1PTOC

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
b'GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQTYALTGISLCNPAASIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
total genus 41
structure length 196
sequence length 196
chains with identical sequence I
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoC02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoC01
1XTCD 3URYA 1PTOD 4L6TB 1EEFD 2SEBD 1JCKB 1JWSD 4Z9CB 1SE2A 2R61A 2XRSD 1LT6D 3R8BA 1EWCA 1Z52A 1BCPC 1DYQA 4L63B 1L0YB 1PTOB 1V1PB 1TY2A 1L0XB 1AW7A 1CK1A 2IPKD 3C0NA 1LTTD 1EU3A 1G8ZD 1LLRD 3TSSA 3C0OA 1BCPF 1RD9D 1LTRD 1JQYD 4RH6A 1TS2A 2XRQD 1V1OA 2CHBD 1I4XA 1S5FD 1CT1D 1BCPB 3MC0B 1LT3D 2AQ3B 1FD7D 3MFGA 3G4NA 1T5XD 1LO5D 5ELCA 2J4XA 3OWEB 5ELBA 2O2LD 4RGMA 2XN9C 4UDUC 3V05A 1B1ZA 1TY0A 1PREA 1PZJD 4DXFA 1BXTA 1SEBD 1LTID 1RDPD 1SE3A 3DWAA 4RHRA 2NTTA 3DWPA 1LTGD 1LT4D 1I4QA 1F77A 1CQVA 1I4RA 3BVMA 1S5CD 1PRTD 5ELDA 1JWMD 3BVZA 3R2IA 2G9HD 2TSSA 4OHJA 1PYWD 1V1PA 3EA6A 2XNAC 1UUPA 4C56C 4RHSA 1EEID 3BYYB 3BZDB 1ESFA 1FNVA 1FNUA 3CHBD 1ET9A 1DJRD 1TS4A 1ENFA 5D3DA 1RF2D 2IJ0A 3R2TA 1QILA 3KLSX 1EU4A 3BVGA 1D5MC 1I4GA 1TS5A 4ZYSA 1PRTC 1SXTA 2AQ1B 1I4PA 2QILA 1PTOH 3O13A 2WV6D 4K6LA 5ELFA 1SBBB 4RCOA 5I4DA 1PRTF 4TSSA 3DWQA 1GOZA 2ICIA 4O1NA 1D5XC 1B44D 1SJED 1S5ED 2QEJC 1HXYD 1PRTB 1M4VA 1D6EC 3G4OA 1LT5D 3BYTB 3GP7A 1LTAD 5FKAC 1XXGA 1HQRD 1SE4A 4BWGB 1D5ZC 1HA5A 1MD2D 4RGOS 1CHQD 1JWUD 1KTKA 4DXGA 5D3IB 1PZKD 5ELEA 1S5BD 5TSSA 1EFID 4RGNA 1I4HA 3C0MA 1RCVD 3SEBA 1BCPD 1SJHD 3EFXD 4RGTA 1FGBD 1LTBD 1UNSA 1TS3A 2RDHA 3W2DA 1ET6A 5FK9C 2RDGA 2Z8LA 1KLUD 2NTSA 1PTOC 4RFBA 1HTLD 1LTSD 1FNWA 1JR0D 1KLGD 1CHPD 1AN8A 1S5DD 1STEA 1PZID 1PTOF 2AQ2B
chains in the Genus database with same CATH superfamily
5EKLA 3S17H 4LF7Q 1FGUA 3A8KE 1F9SA 4L63B 4FDBA 4DV2L 5IT9L 5COYA 4NP5A 2PNRC 1G8ZD 1AE3A 1LLRD 4HCSA 2DNCA 3C0OA 1NTGA 4DR4L 1LTRD 4QIWE 1EIGA 4E6IA 4IZ8A 3U4ZA 1PFSA 1U0LA 5M5YH 4DR1Q 4LFCL 2FMCA 2XN9C 2KHSA 2I5HA 4B3TL 2JE6I 2JEBI 4B3SQ 5E4XA 5T1IA 3A54A 2VUMG 4DAMA 5IY0A 5IP7G 1UE6A 3T56B 3KOJA 1D1IA 4JBWA 1XMQQ 4XTCS 4KV6A 4UP7A 5ELOA 4ZUIA 3MVVA 2QEXA 2UU9L 3BDCA 3I56A 5IYBH 1HTPA 1QVFA 2QKIC 4IUPA 4G7ZC 1SAPA 4A3KH 4DR1L 4X6AH 2L55A 1X3FA 3CCSA 4K8JA 3HGBA 4A3GG 4K6DA 3VYRA 2EIFA 1UUPA 5C5MA 3JC66 4RHSA 3HP3A 3K58A 3BZDB 1E1TA 3CHBD 1UAPA 4NXML 4OO1I 4LF4Q 4Y52H 1GUWA 4WJ4A 3UDIA 2CQAA 3VA7A 2H1EA 4DPGA 2NWGA 1CI3M 1PRTC 3MHBA 3AYHB 2AUJD 5CR3A 1PFMA 2YV5A 1JJGA 4ULLA 1EL0A 3TP6A 3A55A 2XTIA 4G57A 3HOVB 5M9OA 1PYSB 4R4TA 5FO7B 3CQZB 1S5ED 1M4VA 3NHHA 3E3XA 4LF4L 2MO0A 1KAWA 3BDOA 4JG2A 4N9PA 2D0OA 1VQGA 4A3FB 1MD2D 2J0TD 2JA5B 4NMZA 1JWUD 4DXGA 5TSSA 1F2LA 5KNCA 1NNXA 1I4HA 1B9NA 1E24A 1BCPD 2WB1G 5EPJA 2KVMA 2I07B 3W2DA 4P74A 2DY7A 1B53A 5M5WH 2F4VL 2BCOA 2NTSA 4IFDG 2L0CA 3TBIB 1MKHA 5IGBA 4K14A 5CMDA 2F0DA 3HOYB 3DMUA 2AQ2B 3HOUB 1EEFD 3I70A 2E5LQ 4BA1I 1JMCA 4J15A 1ASZA 4CKBA 1K83B 4O0AA 4Y7NH 3IL8A 1C8CA 3GTKB 3OWFA 2R7ZH 2WACA 3MC0B 3KJOA 1IBKQ 2E5LL 3RLNA 1I3QH 5GAGC 4BY1B 4LNQA 2D5DA 1LTID 2QGQA 1S72A 1A2UA 4LF6L 2R92H 4KY5A 1WTPA 3S14H 1SYDA 4EGVA 2A73B 2F0GA 2F0KA 1VQ8A 1I6HH 3H0GG 3PV0A 1YHBA 3CCLA 3PO3B 4A3GB 3T1HL 3BZKA 1WCMH 3PUVA 1A3VA 2KHJA 3RR5A 1FNVA 1FNUA 1K0RA 1ICWA 3KF6B 4FNFA 2PW7A 4B9XA 4JI7Q 4A3EH 5JJZA 4YWKA 1ICFB 2O5JC 1SRUA 4KY6A 3I4MB 4DR6L 3P7JA 4DV6Q 1U4RA 3FRPB 5I4DA 3CCUA 4F87A 2UUBQ 3A56A 5C0XJ 4KHPL 4IUNA 1Q3LA 4ABNA 4DUYL 2F3IA 2FJ2A 2ATWA 4K5WA 3RUZA 4JI7L 4EQOA 1PHJA 1NMFA 1SSOA 3S2DB 3PO2G 4LF5L 1VF7A 3HOWG 4UP9A 1N36Q 2D2CC 4UY8C 3HEJA 3K5NA 5JJLA 4JCVE 1B7YB 2PO4A 2B63G 3A0JA 3EN2A 1LTBD 1GM5A 3J80E 1XPOA 1VQPA 1CKOA 3CPFA 2PZTA 4P73A 4OO1H 1Q46A 2WKDA 1SMYD 1JR0D 3W1GA 2JA7G 5J22A 3K8AA 4BY7G 5F2DA 3IRBA 4QQBX 5C44B 1B4OA 2L1BA 4B3RL 1SE2A 2XRSD 1AE2A 3S24A 1DYQA 1L0YB 3D4WA 2DGYA 4JI0L 3U9SA 1WTXA 2EYLA 3DHQA 4QIWB 2K75A 3JAME 3RN5A 1RKNA 1WTOA 2VS1A 3RZOH 1S5FD 3LX0A 3PIOA 3X3MA 1AP0A 1ZKOA 1II3A 2LXJA 4DV4L 1VQDA 3STBC 2LFNA 3EROA 2K1BA 4RGMA 2MFIA 3J80i 3TP7A 2A6EC 1X3GA 1TIID 4IOCA 1TWAH 4QUFA 1SE3A 4RWSC 4YWLA 2R93G 5C4XG 2E76C 3GV6A 2F1MA 1E7ZA 4QJFA 5M3FH 1MJEA 2JN4A 5DM73 1TWCH 1EUJA 2N3SA 3H0GB 2EY5A 2EQSA 1ZXTA 3TZUA 1EFWA 1KRSA 2K6AA 5FLXc 1B70B 4OWXB 2LKVA 4HTHA 1PLFA 4CDDC 3JAMi 1H9MA 2Q2TA 1B8AA 2F0FA 4A3IH 4JV5Q 2O4XA 4H44C 3J80L 1WJJA 5I2YA 1SNPA 1S4ZA 1I50B 4JI5Q 1OXVA 1U4MA 2K33A 1HUMA 1ZEQX 3MEHA 4DU9A 2RA4A 1C4QA 1ENCA 2L4NA 3BJUA 1EIHA 1O7YA 4AYBB 3KDFA 3O13A 5JVH3 2OF1A 3QB3A 4TSSA 1QJOA 1EQQA 2F03A 2K01A 1WFQA 1KHIA 1HFNA 3KLWA 3OHXC 2EJMA 4ZKCB 3JAML 1MGSA 1D7QA 5C4HA 1A6XA 3HS0C 3TREA 1Y1VB 1STBA 4KLKA 5ELEA 3G71A 1IW7C 1S40A 3IAYA 3I4NH 3S1QB 4ZAIA 2B63B 2CWPA 3S16B 2F0TA 3J81c 1M90C 2ZTDA 2RDGA 2D0PA 1H9KA 1KQSA 4PG3A 1EZ8A 4BY7B 4GKJL 3RLFA 1STEA 1DGSA 2VNUD 4KY7A 2NVXH 4ID6A 5C5LA 1JCKB 1LT6D 3CXCA 4YHHL 4JI4L 4HJAA 3SK4A 1XTDA 4WJWA 4A4IA 1JQYD 3Q24A 4DV1L 4LUOA 3S1NB 2EYHA 2KOLA 3IKJA 3H94A 3NQTA 1IZ6A 3D6WA 1VQHA 1T5XD 3NUCA 4KN7C 4AIMA 4A3DG 2A19A 3FKIH 5E4WC 1KDAA 2R93B 2BE5D 5C4XB 4JK1C 4C3JH 4ZUJA 4A93G 1I4QA 1F77A 3HOZH 4JVZA 4C2MB 2B2VC 1X55A 1S5CD 1PRTD 1EZ6A 4RKBA 2HDMA 3L0OA 4GNXC 1PYWD 3SK8A 2KBNA 1ILPA 2CCZA 3J7YW 1ET9A 3GQBA 5I2XA 2ASBA 4JI8Q 4FP5D 4L5RC 3ND9A 4DUZL 1RTOA 3BVGA 4L5TA 1BUVT 3W1BA 1EIYB 1EIFA 2EJGC 3QG1A 1VF5C 1I6VC 5DNFA 2E8GA 3LWEA 2KEEA 2PQEA 4MIUA 3GTJH 1KXLA 4KI0A 1HUNA 5K36G 4DV0L 5CV9A 4CHTB 4FYDA 1VQFA 1KDCA 1Y1WH 4POGA 5DAUA 1TWHB 1VQJA 4JI8L 3BYTB 4GN5A 3G48A 4K0KQ 4KKUA 2EYOA 4B3MQ 2BDNA 1ZYRD 3ULPA 3GTMB 5I9OA 1PZKD 5C0XG 2JA6H 2MJ8A 4KJNA 3ICEA 3MXUA 4I7AA 4HAEA 5KYIA 4JYAL 5KGUA 1SYEA 4WORA 5FO9B 2F4IA 1LTSD 3M3YH 2NVTH 4LMQD 4B3ML 1VQBA 2RHSB 3PF4A 3K5LA 3GTGB 4C3HB 4IFDJ 1HNXQ 2VW9A 4DR2Q 1TY2A 1G2TA 2RKSA 4CDEC 4BBRH 2K5VA 3F8TA 3AFPA 3HOXB 1WTHA 4A3MG 2XVSA 3E0EA 4IUQA 2WFWA 2A8VA 4HJ7A 4X3SA 1Y8PB 4KHVA 1E2ZA 1I94L 2QF7A 1PH2A 1PH7A 5AFWA 2NN6G 1QNKA 3FPUB 3V96A 5ELCA 5ELBA 4DR7Q 4FVMA 3UDXA 5H1SE 1TWFB 5JEAH 1HNXL 1N33Q 2NVYH 2F0IA 1F2ZA 3DWPA 3GDEA 4A93B 3K7AB 1IBMQ 3Q22A 5C0XI 2VQFQ 1J5EQ 4QCLA 2K05A 3U9OA 4CKEA 5I9PA 1CKNA 4CJ2C 5IYDG 3OMCA 2EDGA 2G9DA 4PMBA 5EQ0A 1EOTA 2FXQA 2K50A 3AU7A 4NPSA 5FLXE 2I5MX 2MNAA 5LL6S 3S17B 5CYUA 4X3TA 4LW1A 3VYUA 3SK6A 