7 A;  2WII B;  3C3L A;  1H9K A;  4RHS A;  4CKB A;  3U9S A;  2L12 A;  3PIO 3;  2B8F A;  2AUK A;  5K36 H;  4CJ1 B;  2HQE A;  4PMW A;  4C3J G;  3K5M A;  2R3Z A;  5F2D A;  3W2D A;  3SE0 A;  3VR5 A;  2RSO A;  5I9P A;  4XT3 B;  5JAV A;  3R93 A;  4XQN A;  1F2M A;  2B2Y A;  4KHV A;  2E75 C;  3ND9 A;  5C4H A;  5C0X H;  3HOV B;  1B2T A;  2F0U A;  2V4D A;  3BZD B;  2F0O A;  3AB9 A;  1GHJ A;  3M4O B;  5C5L A;  2D62 A;  2EDG A;  4KI0 A;  4DXF A;  2HCC A;  3J7A F;  5JEA J;  2LMC B;  2Y0S B;  4WRD A;  2F0S A;  3H0G B;  1U9R A;  5J1Z A;  2MHV A;  5CBE E;  4KTA A;  5C4Z A;  3OMC A;  4LAA A;  1EY8 A;  3CU7 A;  1ET6 A;  3C1E A;  1HUN A;  2SOB A;  4KKU A;  2BA0 A;  2JXM B;  1TR5 A;  1SBB B;  1ZKO A;  2F0T A;  3D8G A;  2QDB A;  4RWS C;  2MP1 A;  4XQJ A;  1OXX K;  1CTM A;  5M5Y B;  1STG A;  3A54 A;  1V8Q A;  3G6J B;  2IL8 A;  3ERQ A;  4LJZ C;  2DN8 A;  3BYT B;  1EYD A;  2ZT9 C;  1WCM B;  2OF1 A;  3DUZ A;  3K5L A;  1ML0 D;  1AFP A;  2OT2 A;  5C3W A;  1G8Z D;  2F0P A;  4XTC S;  1B53 A;  5DEH A;  4Z9C B;  1MD2 D;  1GUW A;  3I72 A;  3MTS A;  1SNQ A;  3NP8 A;  1WTO A;  4L6T B;  4HAE A;  1JR0 D;  5IT9 L;  2WKD A;  2A6E D;  2E74 C;  4KY6 A;  1LT4 D;  5I6Y A;  1D2B A;  2BE5 D;  1C4Q A;  3PMF A;  1PFM A;  2F0F A;  5CBA E;  1PRT F;  1ET9 A;  2PO4 A;  4RKL A;  5ISR A;  1VDZ A;  1PTO F;  2EYJ A;  1UNS A;  1F9Q A;  3X3N A;  1JIC A;  2CW0 D;  3T16 A;  1OXV A;  4EGV A;  2FJ2 A;  5JEA H;  2XN9 C;  3DEO A;  1S5D D;  2DY8 A;  3GTQ B;  2J7Z A;  2SEB D;  2L4N A;  2H4O A;  2EYF A;  3D31 A;  1B3A A;  2RKS A;  5M5X B;  2YYZ A;  1HA6 A;  3L9A X;  5I6W A;  3TME A;  2VXW A;  3I8Z A;  4NKL A;  4KY7 A;  3MXG A;  1SMY D;  3A8I E;  4KD4 A;  2NB0 A;  2EOT A;  1M4V A;  2A68 D;  2A6H C;  1S5C D;  3VA7 A;  3NQT A;  5EBD A;  3P1H A;  1D1K A;  2MUY A;  5J22 A;  3JAM L;  3I4N B;  1K8O A;  1F2Y A;  4MN3 A;  3K58 A;  2O2L D;  1A3U A;  1ENF A;  4CJ0 B;  4JK1 C;  4DA2 A;  1O7Z A;  1U4L A;  1EWC A;  2B2W C;  2J0T D;  1D5Z C;  3V96 A;  1Y8N B;  3A56 A;  1I4G A;  1KDC A;  5D3I B;  5I2Y A;  3S2H B;  5DNF A;  5AFW A;  5CGK A;  1Z52 A;  1RD9 D;  1GUG A;  3OWF A;  3Q23 A;  4IQZ A;  2F0E A;  2R93 B;  1S4Z A;  4TQU S;  5C44 B;  1HCZ A;  2AWN A;  1Y69 U;  1IYV A;  1EWH A;  1FGB D;  4ZLT F;  1BDO A;  2LY7 A;  2IPK D;  2JA5 B;  1E0B A;  2Z4I A;  1RTO A;  5M3M B;  