1PH6A 3S15B 1NR4A 4L5SA 3Q0AA 3ER0A 4WFN3 1IBML 1IBLL 4DV3Q 1HJPA 1AFPA 3NPPA 1JOQA 1JB3A 1U9RA 1W3SA 4OELB 3NWSA 2K4KA 1J8IA 5M5YB 1HXYD 3K0YA 3LGJA 2L11A 3D4RA 1TVXA 4DNRB 2HCIA 3NBHB 4IO9A 5IWAL 1HQRD 2NN6I 1XPUA 4YCWA 4I7ZC 3GTPH 3QIAA 4HR7B 4A3CH 1KTKA 3NELA 3TMEA 1GHKA 1EFID 1KL9A 3W5OA 4EVOA 4FO2A 4BXXG 2GA4B 1PFBA 3MTSA 2JP1A 4JW0A 4GOPB 2VQEL 4HIOA 5HGTA 5BR8Q 3H3VI 2X6GA 1KLUD 2B29A 4XQQA 1PTOC 3IFDA 3J81E 4Q5VA 2HT1A 1AZQA 5LMUQ 1A0IA 4CJ0B 3SR1A 4X64L 3A7AB 3URYA 3DUZA 4L6TB 3STBD 3VYTA 2OQ0A 2A6ED 4A3FG 5D14A 3KF8B 3TP5A 2Q2IA 2GN5A 2IPKD 1N9WA 3TSSA 5FLXL 3K7UC 2MP1A 1RD9D 4A3MB 5IGEA 1K3BC 2M2LA 2ZJRA 2CHBD 4R4OA 1X9NA 4MN3A 2EZVA 2IL8A 2AWNA 4NW2A 5CBAE 2NYZD 3RD4A 1BBXC 2SOBA 1WTQA 4IALA 1PREA 1NAPA 4X65L 2A6HC 1YI2A 3NTIA 4L8JA 1SEBD 3DEPA 3NP8A 3J81i 3HOUG 3A74A 4RAUC 2UXCQ 4N9TA 1R9TH 2NUCA 3VR3A 2Q2HA 4ME5A 3JAMc 4YCUA 1O7ZA 3HKZE 5ISRA 4KTAA 2B2UA 5M5WB 1LACA 3ULLA 4AH6A 1CZWA 1PFNA 3KF8A 3D4DA 5GAEC 3H6MA 5IGFA 4DK3C 2DJFC 5KEEA 5BN5A 2PMZE 4LF7L 1OXUA 4R4IA 1RF2D 4ILWA 3ERQA 3RLOA 5EKKA 4BY1G 2L5TA 1P8LA 4JOIA 4IUVA 1N34Q 3J81L 3NWTA 4Y7NB 5ELFA 1BBUA 1IW7D 3DWQA 1X6OA 3GTLH 1VQMA 1B44D 1SJED 3PO3G 4A3BG 1MSHA 2Z9HA 1VQNA 1I3QB 4B3SL 4GZYC 3F2UA 3NENA 2OEOA 1A62A 1HA5A 5IIFA 1UE1A 1SLJA 1X3QA 4V0BA 1N34L 2F3VA 4F7XA 4LJZC 3S14B 1XMQL 1Z7TA 3PIO3 2K5WA 1I6HB 1NSNS 3K6OA 1WVLA 3I4MG 1IYVA 1RIPA 1V8QA 1WCMB 4AYBE 3SGIA 3KLRA 1SFOH 4HN7A 4RFBA 4BBSH 3UDFA 2ZXOA 1XMOQ 4J6HA 1FJGQ 4A3EB 4RCOA 2NZ1D 2YU9B 1JC7A 2JA8G 2CWAA 2SEBD 4A3JH 5C3EH 4LUZA 4OWTB 3K0XA 3MZ5A 5T1GA 1WI5A 1AW7A 3CCMA 3TRZA 2C5CA 1WD0A 1JICA 2XIWA 2FFKB 1G6PA 1IL2A 5FJ8H 2IT1A 3VA5A 3EJIA 4U68A 3U4VA 1RTNA 2EOTA 1BCPB 3M7GA 3NSWA 1C0AA 1VQAA 3K81C 1LO5D 1YNXA 2A69C 1BVSA 4ME3A 3RNUA 3M4OH 4A3LG 2KQ3A 2DUDA 3E0JA 1AZPA 2EVBA 3PCOB 2DN8A 2ZM6Q 1BXTA 2F0NA 5C44G 3HG9A 1S3OA 3P75A 3HKZG 2UXBQ 3H3VH 1SYFA 2B2TA 2K52A 1QNUA 4H13C 4C56C 2MUYA 4DAVA 1G91A 1F9RA 3BDLA 3H15A 1DJRD 1ENFA 3NXWA 5JOBA 3QOJA 2YTVA 4P72A 1ASYA 4LFAQ 1UEBA 2UXBL 1TS5A 2X6LA 3CPWA 3SE0A 2CH4A 2OTJA 2C35B 2J7ZA 2PPBC 3A5UA 1K8AC 1M1KC 5CV5A 3R3OA 1VMPA 4OL7A 2ICIA 1SDFA 4OIJA 1O7IA 1WOCA 3QO2A 4EQ5A 1Q81C 1GKHA 4O42A 4A3BB 4DK6C 3J7A5 5JAVA 2RF4A 1IBKL 2VZAA 1LTAD 2K04A 1FYCA 4IFDI 3FKIG 4BWGB 3RN2A 1IL8A 2M00A 5M3FB 5D3IB 3FPPA 1S5BD 2EPBA 3C1EA 1VQ5A 2SNSA 3K59A 3M85A 1QWYA 1SNOA 3DEOA 2NBFA 4CBVA 4JPBW 4RGTA 1YZ6A 3H91A 1RHPA 4AYBG 1K3RA 2WP8J 1L1OC 1B2TA 3HOVH 1XWEA 1CHPD 4MNOA 5E7NA 2JA8B 1D2BA 4R4CA 1CQFA 4ZKBB 2R61A 3DM3A 1Y1VG 4JI1Q 2UUAQ 2JA5H 3MAQA 1V1PB 2R7DA 4F8MA 4H02A 3B6YA 5IGGA 4DV6L 1TWGH 3PF5A 1CKMA 2UUBL 1WTWA 3KF6A 4O2DA 2AMCB 2K03A 4QB4A 2Q8IB 4JBKA 3BZCA 4G4KA 4V190 1CT1D 5M3MH 3GTQB 1LT3D 4P2CB 1XJVA 1EYAA 1O78A 2A1AA 2OXPA 1CTMA 2O2LD 3X3NA 2ES2A 1CSPA 2KCTA 2KUMA 3HOYH 2UUAL 4C1NK 1FL0A 4ZCKA 4G7OC 4JBJA 1YVCA 4PV1C 3M4PA 1N36L 3HKZB 2DY8A 2F0WA 3GD7A 1LT4D 3Q8DA 3TP8A 3M9BA 5KRUA 4K5VA 1EYDA 2WKCA 2EJFC 2UXDQ 3OSOA 4C1NI 4YWMA 3GTKH 5IODA 3W3AA 1K8GA 1V1PA 2ID0A 3OIQA 4LF8Q 4ZQ3A 4FF2A 1ILQA 2JJQA 2PMZB 4CJ1B 1BKBA 4OGQC 2N78A 4UPAA 1MJCA 1V43A 2VUMH 2TMPA 1PA6A 4HJ9A 2FMMA 5IP7H 4IN3A 2VXWA 3I4OA 2WV6D 2A68C 2E2JB 4LF8L 3ONAB 3PQIA 1HNZQ 2QEJC 4A3GH 3T13A 3MA2B 3GV3A 1NJIC 4XQJA 3CMAA 3FKIB 4XIGS 1UE5A 1SYCA 4DFAA 3DXJC 3VDYA 1YJWA 1XYIA 2OCEA 3MWYW 4C3JB 4H7BA 2KENA 1E3PA 5IP9G 4ALPA 2MHVA 4ZRZA 1KRTA 4HMIA 2F0LA 4UP8A 2GVBA 1HNZL 5G3LF 4YY3Q 1HHVA 1ET6A 2EY6A 4FF1A 5FK9C 3H09A 3KLSA 1DD2A 5E3FA 4QF4A 5CC4A 3FP9A 3T1YQ 3N52A 3H3VC 2MGSA 4JV5L 2H4OA 3K57A 4IPDA 1G291 2HQEA 4DV7Q 1NUCA 2UUCQ 4JI5L 1YHQA 1JE5A 3G6EA 2HHHQ 2Z4HA 4LFBQ 2Q8RE 3I55A 3S2DH 5EJWA 5HURA 1K9MC 2IX1A 1GJXA 5AJ3Q 3GTJB 3BG3A 4YY3L 4POFA 5CBEE 5LMNQ 2BH8A 2RDFA 1Y1WB 4HEDA 4DV7L 4IFDH 1FD7D 5ELNA 3G4NA 1X65A 3S1MH 3AMUA 3V05A 3PUXA 4UDUC 1SNMA 4NB3A 2QW7A 3J7AV 4IUTA 3SXHA 3FDTA 1QZGA 4PQXA 4C3HG 1WYDA 1DXMA 2KEDA 3EVQA 4IURA 5LMNL 3RZDH 1I4RA 1A8VA 3CU7A 1C9OA 2MQHA 3HOXG 2CFMA 1HZBA 2VB2X 1PH9A 4IPHA 1N8RC 1CUKA 1HNWQ 2NVTB 3BYYB 1G51A 4OEMB 2KJXA 5IYCG 2F3WA 2PZWA 1CZGA 1J9OA 3K80C 2ZJPA 4AQYQ 5D3DA 1XNRQ 2CH4W 2BOSA 2Z1CA 5FLMG 3PMFA 1I4GA 4DR5Q 2CW0C 4BBRB 1SMXA 1PV4A 1I4PA 2HIXA 1OXXK 1PTOH 1NY4A 2F0OA 1P16A 4OIKA 3OW7A 3H0GH 1HNWL 3GTOB 2Y0SE 4IQZA 3J81j 1PRTB 3F2BA 2B2WA 4AQYL 1PH3A 4KN4C 1XNRL 3KFUA 2E2HH 3L7ZC 5FKAC 2NVYB 3QR8A 1MI2A 5GAHC 4HSPA 1U4PA 1EQTA 1KNEA 1I50H 4WRDA 5GQOA 1BQQT 4IUUA 4HIMA 2B8FA 1IHZA 3G4SA 1RCVD 4U673 1SJHD 5JPMC 2IW3A 4MHEA 1MHWC 2BDOA 5BN3A 4DGZA 5C6AA 2HDLA 3PUZA 2C9OA 1STAA 2RBMA 3VR2A 2AKWB 3MFYA 1VQ9A 2A69D 2Z0SA 1EWHA 3R8BA 3PO2H 1BF4A 5CV7A 1NMGA 2BA1A 5I6YA 3HOWH 1CK1A 1LTTD 1Y69U 3VR5A 3S1QH 1BCPF 5IYBG 3WOEA 2B63H 1H9JA 3KBXA 1QUQB 4A3KG 4KD4A 3EBEA 2PCFB 4R4QA 1VQIA 1JOKA 1X3PA 4A75A 4JI2Q 4G7HC 3CF5A 4KKTA 2JA7H 3S2HH 4K0KL 1B1ZA 1V9PA 4P71A 1DCZA 4UHVA 2K7VA 3KBGA 3DWAA 3S9WA 2NTTA 1V1QA 5M5XH 5I6WA 3PIP3 4JI3Q 1CQVA 4FXKC 3PGZA 3R93A 2G9HD 2LSSA 2TSSA 4EX5A 1CA5A 2Z6BA 4K8IA 1Q82C 4GS3A 3G6JB 5EKIA 1EEID 1STGA 4QMGA 1QG7A 5CGKA 2LS01 2B39A 1TS4A 4J1MA 2B8GA 4PMWA 1EU4A 2MO1A 2PW5A 2B2YA 2I46A 4DR2L 1GUNA 3CC2A 4KHZA 3S1RH 5NUCA 2EYPA 5C4JH 1C48A 1L2FA 1QVGA 2RSOA 2Y0SG 5LHY1 3N6RA 1VCIA 4CDCC 4DR7L 5IE8A 1GUSA 1TU2B 1LT5D 3ERSX 1RJTA 1N33L 1FVIA 1KNAA 2F0PA 4QY7A 1B3QA 3TDQA 3IFTA 1G6ZA 1R9TB 1STHA 3PSIA 1CHQD 1EQVA 1HR0Q 1M8AA 4EQPA 4DR3Q 3T16A 3CRKC 2IX0A 2VQFL 1J5EL 2L12A 1GHJA 1NBWA 3SVMA 4GKKQ 2R7ZG 1B3AA 2XWJB 1HTLD 1ESRA 3OPOA 1HQMC 1GUTA 1TWHH 1LYLA 3U58A 3MEFA 1HR0L 1Z52A 2F0UA 1EWCA 1VQEA 2R92G 4DV3L 3GTMH 2NVQH 3TS0A 3SK5A 2R6GA 2QCPX 3P20A 4OX9Q 3I3CA 3GTLB 4DNTB 4CDFC 4A3KB 1XPRA 4K2KA 4DN4M 2XSCA 1VQLA 1WCMG 2E2IH 3MFGA 2EXDA 1Q12A 2IHEA 1AEXA 3J7AF 1R4PB 4A3EG 4DXFA 3I2ZA 3GTGH 1FR3A 4FXDA 5IOCA 1LTGD 5IGDA 1H9RA 2YTXA 2F0VA 1KC8C 1J6QA 3NBHA 1W6KA 4DKAC 1A3UA 5BR8L 4M1UB 2RSNA 4BBSB 1LV9A 1STNA 4P75A 4TQUS 5LMUL 2A68D 1ESFA 4X66Q 5C3EB 1IYJB 4GOPA 1TWFH 3R2TA 1QILA 3KLSX 4YCVA 4DK1A 1Q86C 4A3DH 2IWHA 1HCZA 3LWUA 3WDNA 1ENAA 1ONLA 1O7LA 1PH5A 2RQXA 4DV2Q 3EIVA 5GROA 3K7AH 4C3IH 3J7ZC 1MBYA 3Q6SA 2IHFA 2ZXPA 2Y0SB 2VL6A 4OO1G 3I73A 4XDXA 2ICEC 2E2DC 1NCVA 3D3RA 3L2PA 2Q8TA 1E22A 3VR4A 2JQOA 1VQOA 1O80A 1PMRA 4B3TQ 2R7FA 2UXCL 3AB9A 3S15H 4LF9Q 3ND8A 