4UAI A;  4KJO A;  1EZ8 A;  4LK1 C;  1TWH B;  4H7B A;  3HG9 A;  2EPB A;  1BOS A;  4X3K A;  3A8K E;  2F0D A;  1XTC D;  1SND A;  3GV6 A;  2DNE A;  3QJY A;  3GO5 A;  3MXN A;  1KDA A;  3MVV A;  1PXU A;  1H9J A;  3W3A A;  2RSN A;  1F77 A;  1C48 A;  1Z47 A;  4OIK A;  3L7Z C;  1H9S B;  4K5W A;  2HCI A;  4DAY A;  4Q5V A;  1SDF A;  2FIN B;  1O7Y A;  2RBM A;  2F0N A;  1W6J A;  1Q12 A;  2Q8I B;  1PDQ A;  1FYC A;  3DXJ C;  3QWN A;  1Q3L A;  3TBI B;  4OO1 G;  1RCV D;  5CV6 A;  5D65 A;  5COY A;  4KK7 A;  4TKO B;  1O7L A;  2LFN A;  2NVQ B;  2KCN A;  3GTM B;  4Q0F A;  1HHV A;  3FMC A;  1KDB A;  1O78 A;  2XWB B;  5FK9 C;  1LTA D;  2A69 C;  2TMP A;  3G4N A;  4BY7 B;  3MXP A;  5CV7 A;  3TP6 A;  3BVM A;  2A73 B;  3VYS A;  4ZUI A;  2XRQ D;  4WJW A;  3T4A C;  1GUO A;  4ZUJ A;  5CR3 A;  2K03 A;  4XQQ A;  3DWA A;  4QUC A;  5G3L D;  1EIG A;  3BDC A;  5JOB A;  5IGD A;  1X3Q A;  5C4X B;  1PRT B;  1ESF A;  5IGE A;  1HXY D;  1PTO H;  2KEC A;  5HGT A;  1PTO B;  3VR4 A;  2I46 A;  1I6H B;  3MZ5 A;  1QJO A;  2XRS D;  2F0W A;  1HPC A;  1Y1V B;  2B39 A;  3P7J A;  1SSO A;  2JSO A;  3H3V C;  1IYU A;  1QE6 A;  5DM6 3;  4ME5 A;  1SYC A;  4NDX A;  1A15 A;  4R9W A;  1QCB D;  5IGC A;  3JAM E;  4F7X A;  3NXW A;  2PPB C;  3G7L A;  1I4R A;  1FR3 A;  1LTB D;  2N88 A;  3NSW A;  1EY9 A;  1PYW D;  4A3G B;  5M3F B;  2NVT B;  1CK1 A;  3MC0 B;  4TRD A;  4EQN A;  1JC7 A;  3PUX A;  1BXT A;  1JOO A;  4XT1 B;  3NHH A;  3V05 A;  3ND8 A;  3TP5 A;  3DMU A;  3RZD B;  1F2L A;  1LAC A;  3SXH A;  4FYD A;  4E6I A;  1SNC A;  1NUC A;  3IL8 A;  4KV6 A;  1DCZ A;  4HTH A;  3KBG A;  2EVB A;  1ENC A;  1LV9 A;  2GA4 B;  2K6A A;  5ELC A;  1EYA A;  2IX3 A;  4OO1 I;  2RA4 A;  4X3S A;  1JB3 A;  1RHP A;  4J1M A;  4IUN A;  4M8A A;  2E2I B;  3U9O A;  4IFD G;  1LTS D;  4RGT A;  2XNA C;  4CBV A;  2ICE C;  5C3E B;  2O5J C;  1EY7 A;  2IW3 A;  3BVG A;  3OWE B;  1WTV A;  1SNO A;  3TP8 A;  2FFK B;  4ID6 A;  3FPU B;  5CYU A;  4FO2 A;  3J7Y W;  4X3U A;  2K01 A;  2B2W A;  3K59 A;  2NN6 G;  1STE A;  4DK1 A;  1MSH A;  3H91 A;  1FD7 D;  4ABN A;  1T5X D;  4K14 A;  3BG3 A;  2VNU D;  1QB5 D;  3EFX D;  3PUZ A;  4F87 A;  1JOQ A;  2AUJ D;  5KRU A;  1MI2 A;  3M7G A;  1Y1W B;  1LO5 D;  1A3T A;  4V19 0;  1Q1E A;  1YNJ D;  1ICW A;  4RHR A;  2A6E C;  5TSS A;  5FOB B;  1KAA A;  3S2D B;  2BE5 