3CCVA 3NE5B 4TRDA 4IOAA 1SR3A 1E2WA 4XT3B 5JEAJ 1MIUA 2A5HA 2IX3A 1UNSA 4XYOA 1QOHA 4RKLA 2R7ZB 2UU9Q 2XWBB 5K36H 4QUCA 1HPCA 1TQOA 2JK8A 4MTKA 3PIPA 1KLGD 2B2WC 1YHAA 2JA9A 4LF9L 4L5QA 3QJYA 4NXMQ 2R92B 3MXPA 1QE6A 1CA6A 2N8NA 5C0XH 5M3FG 3C0NA 3OYYA 1DONA 2QDBA 5FO8B 3G7LA 4XT1B 2Z4IA 5JVG3 3FVQA 1YNNC 3I91A 3PUWA 3OWEB 3CC7A 4A3IG 2BE5C 4JBMA 1QVCA 3KYHC 1PZJD 4KMUC 1RL2A 1SYGA 2ZXRA 2OT2A 2K5NA 3BVMA 2CW0D 3C1FA 1T9HA 4A3MH 1HA6A 2E75C 1E1OA 4I65A 2F4VQ 1XMOL 1OXTA 1FJGL 1EQRA 2NN6H 1A3TA 3M7NA 1HZ9A 5J39A 1IXRA 2F0JA 2IJ0A 1PH4A 5C4ZA 4GNXB 3QWNA 1LUZA 1TWGB 3I4NG 2H5XA 3TQYA 2D9UA 1SROA 2LXKA 1UWVA 5JJKA 2EY2A 1PRTF 1B50A 1QCBD 5M3MB 5HY6A 2F0SA 1BO0A 4LK1C 4DK0A 5IYDH 1IKMA 3CC4A 2I0QA 1ZYRC 5J3BA 1TR5A 2ZM6L 4KJOA 5A2QE 5C3XA 3A8JE 4R1JA 2B2YC 3CCQA 4NXNQ 2KCMA 2L15A 5KYLA 2VY3A 4KD3A 1XNQQ 3OOCA 4LF6Q 1A63A 2P5ZX 3I90A 2B2VA 1FGBD 3NTHA 1NE3A 3CKIB 1TS3A 3CAMA 4GNXA 3RZOB 4RCNA 2JYOA 4J8QA 3T1HQ 2WIIB 3CMEA 4NKLA 1AN8A 1LTLA 5LMNW 1PZID 1EYCA 4NXNL 1GUGA 1TWAB 4HJ8A 2VUMB 1XTCD 4LFAL 4Q0FA 4XXEA 1XNQL 4JC0A 2Z6KA 4CGYB 1G2SA 4C3JG 2QA4A 1TWCB 3HOZG 4BXXH 4DR6Q 1WTVA 4R9WA 2FHTA 1PH1A 2BH2A 2XRQD 4GN4B 2KHIA 4FXGC 4WJ3M 4LWCA 4KHPQ 2AQ3B 2RVLA 4DUYQ 1ML0D 3CQZH 4A3IB 1EY4A 2EYFA 2XGTA 4R8NA 5D65A 4TKOB 1DM0B 3I4LA 2YU9H 1PDQA 4PNYA 2F0EA 2K14A 5J1ZA 1JJCB 1CFMA 1GD7A 4IJHA 4A3FH 4RHRA 4MTNA 4DF7A 1N32Q 2K32A 5DM63 1OO9B 4LF5Q 1K8OA 3C2PA 2ZT9C 5A2QL 4F88A 1JE4A 2NB0A 1EY9A 4DAYB 4HCEA 1Y1WG 3D0FA 2X69A 1NR2A 5LL6X 1YEZA 3CD6A 1YBYA 3T53B 3C3LA 4LFCQ 4JI1L 2I5LX 3AQQA 4N8FA 1EY0A 2IY5B 1N32L 4X62Q 2F0QA 3D6CA 2QDLA 4B3RQ 3HOUH 1D5MC 4ZK9B 3I4NB 1EY6A 2JA6G 2AQ1B 5C3WA 1EY5A 2WB1B 2RHQB 4JI0Q 1YNJC 1K0SA 1K83H 3CW2C 5EPKA 5CV6A 1D5XC 3S1MB 4DAPA 4PZ6A 4DV4Q 3GP7A 4X62L 1D8LA 2NVXB 4GOPC 1H95A 2V4DA 2NZHA 4UAIA 4DAYA 3RZDB 4BY1H 1E2VA 3E5SA 4NDXA 4PZ8A 3OIPA 1F2MA 1K28A 4OONA 4DA2A 3OMGA 4RGNA 2EYMA 4BBRG 2UXDL 2PZUA 2N88A 2B2UC 3EFXD 4B9WA 4XYQA 3HZXA 1WD1A 1SNDA 2VB3X 3DM1A 1L0WA 1QZHA 2WAQE 1TXYA 3PO3H 3AFQA 3WOFA 4A3BH 5K5PA 3CCRA 3CCJA 1OTCA 2D62A 2PI2E 3FMCA 3KDFB 2L9HA 5JEAG 3BS1A 2F52A 2RDHA 1PTOD 1VQCA 1MSGA 2YTYA 4IPGA 4Z9CB 1YIJA 4YIJA 1VQ4A 4JOIC 2M9VA 1PTOB 5CV8A 3L3OC 3HOZB 3PUYA 4N8X1 1JORA 5JJIA 4K2LA 1X54A 3I4MH 1TS2A 2LY7A 3M4QA 1I4XA 2GVAA 2E2HB 1VMCA 2E74C 3HFZB 1YITA 4GN3B 4X3UA 4BS9A 2JA8H 1VQ6A 2OWOA 1RDPD 1E0BA 1W2BA 1HFGA 1CM9A 2R3ZA 3QOLA 4H0LC 2ENBA 2A6HD 2ZTEA 2ZJQA 1KDBA 3WWVA 1K73C 5ELDA 3A7LA 5IT9c 3T1YL 3VR6A 5BN4A 3GTQH 3EQLC 2UUCL 4BA2I 4A3LH 2HHHL 4GKJQ 1TKWB 3PO2B 4LFBL 3KUPA 5C44H 1F9QA 4A3CG 2KCNA 3HOWB 2JA6B 3UI2A 4ZYSA 5AJ3L 1SXTA 1YJNA 2RCFA 2QILA 4YHHQ 4JI4Q 1GVPA 2NZOA 4K6LA 1SBBB 1BR9A 3UE1A 1GOZA 2EY1A 1HR0W 4DV1Q 4GLAC 2SDFA 3DLLA 3M3YB 3S2HB 2JA7B 1W6JA 4KK7A 3TS2A 2N55A 2PYKA 3D8GA 1WTRA 3MXNB 1BOSA 2MPMA 2HD3A 4RGOS 1OXSC 2KA7A 5M5XB 3E9IA 3C0MA 3TN2A 2PNHA 1PYBA 4GLXA 2OQKA 4OXPA 1UEAB 4HIDA 2B2TC 2WAQG 2Z8LA 2E2JH 4APVA 1SE8A 4QGUA 2HCCA 4MZ9A 4HJ5A 3OTOQ 1YNND 5JPNC 3F2DA 3EA6A 3I72A 1BNZA 1JWSD 4DR5L 2G5DA 4XQNA 2EXZA 3S1RB 1BCPC 2SNMA 3K5MA 4DUZQ 3A5ZB 5CV4A 1L0XB 3A8IE 3GO5A 4C3IG 1R4QB 5C4JB 4EQNA 3TEHB 5EBDA 3MXNA 5EBCA 1EWIA 1PH8A 1T5EA 3OTOL 3KJPA 1IKLA 3ZJYC 3U50C 4DV0Q 1STYA 5EPLA 4B08A 1A2TA 2J4XA 2OTLA 2CKZB 1TY0A 1Z47A 1SYBA 2JSOA 3LNNA 1Y1VH 2Z6KC 1D1KA 2AUKA 3AEVA 1Z9FA 2Q2UA 3CCEA 1U4LA 1JOOA 1CSQA 3S16H 1TT2A 3C46A 4OHJA 4JYAQ 4DV5Q 3T4AC 3CP0A 1Z6HA 4X3KA 2XNAC 3ZYYX 2JXMB 1GUOA 3MXGA 1KD1C 3OW2A 4BY7H 3GTPB 1HZAA 1UE7A 2B3GA 4PMCA 5FOBB 2LMCB 4CKCA 2NVQB 4S3SA 2WINB 2KCCA 3V2TA 3ULJA 1Y14B 4DV5L 4RMFA 1DOKA 3I8ZA 2AHOB 2HIVA 4O1NA 2E2IB 5DLQE 1C7YA 3NBIA 4BBSG 4JI2L 3S1NH 1F2YA 2ZTCA 3L9AX 1I94Q 1JB7A 4QL5A 2K5QA 1X32A 1VS0A 1SE4A 2O5IC 1F9PA 2A74C 1IYUA 4A3JG 5C3EG 1D5ZC 1QUQA 1EY7A 4RG1A 1CKNB 3BU2A 2DJGC 4FF3A 2PQAB 2JEAI 4JI3L 1H9SB 1SN8A 2R93H 5C4XH 1EY8A 3SEBA 1LM0A 4IPCA 4M8AA 2RCNA 2CVRA 5FJ8G 4DNIA 4C2MH 1BDOA 1SNQA 2HUGA 2WAQB 3Q23A 1BBWA 1X3EA 3GTOH 4TVAB 2FINB 1FNWA 3CRLC 4LAAA 4R8IA 4JI6Q 1S5DD 3P1HA 1GXDC 5GADC 4A3DB 3TZDA 1Q90A 3HRZC 1Q7YC 2BA0A 1L1OB 1PXUA 5KNDA 1Q8IA 2EYJA 3ITPA 4LUVA 4C3IB 5IP9H 1EU3A 1LABA 1DZ1A 1IBLQ 4ZLTF 1Q8KA 4RH6A 2HQLA 5E1FA 1B9MA 2F0MA 2F0HA 1SMYC 1V1OA 3KK7A 4K5XA 2PQAA 4JI6L 1H9SA 1X56A 1K8MA 4HSVA 3I7FA 3E6ZX 5A35A 5IWAQ 1DOLA 3F1ZA 4RA8A 4DR3L 4HIKA 4OWWB 2PI2A 2KECA 1GO3E 3D31A 1HH2P 1KABA 1A15A 4GKKL 3E9HA 4IJLA 1JWMD 3BVZA 1L1OA 3R2IA 4A76A 1HRJA 2VQEQ 1YNJD 3M4YA 1RODA 2AWOA 1EOVA 1JT8A 5IT9E 1I5FA 1JJ2A 3NK9A 3K5OA 3HKSA 1HZCA 1VDZA 1U5KA 4X64Q 3RMHA 1KIXA 3SHLA 5EAYA 3T51B 5L37A 4C3HH 3F2CA 2K5HA 4OX9L 1Q1BA 4ODGA 4FF4A 5IGCA 5HGQA 1Q1EA 4HMJA 1DOMA 2DNEA 2V1CC 5G3LD 1VQ7A 4PZ7A 3HOXH 5CORA 1SFOB 3HOVG 3UDGA 3NQIA 4KKSA 3G4OA 1D6EC 1KAAA 3VYSA 2ALYB 5KIXA 1PVOA 1YJ9A 1AH9A 1Y8OB 2CQOA 1QB5D 1XXGA 1EYGA 4A3JB 5IYCH 2EE1A 4X65Q 5FLMH 2JA5G 3UE0A 2YYZA 3J80c 1SNCA 1Y8NB 4A93H 3FEWX 2WB1E 2K5DA 3FHWA 2N49A 1VQKA 4DR4Q 5KNBA 5M3MG 3NTKA 4GLVB 5DEHA 2K28A 4X66L 3M4OB 5EGTA 3HOYG 3SDZA 1XX8A 1PTOF 3NEMA
chains in the Genus database with same CATH topology
5EKLA 3A8KE 1F9SA 4L63B 5IT9L 5COYA 4NP5A 2PNRC 1G8ZD 1LLRD 4HCSA 2DNCA 3C0OA 1LTRD 1EIGA 4E6IA 4IZ8A 2FMCA 2XN9C 2KHSA 2JE6I 2JEBI 5E4XA 5T1IA 3A54A 3T56B 1D1IA 4JBWA 4XTCS 4KV6A 4ZUIA 3MVVA 3BDCA 1HTPA 2QKIC 4IUPA 4G7ZC 1SAPA 2L55A 4K8JA 3HGBA 4K6DA 3VYRA 1UUPA 5C5MA 4RHSA 3HP3A 3K58A 3BZDB 3CHBD 1UAPA 4OO1I 1GUWA 2CQAA 3VA7A 2H1EA 2NWGA 1CI3M 1PRTC 3MHBA 2AUJD 5CR3A 1PFMA 4ULLA 1EL0A 3TP6A 3A55A 4G57A 3HOVB 5M9OA 5FO7B 3CQZB 1S5ED 1M4VA 3NHHA 3BDOA 4N9PA 4A3FB 1MD2D 2J0TD 2JA5B 4NMZA 1JWUD 4DXGA 5TSSA 1F2LA 5KNCA 1I4HA 1B9NA 1BCPD 5EPJA 2KVMA 2I07B 3W2DA 2DY7A 1B53A 2BCOA 2NTSA 4IFDG 2L0CA 3TBIB 5IGBA 4K14A 5CMDA 2F0DA 3HOYB 3DMUA 2AQ2B 3HOUB 1EEFD 3I70A 4BA1I 4CKBA 1K83B 3IL8A 1C8CA 3GTKB 3OWFA 2WACA 3MC0B 4BY1B 2D5DA 1LTID 1A2UA 4KY5A 1WTPA 1SYDA 4EGVA 2A73B 2F0GA 2F0KA 3PV0A 3PO3B 4A3GB 3PUVA 1A3VA 1FNVA 1FNUA 1ICWA 4FNFA 2PW7A 4B9XA 5JJZA 2O5JC 4KY6A 3I4MB 3P7JA 1U4RA 3FRPB 5I4DA 4F87A 3A56A 5C0XJ 4IUNA 1Q3LA 4ABNA 2FJ2A 4K5WA 3RUZA 4EQOA 1SSOA 3S2DB 1VF7A 2D2CC 3HEJA 3K5NA 2PO4A 1LTBD 3J80E 2PZTA 4OO1H 2WKDA 1SMYD 1JR0D 5J22A 5F2DA 5C44B 1B4OA 2L1BA 1SE2A 2XRSD 1DYQA 1L0YB 3D4WA 3U9SA 1WTXA 2EYLA 3DHQA 4QIWB 3JAME 1RKNA 1WTOA 1S5FD 3LX0A 3X3MA 1AP0A 1ZKOA 1II3A 2LFNA 2K1BA 3EROA 4RGMA 3TP7A 2A6EC 1TIID 4QUFA 1SE3A 4RWSC 2E76C 3GV6A 2F1MA 5DM73 3H0GB 2EY5A 1ZXTA 3TZUA 2K6AA 2LKVA 4HTHA 1PLFA 1H9MA 2F0FA 2O4XA 4H44C 3J80L 5I2YA 1SNPA 1S4ZA 1I50B 1OXVA 1U4MA 2K33A 1HUMA 1ZEQX 3MEHA 4DU9A 2RA4A 1C4QA 1ENCA 2L4NA 1EIHA 1O7YA 4AYBB 3O13A 5JVH3 2OF1A 4TSSA 3QB3A 1QJOA 2F03A 2K01A 1HFNA 3OHXC 2EJMA 4ZKCB 3JAML 1MGSA 5C4HA 1A6XA 3HS0C 1Y1VB 1STBA 5ELEA 1IW7C 3IAYA 3S1QB 4ZAIA 2B63B 3S16B 2F0TA 2RDGA 1H9KA 1EZ8A 4BY7B 3RLFA 1STEA 2VNUD 4KY7A 4ID6A 5C5LA 1JCKB 1LT6D 3SK4A 4WJWA 1JQYD 3Q24A 3S1NB 2EYHA 2KOLA 3IKJA 3H94A 3NQTA 3D6WA 1T5XD 3NUCA 4KN7C 5E4WC 1KDAA 2R93B 2BE5D 5C4XB 4JK1C 4ZUJA 1I4QA 1F77A 4C2MB 2B2VC 1S5CD 1PRTD 1EZ6A 4RKBA 2HDMA 1PYWD 3SK8A 1ILPA 3J7YW 1ET9A 3GQBA 5I2XA 4FP5D 3ND9A 1RTOA 3BVGA 1BUVT 2EJGC 3QG1A 1VF5C 1I6VC 5DNFA 3LWEA 2KEEA 2PQEA 4MIUA 4KI0A 1HUNA 5K36G 5CV9A 4CHTB 4FYDA 1KDCA 5DAUA 1TWHB 3BYTB 4KKUA 2EYOA 2BDNA 1ZYRD 3GTMB 5I9OA 1PZKD 5C0XG 2MJ8A 4KJNA 3MXUA 4HAEA 5KYIA 5KGUA 1SYEA 4WORA 5FO9B 2F4IA 1LTSD 4LMQD 3K5LA 3GTGB 4C3HB 4IFDJ 1TY2A 1G2TA 2RKSA 3HOXB 2XVSA 4IUQA 4X3SA 1Y8PB 4KHVA 1E2ZA 2QF7A 5AFWA 2NN6G 1QNKA 3FPUB 3V96A 5ELCA 5ELBA 4FVMA 1TWFB 5JEAH 2F0IA 1F2ZA 3DWPA 4A93B 3K7AB 3Q22A 5C0XI 4QCLA 2K05A 3U9OA 4CKEA 5I9PA 4CJ2C 3OMCA 2EDGA 2G9DA 4PMBA 5EQ0A 1EOTA 5FLXE 3AU7A 5LL6S 3S17B 5CYUA 4X3TA 3VYUA 3SK6A 3S15B 1NR4A 3Q0AA 4WFN3 1AFPA 3NPPA 1JOQA 1JB3A 1U9RA 3NWSA 1J8IA 5M5YB 1HXYD 3K0YA 2L11A 3D4RA 1TVXA 4DNRB 2HCIA 1HQRD 2NN6I 4I7ZC 3QIAA 4HR7B 1KTKA 3TMEA 1GHKA 1EFID 4EVOA 4FO2A 2GA4B 1PFBA 3MTSA 2JP1A 5HGTA 2X6GA 1KLUD 4XQQA 1PTOC 3IFDA 3J81E 4Q5VA 1AZQA 4CJ0B 3SR1A 3A7AB 3URYA 3DUZA 4L6TB 3VYTA 2A6ED 5D14A 3TP5A 2IPKD 5FLXL 3TSSA 2MP1A 1RD9D 4A3MB 5IGEA 2M2LA 2CHBD 4MN3A 2EZVA 2IL8A 2AWNA 4NW2A 5CBAE 2NYZD 3RD4A 1BBXC 2SOBA 1WTQA 4IALA 1PREA 1NAPA 2A6HC 3NTIA 4L8JA 1SEBD 3DEPA 3NP8A 4RAUC 4N9TA 2NUCA 3VR3A 4ME5A 1O7ZA 5ISRA 4KTAA 2B2UA 5M5WB 1LACA 1CZWA 1PFNA 3KF8A 3D4DA 3H6MA 5IGFA 5KEEA 5BN5A 1OXUA 1RF2D 4ILWA 3ERQA 5EKKA 2L5TA 4IUVA 3J81L 3NWTA 4Y7NB 5ELFA 1IW7D 3DWQA 1B44D 1SJED 1MSHA 1I3QB 4GZYC 3F2UA 2OEOA 1HA5A 5IIFA 1X3QA 4V0BA 2F3VA 4F7XA 4LJZC 3S14B 1Z7TA 3PIO3 2K5WA 1I6HB 1NSNS 3K6OA 1WVLA 1IYVA 1V8QA 1WCMB 3KLRA 4HN7A 4RFBA 2ZXOA 4J6HA 4A3EB 4RCOA 2NZ1D 2YU9B 1JC7A 2SEBD 3MZ5A 5T1GA 1AW7A 2C5CA 1WD0A 1JICA 2XIWA 2FFKB 2IT1A 3VA5A 3EJIA 4U68A 1RTNA 2EOTA 1BCPB 3M7GA 3NSWA 1LO5D 2A69C 2KQ3A 3E0JA 1AZPA 2EVBA 2DN8A 1BXTA 2F0NA 3HG9A 3P75A 1SYFA 2B2TA 4H13C 1QNUA 4C56C 2MUYA 4DAVA 1G91A 1F9RA 3BDLA 1DJRD 1ENFA 3NXWA 5JOBA 3QOJA 1TS5A 2X6LA 3SE0A 2J7ZA 2PPBC 5CV5A 3R3OA 1VMPA 4OL7A 2ICIA 1SDFA 4OIJA 3QO2A 4O42A 4A3BB 5JAVA 1LTAD 2K04A 1FYCA 4IFDI 4BWGB 1IL8A 2M00A 5M3FB 5D3IB 3FPPA 1S5BD 2EPBA 3C1EA 2SNSA 3K59A 3M85A 1QWYA 1SNOA 3DEOA 2NBFA 4CBVA 4RGTA 3H91A 1RHPA 2WP8J 1B2TA 1XWEA 1CHPD 2JA8B 1D2BA 1CQFA 4ZKBB 2R61A 3MAQA 1V1PB 4F8MA 5IGGA 1WTWA 2K03A 4QB4A 2Q8IB 4G4KA 4V190 1CT1D 3GTQB 1LT3D 4P2CB 1EYAA 1O78A 2OXPA 1CTMA 2O2LD 3X3NA 2KUMA 4C1NK 4G7OC 4PV1C 3HKZB 2DY8A 2F0WA 3GD7A 1LT4D 3TP8A 5KRUA 4K5VA 1EYDA 2WKCA 2EJFC 3OSOA 4C1NI 5IODA 3W3AA 1V1PA 2ID0A 3OIQA 4ZQ3A 4FF2A 1ILQA 2PMZB 4CJ1B 4OGQC 1V43A 2TMPA 2FMMA 4IN3A 2VXWA 2WV6D 2A68C 2E2JB 3ONAB 2QEJC 3T13A 3MA2B 3GV3A 4XQJA 3FKIB 4XIGS 1SYCA 4DFAA 3DXJC 1XYIA 3MWYW 4C3JB 4H7BA 2MHVA 4ZRZA 4HMIA 2F0LA 5G3LF 1HHVA 1ET6A 2EY6A 4FF1A 5FK9C 3H09A 3KLSA 1DD2A 5E3FA 4QF4A 5CC4A 3N52A 3H3VC 2MGSA 2H4OA 3K57A 1G291 2HQEA 1NUCA 2Z4HA 2Q8RE 5EJWA 5HURA 2IX1A 1GJXA 3GTJB 3BG3A 5CBEE 2RDFA 1Y1WB 4HEDA 4IFDH 1FD7D 3G4NA 3AMUA 3V05A 3PUXA 4UDUC 1SNMA 3J7AV 4IUTA 3SXHA 3FDTA 4PQXA 4C3HG 1DXMA 2KEDA 3EVQA 4IURA 1I4RA 3CU7A 2VB2X 2NVTB 3BYYB 2KJXA 2F3WA 2PZWA 1CZGA 1J9OA 5D3DA 2BOSA 2Z1CA 3PMFA 1I4GA 2CW0C 4BBRB 1I4PA 1OXXK 1PTOH 2F0OA 4OIKA 3OW7A 3GTOB 4IQZA 1PRTB 2B2WA 4KN4C 3L7ZC 5FKAC 2NVYB 1MI2A 4HSPA 1U4PA 1EQTA 1KNEA 4WRDA 1BQQT 4IUUA 2B8FA 1IHZA 1RCVD 4U673 1SJHD 5JPMC 2IW3A 4MHEA 2BDOA 5BN3A 4DGZA 5C6AA 2HDLA 3PUZA 2C9OA 1STAA 2RBMA 3VR2A 3MFYA 2A69D 1EWHA 3R8BA 1BF4A 5CV7A 2BA1A 5I6YA 1CK1A 1LTTD 1Y69U 3VR5A 1BCPF 3WOEA 1H9JA 3KBXA 4KD4A 2PCFB 1JOKA 1X3PA 4G7HC 4KKTA 1B1ZA 1DCZA 2K7VA 3KBGA 3DWAA 3S9WA 2NTTA 5I6WA 3PIP3 1CQVA 4FXKC 3R93A 2G9HD 2TSSA 1CA5A 4K8IA 3G6JB 5EKIA 1EEID 1STGA 4QMGA 1QG7A 5CGKA 2LS01 2B39A 1TS4A 4J1MA 2B8GA 4PMWA 1EU4A 2PW5A 2B2YA 2I46A 1GUNA 4KHZA 5NUCA 2EYPA 1C48A 2RSOA 5LHY1 3N6RA 1VCIA 1GUSA 1TU2B 1LT5D 1RJTA 1KNAA 2F0PA 3TDQA 1G6ZA 3IFTA 1R9TB 1STHA 1CHQD 1EQVA 1M8AA 4EQPA 3T16A 3CRKC 2IX0A 2L12A 1GHJA 3SVMA 1B3AA 2XWJB 1HTLD 1ESRA 3OPOA 1HQMC 1GUTA 1Z52A 2F0UA 1EWCA 3SK5A 2R6GA 2QCPX 3P20A 3I3CA 3GTLB 4DNTB 4A3KB 4K2KA 4DN4M 2XSCA 3MFGA 1Q12A 3J7AF 1AEXA 1R4PB 4DXFA 1FR3A 4FXDA 5IOCA 1LTGD 5IGDA 1H9RA 2F0VA 3NBHA 1W6KA 1A3UA 4M1UB 2RSNA 4BBSB 1LV9A 1STNA 4TQUS 2A68D 1ESFA 5C3EB 3R2TA 1QILA 3KLSX 4DK1A 2IWHA 1HCZA 3LWUA 3WDNA 1ENAA 1ONLA 1O7LA 2RQXA 1MBYA 3Q6SA 2ZXPA 2Y0SB 4OO1G 3I73A 4XDXA 2ICEC 2E2DC 1NCVA 3D3RA 2Q8TA 3VR4A 1O80A 1PMRA 3AB9A 3ND8A 3NE5B 4TRDA 4XT3B 1E2WA 5JEAJ 2A5HA 2IX3A 1UNSA 4XYOA 1QOHA 4RKLA 2R7ZB 2XWBB 5K36H 4QUCA 1HPCA 1TQOA 1KLGD 2B2WC 3QJYA 2R92B 3MXPA 1QE6A 1CA6A 5C0XH 3C0NA 1DONA 2QDBA 5FO8B 3G7LA 4XT1B 2Z4IA 5JVG3 3FVQA 1YNNC 3I91A 3PUWA 3OWEB 2BE5C 1PZJD 4KMUC 1SYGA 2ZXRA 2OT2A 3BVMA 2CW0D 3C1FA 1HA6A 2E75C 4I65A 1OXTA 2NN6H 1A3TA 3M7NA 5J39A 2F0JA 2IJ0A 5C4ZA 3QWNA 1TWGB 2D9UA 2EY2A 1PRTF 1B50A 1QCBD 5M3MB 2F0SA 1BO0A 4LK1C 4DK0A 1IKMA 1ZYRC 1TR5A 4KJOA 5A2QE 5C3XA 3A8JE 2B2YC 5KYLA 4KD3A 3OOCA 3I90A 2B2VA 1FGBD 3NTHA 3CKIB 1TS3A 3RZOB 4RCNA 2JYOA 4J8QA 2WIIB 4NKLA 1AN8A 1PZID 1EYCA 1GUGA 1TWAB 2VUMB 1XTCD 4Q0FA 4XXEA 4CGYB 1G2SA 4C3JG 1TWCB 1WTVA 4R9WA 2FHTA 2XRQD 4FXGC 2AQ3B 2RVLA 1ML0D 4A3IB 1EY4A 2EYFA 4R8NA 5D65A 4TKOB 1DM0B 3I4LA 1PDQA 4PNYA 2F0EA 5J1ZA 1CFMA 4RHRA 4DF7A 2K32A 5DM63 1OO9B 1K8OA 3C2PA 2ZT9C 5A2QL 4F88A 1JE4A 2NB0A 1EY9A 4HCEA 2X69A 1NR2A 5LL6X 3C3LA 3T53B 1EY0A 2F0QA 3D6CA 1D5MC 4ZK9B 3I4NB 1EY6A 2AQ1B 5C3WA 1EY5A 2WB1B 1YNJC 5EPKA 5CV6A 1D5XC 3S1MB 4DAPA 3GP7A 2NVXB 2V4DA 4UAIA 4DAYA 3RZDB 1E2VA 3E5SA 4NDXA 3OIPA 1F2MA 4DA2A 3OMGA 4RGNA 2EYMA 2PZUA 2N88A 2B2UC 