C;  2FMM A;  5D3D A;  2MPM A;  2R6G A;  2Z1C A;  3A55 A;  5EPK A;  1DOL A;  4OHJ A;  1FNU A;  4RA8 A;  1BCP D;  2CW0 C;  3NK9 A;  1CQF A;  1U4M A;  4FXK C;  2FHT A;  3S16 B;  2PZW A;  4F8M A;  2B8G A;  1CZW A;  1LAB A;  1Y8O B;  2LS0 1;  4BWG B;  5JVH 3;  2F0G A;  3KF8 A;  1WTX A;  1STY A;  2D5D A;  2RQX A;  2L0C A;  4EVO A;  2L11 A;  1LT5 D;  2XSC A;  2F0M A;  3QOL A;  5EKI A;  1WTR A;  4A3E B;  1ZYR D;  2R61 A;  5LL6 S;  3TSS A;  2KVM A;  1EZ6 A;  2C9O A;  1SMY C;  3D4R A;  3GD7 A;  2BCO A;  2WV6 D;  2A68 C;  5BN5 A;  1SYG A;  1DON A;  2D9U A;  3WDN A;  1LTG D;  3SK4 A;  3BVZ A;  3N6R A;  4IFD I;  3IFD A;  3TZD A;  1QIL A;  1EEF D;  1IW7 D;  1SYB A;  3BDO A;  3HOU B;  1GJX A;  1PZJ D;  3CQZ B;  1TS2 A;  3FPP A;  1SE3 A;  1JQY D;  4HSP A;  3N52 A;  1SYF A;  1LTR D;  3IFT A;  2JE6 I;  4A3K B;  2NN6 I;  1SEB D;  4KD3 A;  2JA6 B;  3TDQ A;  2ENB A;  5C3X A;  4QUF A;  4C1N K;  1PRE A;  4QIW B;  3J80 E;  1LT6 D;  5LL6 X;  4QCL A;  2PZU A;  3NWT A;  1CQV A;  2KEE A;  3GTJ B;  1LTT D;  1LT3 D;  2F0Q A;  5C6A A;  2NVY B;  3EVQ A;  4KY5 A;  1UEA B;  1NCV A;  3OW7 A;  1STN A;  5M9O A;  1EQV A;  5CV9 A;  3BS1 A;  2PYK A;  4G7Z C;  2NTT A;  2RDH A;  3SEB A;  4NP5 A;  3GV3 A;  1S5E D;  1EU3 A;  5IIF A;  1I4Q A;  4FXD A;  4B9W A;  1R4Q B;  4ZRZ A;  3Q22 A;  1I4X A;  3E0J A;  1H9S A;  2VB3 X;  2VUM B;  2PW5 A;  3NWS A;  5C5M A;  1NR2 A;  3NQI A;  1B50 A;  4KMU C;  3NUC A;  3C2P A;  3K5N A;  1LTI D;  1ILP A;  4DAP A;  1B9M A;  3K5O A;  3RUZ A;  1HFG A;  4IN3 A;  3DHQ A;  5BN4 A;  1X32 A;  4C3J B;  1GXD C;  5IGB A;  4KN4 C;  1CA5 A;  2K28 A;  1A6X A;  4BBR B;  5EPJ A;  3SK6 A;  3OOC A;  2EE1 A;  4RAU C;  3R3O A;  3K0Y A;  2B2U C;  2RDF A;  4IUU A;  1A3V A;  2M2L A;  4RCO A;  2DY7 A;  5EBC A;  3R2I A;  3GQB A;  4J8Q A;  4IAL A;  3L3O C;  5A2Q L;  1ONL A;  1DM0 B;  2O4X A;  4IUR A;  3VR6 A;  3GTK B;  1KTK A;  1G91 A;  3OHX C;  1CFM A;  3FRP B;  4FNF A;  3TN2 A;  3GP7 A;  4FP5 D;  3HOX B;  3FDT A;  1IKM A;  2X6L A;  5KYI A;  4C3H B;  2F0V A;  5CMD A;  2KED A;  3DM1 A;  1AZP A;  3D4W A;  1TY2 A;  4I65 A;  5BN3 A;  1F9P A;  2SNS A;  2CHB D;  1SNM A;  4F88 A;  3NTK A;  1EY4 A;  3I4M B;  5I2X A;  4KKS A;  4DNR B;  4CJ2 C;  3S1R B;  3TZU A;  4K6L A;  4KHZ A;  2QF7 A;  3MA2 B;  4HED A;  1E2Z A;  1QNU A;  1TU2 B;  