3EFXD 4B9WA 4XYQA 3HZXA 1WD1A 1SNDA 2VB3X 3DM1A 3WOFA 5K5PA 2D62A 3FMCA 2L9HA 5JEAG 3BS1A 2RDHA 1PTOD 1MSGA 4Z9CB 4YIJA 2M9VA 1PTOB 5CV8A 3L3OC 3HOZB 3PUYA 1JORA 4K2LA 1TS2A 2LY7A 1I4XA 2E2HB 1VMCA 2E74C 4X3UA 4BS9A 1RDPD 1E0BA 1HFGA 1CM9A 2R3ZA 3QOLA 4H0LC 2ENBA 2A6HD 1KDBA 5ELDA 3A7LA 3VR6A 5BN4A 3EQLC 4BA2I 1TKWB 3PO2B 3KUPA 1F9QA 2KCNA 3HOWB 2JA6B 3UI2A 4ZYSA 1SXTA 2QILA 4K6LA 1SBBB 1BR9A 1GOZA 2EY1A 2SDFA 3M3YB 3S2HB 2JA7B 1W6JA 4KK7A 2N55A 2PYKA 3D8GA 1WTRA 1BOSA 2MPMA 4RGOS 1OXSC 2KA7A 5M5XB 3C0MA 3TN2A 1UEAB 2B2TC 2Z8LA 2HCCA 1YNND 5JPNC 3EA6A 3I72A 1BNZA 1JWSD 4XQNA 2EXZA 3S1RB 1BCPC 2SNMA 3K5MA 5CV4A 1L0XB 3A8IE 3GO5A 4C3IG 1R4QB 5C4JB 4EQNA 5EBDA 3MXNA 5EBCA 1T5EA 1IKLA 1STYA 5EPLA 4B08A 1A2TA 2J4XA 1TY0A 1Z47A 1SYBA 2JSOA 3LNNA 1D1KA 2AUKA 1U4LA 1JOOA 1TT2A 3C46A 4OHJA 3T4AC 1Z6HA 4X3KA 2XNAC 3ZYYX 2JXMB 1GUOA 3MXGA 3GTPB 4PMCA 5FOBB 2LMCB 4CKCA 2NVQB 4S3SA 2WINB 2KCCA 3V2TA 1DOKA 3I8ZA 4O1NA 2E2IB 3NBIA 1F2YA 3L9AX 2K5QA 1X32A 1SE4A 2O5IC 1F9PA 2A74C 1IYUA 1D5ZC 1EY7A 4FF3A 2JEAI 1H9SB 1EY8A 3SEBA 4M8AA 2CVRA 1BDOA 1SNQA 2HUGA 2WAQB 3Q23A 2FINB 1FNWA 3CRLC 4LAAA 4R8IA 1S5DD 3P1HA 1GXDC 4A3DB 3TZDA 1Q90A 3HRZC 2BA0A 1PXUA 5KNDA 1Q8IA 2EYJA 3ITPA 4C3IB 1EU3A 1LABA 1DZ1A 4ZLTF 4RH6A 5E1FA 1B9MA 2F0MA 2F0HA 1SMYC 1V1OA 3KK7A 4K5XA 1H9SA 1K8MA 4HSVA 3E6ZX 5A35A 1DOLA 4RA8A 2KECA 3D31A 1KABA 1A15A 1JWMD 3BVZA 3R2IA 1HRJA 1YNJD 3M4YA 1RODA 2AWOA 5IT9E 3NK9A 3K5OA 1VDZA 3RMHA 3SHLA 3T51B 1Q1BA 4ODGA 4FF4A 5IGCA 1Q1EA 4HMJA 1DOMA 2DNEA 5G3LD 5CORA 1SFOB 3NQIA 4KKSA 3G4OA 1D6EC 1KAAA 3VYSA 5KIXA 1Y8OB 1QB5D 1XXGA 4A3JB 2EE1A 2YYZA 1SNCA 1Y8NB 3FEWX 2K5DA 5KNBA 3NTKA 5DEHA 2K28A 3M4OB 5EGTA 3SDZA 1XX8A 1PTOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTC D;  3URY A;  1PTO D;  4L6T B;  1EEF D;  2SEB D;  1JCK B;  1JWS D;  4Z9C B;  1SE2 A;  2R61 A;  2XRS D;  1LT6 D;  3R8B A;  1EWC A;  1Z52 A;  1BCP C;  1DYQ A;  4L63 B;  1L0Y B;  1PTO B;  1V1P B;  1TY2 A;  1L0X B;  1AW7 A;  1CK1 A;  2IPK D;  3C0N A;  1LTT D;  1EU3 A;  1G8Z D;  1LLR D;  3TSS A;  3C0O A;  1BCP F;  1RD9 D;  1LTR D;  1JQY D;  4RH6 A;  1TS2 A;  2XRQ D;  1V1O A;  2CHB D;  1I4X A;  1S5F D;  1CT1 D;  1BCP B;  3MC0 B;  1LT3 D;  2AQ3 B;  1FD7 D;  3MFG A;  3G4N A;  1T5X D;  1LO5 D;  5ELC A;  2J4X A;  3OWE B;  5ELB A;  2O2L D;  4RGM A;  2XN9 C;  4UDU C;  3V05 A;  1B1Z A;  1TY0 A;  1PRE A;  1PZJ D;  4DXF A;  1BXT A;  1SEB D;  1LTI D;  1RDP D;  1SE3 A;  3DWA A;  4RHR A;  2NTT A;  3DWP A;  1LTG D;  1LT4 D;  1I4Q A;  1F77 A;  1CQV A;  1I4R A;  3BVM A;  1S5C D;  1PRT D;  5ELD A;  1JWM D;  3BVZ A;  3R2I A;  2G9H D;  2TSS A;  4OHJ A;  1PYW D;  1V1P A;  3EA6 A;  2XNA C;  1UUP A;  4C56 C;  4RHS A;  1EEI D;  3BYY B;  3BZD B;  1ESF A;  1FNV A;  1FNU A;  3CHB D;  1ET9 A;  1DJR D;  1TS4 A;  1ENF A;  5D3D A;  1RF2 D;  2IJ0 A;  3R2T A;  1QIL A;  3KLS X;  1EU4 A;  3BVG A;  1D5M C;  1I4G A;  1TS5 A;  4ZYS A;  1PRT C;  1SXT A;  2AQ1 B;  1I4P A;  2QIL A;  1PTO H;  3O13 A;  2WV6 D;  4K6L A;  5ELF A;  1SBB B;  4RCO A;  5I4D A;  1PRT F;  4TSS A;  3DWQ A;  1GOZ A;  2ICI A;  4O1N A;  1D5X C;  1B44 D;  1SJE D;  1S5E D;  2QEJ C;  1HXY D;  1PRT B;  1M4V A;  1D6E C;  3G4O A;  1LT5 D;  3BYT B;  3GP7 A;  1LTA D;  5FKA C;  1XXG A;  1HQR D;  1SE4 A;  4BWG B;  1D5Z C;  1HA5 A;  1MD2 D;  4RGO S;  1CHQ D;  1JWU D;  1KTK A;  4DXG A;  5D3I B;  1PZK D;  5ELE A;  1S5B D;  5TSS A;  1EFI D;  4RGN A;  1I4H A;  3C0M A;  1RCV D;  3SEB A;  1BCP D;  1SJH D;  3EFX D;  4RGT A;  1FGB D;  1LTB D;  1UNS A;  1TS3 A;  2RDH A;  3W2D A;  1ET6 A;  5FK9 C;  2RDG A;  2Z8L A;  1KLU D;  2NTS A;  1PTO C;  4RFB A;  1HTL D;  1LTS D;  1FNW A;  1JR0 D;  1KLG D;  1CHP D;  1AN8 A;  1S5D D;  1STE A;  1PZI D;  1PTO F;  2AQ2 B; 
#chains in the Genus database with same CATH topology
 5EKL A;  3S17 H;  4LF7 Q;  1FGU A;  3A8K E;  1F9S A;  4L63 B;  4FDB A;  4DV2 L;  5IT9 L;  5COY A;  4NP5 A;  2PNR C;  1G8Z D;  1AE3 A;  1LLR D;  4HCS A;  2DNC A;  3C0O A;  1NTG A;  4DR4 L;  1LTR D;  4QIW E;  1EIG A;  4E6I A;  4IZ8 A;  3U4Z A;  1PFS A;  1U0L A;  5M5Y H;  4DR1 Q;  4LFC L;  2FMC A;  2XN9 C;  2KHS A;  2I5H A;  4B3T L;  2JE6 I;  2JEB I;  4B3S Q;  5E4X A;  5T1I A;  3A54 A;  2VUM G;  4DAM A;  5IY0 A;  5IP7 G;  1UE6 A;  3T56 B;  3KOJ A;  1D1I A;  4JBW A;  1XMQ Q;  4XTC S;  4KV6 A;  4UP7 A;  5ELO A;  4ZUI A;  3MVV A;  2QEX A;  2UU9 L;  3BDC A;  3I56 A;  5IYB H;  1HTP A;  1QVF A;  2QKI C;  4IUP A;  4G7Z C;  1SAP A;  4A3K H;  4DR1 L;  4X6A H;  2L55 A;  1X3F A;  3CCS A;  4K8J A;  3HGB A;  4A3G G;  4K6D A;  3VYR A;  2EIF A;  1UUP A;  5C5M A;  3JC6 6;  4RHS A;  3HP3 A;  3K58 A;  3BZD B;  1E1T A;  3CHB D;  1UAP A;  4NXM L;  4OO1 I;  4LF4 Q;  4Y52 H;  1GUW A;  4WJ4 A;  3UDI A;  2CQA A;  3VA7 A;  2H1E A;  4DPG A;  2NWG A;  1CI3 M;  1PRT C;  3MHB A;  3AYH B;  2AUJ D;  5CR3 A;  1PFM A;  2YV5 A;  1JJG A;  4ULL A;  1EL0 A;  3TP6 A;  3A55 A;  2XTI A;  4G57 A;  3HOV B;  5M9O A;  1PYS B;  4R4T A;  5FO7 B;  3CQZ B;  1S5E D;  1M4V A;  3NHH A;  3E3X A;  4LF4 L;  2MO0 A;  1KAW A;  3BDO A;  4JG2 A;  4N9P A;  2D0O A;  1VQG A;  4A3F B;  1MD2 D;  2J0T D;  2JA5 B;  4NMZ A;  1JWU D;  4DXG A;  5TSS A;  1F2L A;  5KNC A;  1NNX A;  1I4H A;  1B9N A;  1E24 A;  1BCP D;  2WB1 G;  5EPJ A;  2KVM A;  2I07 B;  3W2D A;  4P74 A;  2DY7 A;  1B53 A;  5M5W H;  2F4V L;  2BCO A;  2NTS A;  4IFD G;  2L0C A;  3TBI B;  1MKH A;  5IGB A;  4K14 A;  5CMD A;  2F0D A;  3HOY B;  3DMU A;  2AQ2 B;  3HOU B;  1EEF D;  3I70 A;  2E5L Q;  4BA1 I;  1JMC A;  4J15 A;  1ASZ A;  4CKB A;  1K83 B;  4O0A A;  4Y7N H;  3IL8 A;  1C8C A;  3GTK B;  3OWF A;  2R7Z H;  2WAC A;  3MC0 B;  3KJO A;  1IBK Q;  2E5L L;  3RLN A;  1I3Q H;  5GAG C;  4BY1 B;  4LNQ A;  2D5D A;  1LTI D;  2QGQ A;  1S72 A;  1A2U A;  4LF6 L;  2R92 H;  4KY5 A;  1WTP A;  3S14 H;  1SYD A;  4EGV A;  2A73 B;  2F0G A;  2F0K A;  1VQ8 A;  1I6H H;  3H0G G;  3PV0 A;  1YHB A;  3CCL A;  3PO3 B;  4A3G B;  3T1H L;  3BZK A;  1WCM H;  3PUV A;  1A3V A;  2KHJ A;  3RR5 A;  1FNV A;  1FNU A;  1K0R A;  1ICW A;  3KF6 B;  4FNF A;  2PW7 A;  4B9X A;  4JI7 Q;  4A3E H;  5JJZ A;  4YWK A;  1ICF B;  2O5J C;  1SRU A;  4KY6 A;  3I4M B;  4DR6 L;  3P7J A;  4DV6 Q;  1U4R A;  3FRP B;  5I4D A;  3CCU A;  4F87 A;  2UUB Q;  3A56 A;  5C0X J;  4KHP L;  4IUN A;  1Q3L A;  4ABN A;  4DUY L;  2F3I A;  2FJ2 A;  2ATW A;  4K5W A;  3RUZ A;  4JI7 L;  4EQO A;  1PHJ A;  1NMF A;  1SSO A;  3S2D B;  3PO2 G;  4LF5 L;  1VF7 A;  3HOW G;  4UP9 A;  1N36 Q;  2D2C C;  4UY8 C;  3HEJ A;  3K5N A;  5JJL A;  4JCV E;  1B7Y B;  2PO4 A;  2B63 G;  3A0J A;  3EN2 A;  1LTB D;  1GM5 A;  3J80 E;  1XPO A;  1VQP A;  1CKO A;  3CPF A;  2PZT A;  4P73 A;  4OO1 H;  1Q46 A;  2WKD A;  1SMY D;  1JR0 D;  3W1G A;  2JA7 G;  5J22 A;  3K8A A;  4BY7 G;  5F2D A;  3IRB A;  4QQB X;  5C44 B;  1B4O A;  2L1B A;  4B3R L;  1SE2 A;  2XRS D;  1AE2 A;  3S24 A;  1DYQ A;  1L0Y B;  3D4W A;  2DGY A;  4JI0 L;  3U9S A;  1WTX A;  2EYL A;  3DHQ A;  4QIW B;  2K75 A;  3JAM E;  3RN5 A;  1RKN A;  1WTO A;  2VS1 A;  3RZO H;  1S5F D;  3LX0 A;  3PIO A;  3X3M A;  1AP0 A;  1ZKO A;  1II3 A;  2LXJ A;  4DV4 L;  1VQD A;  3STB C;  2LFN A;  3ERO A;  2K1B A;  4RGM A;  2MFI A;  3J80 i;  3TP7 A;  2A6E C;  1X3G A;  1TII D;  4IOC A;  1TWA H;  4QUF A;  1SE3 A;  4RWS C;  4YWL A;  2R93 G;  5C4X G;  2E76 C;  3GV6 A;  2F1M A;  1E7Z A;  4QJF A;  5M3F H;  1MJE A;  2JN4 A;  5DM7 3;  1TWC H;  1EUJ A;  2N3S A;  3H0G B;  2EY5 A;  2EQS A;  1ZXT A;  3TZU A;  1EFW A;  1KRS A;  2K6A A;  5FLX c;  1B70 B;  4OWX B;  2LKV A;  4HTH A;  1PLF A;  4CDD C;  3JAM i;  1H9M A;  2Q2T A;  1B8A A;  2F0F A;  4A3I H;  4JV5 Q;  2O4X A;  4H44 C;  3J80 L;  1WJJ A;  5I2Y A;  1SNP A;  1S4Z A;  1I50 B;  4JI5 Q;  1OXV A;  1U4M A;  2K33 A;  1HUM A;  1ZEQ X;  3MEH A;  4DU9 A;  2RA4 A;  1C4Q A;  1ENC A;  2L4N A;  3BJU A;  1EIH A;  1O7Y A;  4AYB B;  3KDF A;  3O13 A;  5JVH 3;  2OF1 A;  3QB3 A;  4TSS A;  1QJO A;  1EQQ A;  2F03 A;  2K01 A;  1WFQ A;  1KHI A;  1HFN A;  3KLW A;  3OHX C;  2EJM A;  4ZKC B;  3JAM L;  1MGS A;  1D7Q A;  5C4H A;  1A6X A;  3HS0 C;  3TRE A;  1Y1V B;  1STB A;  4KLK A;  5ELE A;  3G71 A;  1IW7 C;  1S40 A;  3IAY A;  3I4N H;  3S1Q B;  4ZAI A;  2B63 B;  2CWP A;  3S16 B;  2F0T A;  3J81 c;  1M90 C;  2ZTD A;  2RDG A;  2D0P A;  1H9K A;  1KQS A;  4PG3 A;  1EZ8 A;  4BY7 B;  4GKJ L;  3RLF A;  1STE A;  1DGS A;  2VNU D;  4KY7 A;  2NVX H;  4ID6 A;  5C5L A;  1JCK B;  1LT6 D;  3CXC A;  4YHH L;  4JI4 L;  4HJA A;  3SK4 A;  1XTD A;  4WJW A;  4A4I A;  1JQY D;  3Q24 A;  4DV1 L;  4LUO A;  3S1N B;  2EYH A;  2KOL A;  3IKJ A;  3H94 A;  3NQT A;  1IZ6 A;  3D6W A;  1VQH A;  1T5X D;  3NUC A;  4KN7 C;  4AIM A;  4A3D G;  2A19 A;  3FKI H;  5E4W C;  1KDA A;  2R93 B;  2BE5 D;  5C4X B;  4JK1 C;  4C3J H;  4ZUJ A;  4A93 G;  1I4Q A;  1F77 A;  3HOZ H;  4JVZ A;  4C2M B;  2B2V C;  1X55 A;  1S5C D;  1PRT D;  1EZ6 A;  4RKB A;  2HDM A;  3L0O A;  4GNX C;  1PYW D;  3SK8 A;  2KBN A;  1ILP A;  2CCZ A;  3J7Y W;  1ET9 A;  3GQB A;  5I2X A;  2ASB A;  4JI8 Q;  4FP5 D;  4L5R C;  3ND9 A;  4DUZ L;  1RTO A;  3BVG A;  4L5T A;  1BUV T;  3W1B A;  1EIY B;  1EIF A;  2EJG C;  3QG1 A;  1VF5 C;  1I6V C;  5DNF A;  2E8G A;  3LWE A;  2KEE A;  2PQE A;  4MIU A;  3GTJ H;  1KXL A;  4KI0 A;  1HUN A;  5K36 G;  4DV0 L;  5CV9 A;  4CHT B;  4FYD A;  1VQF A;  1KDC A;  1Y1W H;  4POG A;  5DAU A;  1TWH B;  1VQJ A;  4JI8 L;  3BYT B;  4GN5 A;  3G48 A;  4K0K Q;  4KKU A;  2EYO A;  4B3M Q;  2BDN A;  1ZYR D;  3ULP A;  3GTM B;  5I9O A;  1PZK D;  5C0X G;  2JA6 H;  2MJ8 A;  4KJN A;  3ICE A;  3MXU A;  4I7A A;  4HAE A;  5KYI A;  4JYA L;  5KGU A;  1SYE A;  4WOR A;  5FO9 B;  2F4I A;  1LTS D;  3M3Y H;  2NVT H;  4LMQ D;  4B3M L;  1VQB A;  2RHS B;  3PF4 A;  3K5L A;  3GTG B;  4C3H B;  4IFD J;  1HNX Q;  2VW9 A;  4DR2 Q;  1TY2 A;  1G2T A;  2RKS A;  4CDE C;  4BBR H;  2K5V A;  3F8T A;  3AFP A;  3HOX B;  1WTH A;  4A3M G;  2XVS A;  3E0E A;  4IUQ A;  2WFW A;  2A8V A;  4HJ7 A;  4X3S A;  1Y8P B;  4KHV A;  1E2Z A;  1I94 L;  2QF7 A;  1PH2 A;  1PH7 A;  5AFW A;  2NN6 G;  1QNK A;  3FPU B;  3V96 A;  5ELC A;  5ELB A;  4DR7 Q;  4FVM A;  3UDX A;  5H1S E;  1TWF B;  5JEA H;  1HNX L;  1N33 Q;  2NVY H;  2F0I A;  1F2Z A;  3DWP A;  3GDE A;  4A93 B;  3K7A B;  1IBM Q;  3Q22 A;  5C0X I;  2VQF Q;  1J5E Q;  4QCL A;  2K05 A;  3U9O A;  4CKE A;  5I9P A;  1CKN A;  4CJ2 C;  5IYD G;  3OMC A;  2EDG A;  2G9D A;  4PMB A;  5EQ0 A;  1EOT A;  2FXQ A;  2K50 A;  3AU7 A;  4NPS A;  5FLX E;  2I5M X;  2MNA A;  5LL6 S;  3S17 B;  5CYU A;  4X3T A;  4LW1 A;  3VYU A;  3SK6 A;  1PH6 A;  3S15 B;  1NR4 A;  4L5S A;  3Q0A A;  3ER0 A;  4WFN 3;  1IBM L;  1IBL L;  4DV3 Q;  1HJP A;  1AFP A;  3NPP A;  1JOQ A;  1JB3 A;  1U9R A;  1W3S A;  4OEL B;  3NWS A;  2K4K A;  1J8I A;  5M5Y B;  1HXY D;  3K0Y A;  3LGJ A;  2L11 A;  3D4R A;  1TVX A;  4DNR B;  2HCI A;  3NBH B;  4IO9 A;  5IWA L;  1HQR D;  2NN6 I;  1XPU A;  4YCW A;  4I7Z C;  3GTP H;  3QIA A;  4HR7 B;  4A3C H;  1KTK A;  3NEL A;  3TME A;  1GHK A;  1EFI D;  1KL9 A;  3W5O A;  4EVO A;  4FO2 A;  4BXX G;  2GA4 B;  1PFB A;  3MTS A;  2JP1 A;  4JW0 A;  4GOP B;  2VQE L;  4HIO A;  5HGT A;  5BR8 Q;  3H3V I;  2X6G A;  1KLU D;  2B29 A;  4XQQ A;  1PTO C;  3IFD A;  3J81 E;  4Q5V A;  2HT1 A;  1AZQ A;  5LMU Q;  1A0I A;  4CJ0 B;  3SR1 A;  4X64 L;  3A7A B;  3URY A;  3DUZ A;  4L6T B;  3STB D;  3VYT A;  2OQ0 A;  2A6E D;  4A3F G;  5D14 A;  3KF8 B;  3TP5 A;  2Q2I A;  2GN5 A;  2IPK D;  1N9W A;  3TSS A;  5FLX L;  3K7U C;  2MP1 A;  1RD9 D;  4A3M B;  5IGE A;  1K3B C;  2M2L A;  2ZJR A;  2CHB D;  4R4O A;  1X9N A;  4MN3 A;  2EZV A;  2IL8 A;  2AWN A;  4NW2 A;  5CBA E;  2NYZ D;  3RD4 A;  1BBX C;  2SOB A;  1WTQ A;  4IAL A;  1PRE A;  1NAP A;  4X65 L;  2A6H C;  1YI2 A;  3NTI A;  4L8J A;  1SEB D;  3DEP A;  3NP8 A;  3J81 i;  3HOU G;  3A74 A;  4RAU C;  2UXC Q;  4N9T A;  1R9T H;  2NUC A;  3VR3 A;  2Q2H A;  4ME5 A;  3JAM c;  4YCU A;  1O7Z A;  3HKZ E;  5ISR A;  4KTA A;  2B2U A;  5M5W B;  1LAC A;  3ULL A;  4AH6 A;  1CZW A;  1PFN A;  3KF8 A;  3D4D A;  5GAE C;  3H6M A;  5IGF A;  4DK3 C;  2DJF C;  5KEE A;  5BN5 A;  2PMZ E;  4LF7 L;  1OXU A;  4R4I A;  1RF2 D;  4ILW A;  3ERQ A;  3RLO A;  5EKK A;  4BY1 G;  2L5T A;  1P8L A;  4JOI A;  4IUV A;  1N34 Q;  3J81 L;  3NWT A;  4Y7N B;  5ELF A;  1BBU A;  1IW7 D;  3DWQ A;  1X6O A;  3GTL H;  1VQM A;  1B44 D;  1SJE D;  3PO3 G;  4A3B G;  1MSH A;  2Z9H A;  1VQN A;  1I3Q B;  4B3S L;  4GZY C;  3F2U A;  3NEN A;  2OEO A;  1A62 A;  1HA5 A;  5IIF A;  1UE1 A;  1SLJ A;  1X3Q A;  4V0B A;  1N34 L;  2F3V A;  4F7X A;  4LJZ C;  3S14 B;  1XMQ L;  1Z7T