4DK0 A;  3SHL A;  1K8M A;  1TY0 A;  4RCN A;  3D6C A;  4HN7 A;  4G4K A;  3OSO A;  5IGG A;  5A35 A;  4K2K A;  1IL8 A;  4C3I G;  1HTL D;  3MAQ A;  1GUT A;  1JCK B;  3T51 B;  2QIL A;  4CHT B;  1KNA A;  5JJZ A;  5T1G A;  2JP1 A;  2RVL A;  4O42 A;  3HP3 A;  5I9O A;  1JE4 A;  3I70 A;  2WAC A;  4XXE A;  5IT9 E;  3Q24 A;  3D4D A;  1C8C A;  2EYM A;  4OL7 A;  3VYU A;  4P2C B;  3BYY B;  2F0H A;  1Y8P B;  2B2T C;  1STB A;  3KLR A;  3D6W A;  3SR1 A;  3GTO B;  3H6M A;  1O80 A;  1TWF B;  1LLR D;  4A3B B;  1Q90 A;  1NAP A;  2PQE A;  1RKN A;  3PUW A;  3T56 B;  2OEO A;  4DU9 A;  1TT2 A;  4PNY A;  5FO9 B;  2ID0 A;  2BDO A;  3NBI A;  3ERO A;  3NTI A;  1ROD A;  4C2M B;  1RJT A;  1KNE A;  1OXU A;  3OIP A;  2Q8T A;  2WIN B;  4ZAI A;  5K36 G;  5CV4 A;  3I3C A;  2EZV A;  1SYE A;  3HOW B;  3C46 A;  5CC4 A;  3PO3 B;  1G6Z A;  5ELF A;  1TWC B;  4A93 B;  5C0X G;  4ZYS A;  2KOL A;  2CQA A;  4MIU A;  5EGT A;  4GZY C;  1YNN D;  2A5H A;  2IX1 A;  2XVS A;  1BF4 A;  2D2C C;  1AW7 A;  2EY5 A;  1CHQ D;  3BDL A;  4FF4 A;  4PV1 C;  3I73 A;  1YNJ C;  3HRZ C;  3C1F A;  2B2V C;  2KUM A;  1DXM A;  1I50 B;  3NPP A;  2IWH A;  1NR4 A;  3FEW X;  4L8J A;  4RGO S;  2L5T A;  1EL0 A;  2CVR A;  5JPM C;  1DOM A;  3G4O A;  1I3Q B;  2OXP A;  4HR7 B;  1BCP C;  3MFG A;  1BR9 A;  1F2Z A;  2BA1 A;  4QMG A;  4DFA A;  5A2Q E;  2N55 A;  2M9V A;  5G3L F;  1QWY A;  4YIJ A;  4PQX A;  1EIH A;  4QB4 A;  3K6O A;  4R8I A;  4H44 C;  3LNN A;  3MHB A;  4A3M B;  4JBW A;  4R8N A;  4HMJ A;  2ZXR A;  1EY5 A;  5DAU A;  1B9N A;  5E4X A;  3PV0 A;  1GOZ A;  3VYR A;  4G7H C;  1ZYR C;  2F0I A;  3RD4 A;  1SAP A;  1CZG A;  2WB1 B;  3MXU A;  2EYL A;  2L55 A;  5CV5 A;  3VYT A;  4RGN A;  1F9R A;  3OIQ A;  2O5I C;  3T53 B;  4H13 C;  3WOF A;  4XYO A;  1L0Y B;  4OO1 H;  2LKV A;  2B2U A;  5JEA G;  1MBY A;  1IW7 C;  1TQO A;  4RGM A;  2NYZ D;  1Q8I A;  1H9R A;  3I90 A;  3VA5 A;  2MGS A;  1EY6 A;  2E2H B;  1E2W A;  2ICI A;  3TP7 A;  3RLF A;  4ZQ3 A;  4EQO A;  2JEA I;  4IZ8 A;  1SNP A;  5C0X I;  3MEH A;  4DGZ A;  1G2T A;  4ILW A;  1TKW B;  2WAQ B;  4K8I A;  4NMZ A;  4KKT A;  4OIJ A;  5E1F A;  4V0B A;  3PUV A;  3J7A V;  2PZT A;  4DAV A;  4XYQ A;  1IKL A;  2K5W A;  3QB3 A;  1W6K A;  1XX8 A;  3A7L A;  4RFB A;  3ITP A;  3HS0 C;  4KN7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...