A;  3PIO 3;  2K5W A;  1I6H B;  1NSN S;  3K6O A;  1WVL A;  3I4M G;  1IYV A;  1RIP A;  1V8Q A;  1WCM B;  4AYB E;  3SGI A;  3KLR A;  1SFO H;  4HN7 A;  4RFB A;  4BBS H;  3UDF A;  2ZXO A;  1XMO Q;  4J6H A;  1FJG Q;  4A3E B;  4RCO A;  2NZ1 D;  2YU9 B;  1JC7 A;  2JA8 G;  2CWA A;  2SEB D;  4A3J H;  5C3E H;  4LUZ A;  4OWT B;  3K0X A;  3MZ5 A;  5T1G A;  1WI5 A;  1AW7 A;  3CCM A;  3TRZ A;  2C5C A;  1WD0 A;  1JIC A;  2XIW A;  2FFK B;  1G6P A;  1IL2 A;  5FJ8 H;  2IT1 A;  3VA5 A;  3EJI A;  4U68 A;  3U4V A;  1RTN A;  2EOT A;  1BCP B;  3M7G A;  3NSW A;  1C0A A;  1VQA A;  3K81 C;  1LO5 D;  1YNX A;  2A69 C;  1BVS A;  4ME3 A;  3RNU A;  3M4O H;  4A3L G;  2KQ3 A;  2DUD A;  3E0J A;  1AZP A;  2EVB A;  3PCO B;  2DN8 A;  2ZM6 Q;  1BXT A;  2F0N A;  5C44 G;  3HG9 A;  1S3O A;  3P75 A;  3HKZ G;  2UXB Q;  3H3V H;  1SYF A;  2B2T A;  2K52 A;  1QNU A;  4H13 C;  4C56 C;  2MUY A;  4DAV A;  1G91 A;  1F9R A;  3BDL A;  3H15 A;  1DJR D;  1ENF A;  3NXW A;  5JOB A;  3QOJ A;  2YTV A;  4P72 A;  1ASY A;  4LFA Q;  1UEB A;  2UXB L;  1TS5 A;  2X6L A;  3CPW A;  3SE0 A;  2CH4 A;  2OTJ A;  2C35 B;  2J7Z A;  2PPB C;  3A5U A;  1K8A C;  1M1K C;  5CV5 A;  3R3O A;  1VMP A;  4OL7 A;  2ICI A;  1SDF A;  4OIJ A;  1O7I A;  1WOC A;  3QO2 A;  4EQ5 A;  1Q81 C;  1GKH A;  4O42 A;  4A3B B;  4DK6 C;  3J7A 5;  5JAV A;  2RF4 A;  1IBK L;  2VZA A;  1LTA D;  2K04 A;  1FYC A;  4IFD I;  3FKI G;  4BWG B;  3RN2 A;  1IL8 A;  2M00 A;  5M3F B;  5D3I B;  3FPP A;  1S5B D;  2EPB A;  3C1E A;  1VQ5 A;  2SNS A;  3K59 A;  3M85 A;  1QWY A;  1SNO A;  3DEO A;  2NBF A;  4CBV A;  4JPB W;  4RGT A;  1YZ6 A;  3H91 A;  1RHP A;  4AYB G;  1K3R A;  2WP8 J;  1L1O C;  1B2T A;  3HOV H;  1XWE A;  1CHP D;  4MNO A;  5E7N A;  2JA8 B;  1D2B A;  4R4C A;  1CQF A;  4ZKB B;  2R61 A;  3DM3 A;  1Y1V G;  4JI1 Q;  2UUA Q;  2JA5 H;  3MAQ A;  1V1P B;  2R7D A;  4F8M A;  4H02 A;  3B6Y A;  5IGG A;  4DV6 L;  1TWG H;  3PF5 A;  1CKM A;  2UUB L;  1WTW A;  3KF6 A;  4O2D A;  2AMC B;  2K03 A;  4QB4 A;  2Q8I B;  4JBK A;  3BZC A;  4G4K A;  4V19 0;  1CT1 D;  5M3M H;  3GTQ B;  1LT3 D;  4P2C B;  1XJV A;  1EYA A;  1O78 A;  2A1A A;  2OXP A;  1CTM A;  2O2L D;  3X3N A;  2ES2 A;  1CSP A;  2KCT A;  2KUM A;  3HOY H;  2UUA L;  4C1N K;  1FL0 A;  4ZCK A;  4G7O C;  4JBJ A;  1YVC A;  4PV1 C;  3M4P A;  1N36 L;  3HKZ B;  2DY8 A;  2F0W A;  3GD7 A;  1LT4 D;  3Q8D A;  3TP8 A;  3M9B A;  5KRU A;  4K5V A;  1EYD A;  2WKC A;  2EJF C;  2UXD Q;  3OSO A;  4C1N I;  4YWM A;  3GTK H;  5IOD A;  3W3A A;  1K8G A;  1V1P A;  2ID0 A;  3OIQ A;  4LF8 Q;  4ZQ3 A;  4FF2 A;  1ILQ A;  2JJQ A;  2PMZ B;  4CJ1 B;  1BKB A;  4OGQ C;  2N78 A;  4UPA A;  1MJC A;  1V43 A;  2VUM H;  2TMP A;  1PA6 A;  4HJ9 A;  2FMM A;  5IP7 H;  4IN3 A;  2VXW A;  3I4O A;  2WV6 D;  2A68 C;  2E2J B;  4LF8 L;  3ONA B;  3PQI A;  1HNZ Q;  2QEJ C;  4A3G H;  3T13 A;  3MA2 B;  3GV3 A;  1NJI C;  4XQJ A;  3CMA A;  3FKI B;  4XIG S;  1UE5 A;  1SYC A;  4DFA A;  3DXJ C;  3VDY A;  1YJW A;  1XYI A;  2OCE A;  3MWY W;  4C3J B;  4H7B A;  2KEN A;  1E3P A;  5IP9 G;  4ALP A;  2MHV A;  4ZRZ A;  1KRT A;  4HMI A;  2F0L A;  4UP8 A;  2GVB A;  1HNZ L;  5G3L F;  4YY3 Q;  1HHV A;  1ET6 A;  2EY6 A;  4FF1 A;  5FK9 C;  3H09 A;  3KLS A;  1DD2 A;  5E3F A;  4QF4 A;  5CC4 A;  3FP9 A;  3T1Y Q;  3N52 A;  3H3V C;  2MGS A;  4JV5 L;  2H4O A;  3K57 A;  4IPD A;  1G29 1;  2HQE A;  4DV7 Q;  1NUC A;  2UUC Q;  4JI5 L;  1YHQ A;  1JE5 A;  3G6E A;  2HHH Q;  2Z4H A;  4LFB Q;  2Q8R E;  3I55 A;  3S2D H;  5EJW A;  5HUR A;  1K9M C;  2IX1 A;  1GJX A;  5AJ3 Q;  3GTJ B;  3BG3 A;  4YY3 L;  4POF A;  5CBE E;  5LMN Q;  2BH8 A;  2RDF A;  1Y1W B;  4HED A;  4DV7 L;  4IFD H;  1FD7 D;  5ELN A;  3G4N A;  1X65 A;  3S1M H;  3AMU A;  3V05 A;  3PUX A;  4UDU C;  1SNM A;  4NB3 A;  2QW7 A;  3J7A V;  4IUT A;  3SXH A;  3FDT A;  1QZG A;  4PQX A;  4C3H G;  1WYD A;  1DXM A;  2KED A;  3EVQ A;  4IUR A;  5LMN L;  3RZD H;  1I4R A;  1A8V A;  3CU7 A;  1C9O A;  2MQH A;  3HOX G;  2CFM A;  1HZB A;  2VB2 X;  1PH9 A;  4IPH A;  1N8R C;  1CUK A;  1HNW Q;  2NVT B;  3BYY B;  1G51 A;  4OEM B;  2KJX A;  5IYC G;  2F3W A;  2PZW A;  1CZG A;  1J9O A;  3K80 C;  2ZJP A;  4AQY Q;  5D3D A;  1XNR Q;  2CH4 W;  2BOS A;  2Z1C A;  5FLM G;  3PMF A;  1I4G A;  4DR5 Q;  2CW0 C;  4BBR B;  1SMX A;  1PV4 A;  1I4P A;  2HIX A;  1OXX K;  1PTO H;  1NY4 A;  2F0O A;  1P16 A;  4OIK A;  3OW7 A;  3H0G H;  1HNW L;  3GTO B;  2Y0S E;  4IQZ A;  3J81 j;  1PRT B;  3F2B A;  2B2W A;  4AQY L;  1PH3 A;  4KN4 C;  1XNR L;  3KFU A;  2E2H H;  3L7Z C;  5FKA C;  2NVY B;  3QR8 A;  1MI2 A;  5GAH C;  4HSP A;  1U4P A;  1EQT A;  1KNE A;  1I50 H;  4WRD A;  5GQO A;  1BQQ T;  4IUU A;  4HIM A;  2B8F A;  1IHZ A;  3G4S A;  1RCV D;  4U67 3;  1SJH D;  5JPM C;  2IW3 A;  4MHE A;  1MHW C;  2BDO A;  5BN3 A;  4DGZ A;  5C6A A;  2HDL A;  3PUZ A;  2C9O A;  1STA A;  2RBM A;  3VR2 A;  2AKW B;  3MFY A;  1VQ9 A;  2A69 D;  2Z0S A;  1EWH A;  3R8B A;  3PO2 H;  1BF4 A;  5CV7 A;  1NMG A;  2BA1 A;  5I6Y A;  3HOW H;  1CK1 A;  1LTT D;  1Y69 U;  3VR5 A;  3S1Q H;  1BCP F;  5IYB G;  3WOE A;  2B63 H;  1H9J A;  3KBX A;  1QUQ B;  4A3K G;  4KD4 A;  3EBE A;  2PCF B;  4R4Q A;  1VQI A;  1JOK A;  1X3P A;  4A75 A;  4JI2 Q;  4G7H C;  3CF5 A;  4KKT A;  2JA7 H;  3S2H H;  4K0K L;  1B1Z A;  1V9P A;  4P71 A;  1DCZ A;  4UHV A;  2K7V A;  3KBG A;  3DWA A;  3S9W A;  2NTT A;  1V1Q A;  5M5X H;  5I6W A;  3PIP 3;  4JI3 Q;  1CQV A;  4FXK C;  3PGZ A;  3R93 A;  2G9H D;  2LSS A;  2TSS A;  4EX5 A;  1CA5 A;  2Z6B A;  4K8I A;  1Q82 C;  4GS3 A;  3G6J B;  5EKI A;  1EEI D;  1STG A;  4QMG A;  1QG7 A;  5CGK A;  2LS0 1;  2B39 A;  1TS4 A;  4J1M A;  2B8G A;  4PMW A;  1EU4 A;  2MO1 A;  2PW5 A;  2B2Y A;  2I46 A;  4DR2 L;  1GUN A;  3CC2 A;  4KHZ A;  3S1R H;  5NUC A;  2EYP A;  5C4J H;  1C48 A;  1L2F A;  1QVG A;  2RSO A;  2Y0S G;  5LHY 1;  3N6R A;  1VCI A;  4CDC C;  4DR7 L;  5IE8 A;  1GUS A;  1TU2 B;  1LT5 D;  3ERS X;  1RJT A;  1N33 L;  1FVI A;  1KNA A;  2F0P A;  4QY7 A;  1B3Q A;  3TDQ A;  3IFT A;  1G6Z A;  1R9T B;  1STH A;  3PSI A;  1CHQ D;  1EQV A;  1HR0 Q;  1M8A A;  4EQP A;  4DR3 Q;  3T16 A;  3CRK C;  2IX0 A;  2VQF L;  1J5E L;  2L12 A;  1GHJ A;  1NBW A;  3SVM A;  4GKK Q;  2R7Z G;  1B3A A;  2XWJ B;  1HTL D;  1ESR A;  3OPO A;  1HQM C;  1GUT A;  1TWH H;  1LYL A;  3U58 A;  3MEF A;  1HR0 L;  1Z52 A;  2F0U A;  1EWC A;  1VQE A;  2R92 G;  4DV3 L;  3GTM H;  2NVQ H;  3TS0 A;  3SK5 A;  2R6G A;  2QCP X;  3P20 A;  4OX9 Q;  3I3C A;  3GTL B;  4DNT B;  4CDF C;  4A3K B;  1XPR A;  4K2K A;  4DN4 M;  2XSC A;  1VQL A;  1WCM G;  2E2I H;  3MFG A;  2EXD A;  1Q12 A;  2IHE A;  1AEX A;  3J7A F;  1R4P B;  4A3E G;  4DXF A;  3I2Z A;  3GTG H;  1FR3 A;  4FXD A;  5IOC A;  1LTG D;  5IGD A;  1H9R A;  2YTX A;  2F0V A;  1KC8 C;  1J6Q A;  3NBH A;  1W6K A;  4DKA C;  1A3U A;  5BR8 L;  4M1U B;  2RSN A;  4BBS B;  1LV9 A;  1STN A;  4P75 A;  4TQU S;  5LMU L;  2A68 D;  1ESF A;  4X66 Q;  5C3E B;  1IYJ B;  4GOP A;  1TWF H;  3R2T A;  1QIL A;  3KLS X;  4YCV A;  4DK1 A;  1Q86 C;  4A3D H;  2IWH A;  1HCZ A;  3LWU A;  3WDN A;  1ENA A;  1ONL A;  1O7L A;  1PH5 A;  2RQX A;  4DV2 Q;  3EIV A;  5GRO A;  3K7A H;  4C3I H;  3J7Z C;  1MBY A;  3Q6S A;  2IHF A;  2ZXP A;  2Y0S B;  2VL6 A;  4OO1 G;  3I73 A;  4XDX A;  2ICE C;  2E2D C;  1NCV A;  3D3R A;  3L2P A;  2Q8T A;  1E22 A;  3VR4 A;  2JQO A;  1VQO A;  1O80 A;  1PMR A;  4B3T Q;  2R7F A;  2UXC L;  3AB9 A;  3S15 H;  4LF9 Q;  3ND8 A;  3CCV A;  3NE5 B;  4TRD A;  4IOA A;  1SR3 A;  1E2W A;  4XT3 B;  5JEA J;  1MIU A;  2A5H A;  2IX3 A;  1UNS A;  4XYO A;  1QOH A;  4RKL A;  2R7Z B;  2UU9 Q;  2XWB B;  5K36 H;  4QUC A;  1HPC A;  1TQO A;  2JK8 A;  4MTK A;  3PIP A;  1KLG D;  2B2W C;  1YHA A;  2JA9 A;  4LF9 L;  4L5Q A;  3QJY A;  4NXM Q;  2R92 B;  3MXP A;  1QE6 A;  1CA6 A;  2N8N A;  5C0X H;  5M3F G;  3C0N A;  3OYY A;  1DON A;  2QDB A;  5FO8 B;  3G7L A;  4XT1 B;  2Z4I A;  5JVG 3;  3FVQ A;  1YNN C;  3I91 A;  3PUW A;  3OWE B;  3CC7 A;  4A3I G;  2BE5 C;  4JBM A;  1QVC A;  3KYH C;  1PZJ D;  4KMU C;  1RL2 A;  1SYG A;  2ZXR A;  2OT2 A;  2K5N A;  3BVM A;  2CW0 D;  3C1F A;  1T9H A;  4A3M H;  1HA6 A;  2E75 C;  1E1O A;  4I65 A;  2F4V Q;  1XMO L;  1OXT A;  1FJG L;  1EQR A;  2NN6 H;  1A3T A;  3M7N A;  1HZ9 A;  5J39 A;  1IXR A;  2F0J A;  2IJ0 A;  1PH4 A;  5C4Z A;  4GNX B;  3QWN A;  1LUZ A;  1TWG B;  3I4N G;  2H5X A;  3TQY A;  2D9U A;  1SRO A;  2LXK A;  1UWV A;  5JJK A;  2EY2 A;  1PRT F;  1B50 A;  1QCB D;  5M3M B;  5HY6 A;  2F0S A;  1BO0 A;  4LK1 C;  4DK0 A;  5IYD H;  1IKM A;  3CC4 A;  2I0Q A;  1ZYR C;  5J3B A;  1TR5 A;  2ZM6 L;  4KJO A;  5A2Q E;  5C3X A;  3A8J E;  4R1J A;  2B2Y C;  3CCQ A;  4NXN Q;  2KCM A;  2L15 A;  5KYL A;  2VY3 A;  4KD3 A;  1XNQ Q;  3OOC A;  4LF6 Q;  1A63 A;  2P5Z X;  3I90 A;  2B2V A;  1FGB D;  3NTH A;  1NE3 A;  3CKI B;  1TS3 A;  3CAM A;  4GNX A;  3RZO B;  4RCN A;  2JYO A;  4J8Q A;  3T1H Q;  2WII B;  3CME A;  4NKL A;  1AN8 A;  1LTL A;  5LMN W;  1PZI D;  1EYC A;  4NXN L;  1GUG A;  1TWA B;  4HJ8 A;  2VUM B;  1XTC D;  4LFA L;  4Q0F A;  4XXE A;  1XNQ L;  4JC0 A;  2Z6K A;  4CGY B;  1G2S A;  4C3J G;  2QA4 A;  1TWC B;  3HOZ G;  4BXX H;  4DR6 Q;  1WTV A;  4R9W A;  2FHT A;  1PH1 A;  2BH2 A;  2XRQ D;  4GN4 B;  2KHI A;  4FXG C;  4WJ3 M;  4LWC A;  4KHP Q;  2AQ3 B;  2RVL A;  4DUY Q;  1ML0 D;  3CQZ H;  4A3I B;  1EY4 A;  2EYF A;  2XGT A;  4R8N A;  5D65 A;  4TKO B;  1DM0 B;  3I4L A;  2YU9 H;  1PDQ A;  4PNY A;  2F0E A;  2K14 A;  5J1Z A;  1JJC B;  1CFM A;  1GD7 A;  4IJH A;  4A3F H;  4RHR A;  4MTN A;  4DF7 A;  1N32 Q;  2K32 A;  5DM6 3;  1OO9 B;  4LF5 Q;  1K8O A;  3C2P A;  2ZT9 C;  5A2Q L;  4F88 A;  1JE4 A;  2NB0 A;  1EY9 A;  4DAY B;  4HCE A;  1Y1W G;  3D0F A;  2X69 A;  1NR2 A;  5LL6 X;  1YEZ A;  3CD6 A;  1YBY A;  3T53 B;  3C3L A;  4LFC Q;  4JI1 L;  2I5L X;  3AQQ A;  4N8F A;  1EY0 A;  2IY5 B;  1N32 L;  4X62 Q;  2F0Q A;  3D6C A;  2QDL A;  4B3R Q;  3HOU H;  1D5M C;  4ZK9 B;  3I4N B;  1EY6 A;  2JA6 G;  2AQ1 B;  5C3W A;  1EY5 A;  2WB1 B;  2RHQ B;  4JI0 Q;  1YNJ C;  1K0S A;  1K83 H;  3CW2 C;  5EPK A;  5CV6 A;  1D5X C;  3S1M B;  4DAP A;  4PZ6 A;  4DV4 Q;  3GP7 A;  4X62 L;  1D8L A;  2NVX B;  4GOP C;  1H95 A;  2V4D A;  2NZH A;  4UAI A;  4DAY A;  3RZD B;  4BY1 H;  1E2V A;  3E5S A;  4NDX A;  4PZ8 A;  3OIP A;  1F2M A;  1K28 A;  4OON A;  4DA2 A;  3OMG A;  4RGN A;  2EYM A;  4BBR G;  2UXD L;  2PZU A;  2N88 A;  2B2U C;  3EFX D;  4B9W A;  4XYQ A;  3HZX A;  1WD1 A;  1SND A;  2VB3 X;  3DM1 A;  1L0W A;  1QZH A;  2WAQ E;  1TXY A;  3PO3 H;  3AFQ A;  3WOF A;  4A3B H;  5K5P A;  3CCR A;  3CCJ A;  1OTC A;  2D62 A;  2PI2 E;  3FMC A;  3KDF B;  2L9H A;  5JEA G;  3BS1 A;  2F52 A;  2RDH A;  1PTO D;  1VQC A;  1MSG A;  2YTY A;  4IPG A;  4Z9C B;  1YIJ A;  4YIJ A;  1VQ4 A;  4JOI C;  2M9V A;  1PTO B;  5CV8 A;  3L3O C;  3HOZ B;  3PUY A;  4N8X 1;  1JOR A;  5JJI A;  4K2L A;  1X54 A;  3I4M H;  1TS2 A;  2LY7 A;  3M4Q A;  1I4X A;  2GVA A;  2E2H B;  1VMC A;  2E74 C;  3HFZ B;  1YIT A;  4GN3 B;  4X3U A;  4BS9 A;  2JA8 H;  1VQ6 A;  2OWO A;  1RDP D;  1E0B A;  1W2B A;  1HFG A;  1CM9 A;  2R3Z A;  3QOL A;  4H0L C;  2ENB A;  2A6H D;  2ZTE A;  2ZJQ A;  1KDB A;  3WWV A;  1K73 C;  5ELD A;  3A7L A;  5IT9 c;  3T1Y L;  3VR6 A;  5BN4 A;  3GTQ H;  3EQL C;  2UUC L;  4BA2 I;  4A3L H;  2HHH L;  4GKJ Q;  1TKW B;  3PO2 B;  4LFB L;  3KUP A;  5C44 H;  1F9Q A;  4A3C G;  2KCN A;  3HOW B;  2JA6 B;  3UI2 A;  4ZYS A;  5AJ3 L;  1SXT A;  1YJN A;  2RCF A;  2QIL A;  4YHH Q;  4JI4 Q;  1GVP A;  2NZO A;  4K6L A;  1SBB B;  1BR9 A;  3UE1 A;  1GOZ A;  2EY1 A;  1HR0 W;  4DV1 Q;  4GLA C;  2SDF A;  3DLL A;  3M3Y B;  3S2H B;  2JA7 B;  1W6J A;  4KK7 A;  3TS2 A;  2N55 A;  2PYK A;  3D8G A;  1WTR A;  3MXN B;  1BOS A;  2MPM A;  2HD3 A;  4RGO S;  1OXS C;  2KA7 A;  5M5X B;  3E9I A;  3C0M A;  3TN2 A;  2PNH A;  1PYB A;  4GLX A;  2OQK A;  4OXP A;  1UEA B;  4HID A;  2B2T C;  2WAQ G;  2Z8L A;  2E2J H;  4APV A;  1SE8 A;  4QGU A;  2HCC A;  4MZ9 A;  4HJ5 A;  3OTO Q;  1YNN D;  5JPN C;  3F2D A;  3EA6 A;  3I72 A;  1BNZ A;  1JWS D;  4DR5 L;  2G5D A;  4XQN A;  2EXZ A;  3S1R B;  1BCP C;  2SNM A;  3K5M A;  4DUZ Q;  3A5Z B;  5CV4 A;  1L0X B;  3A8I E;  3GO5 A;  4C3I G;  1R4Q B;  5C4J B;  4EQN A;  3TEH B;  5EBD A;  3MXN A;  5EBC A;  1EWI A;  1PH8 A;  1T5E A;  3OTO L;  3KJP A;  1IKL A;  3ZJY C;  3U50 C;  4DV0 Q;  1STY A;  5EPL A;  4B08 A;  1A2T A;  2J4X A;  2OTL A;  2CKZ B;  1TY0 A;  1Z47 A;  1SYB A;  2JSO A;  3LNN A;  1Y1V H;  2Z6K C;  1D1K A;  2AUK A;  3AEV A;  1Z9F A;  2Q2U A;  3CCE A;  1U4L A;  1JOO A;  1CSQ A;  3S16 H;  1TT2 A;  3C46 A;  4OHJ A;  4JYA Q;  4DV5 Q;  3T4A C;  3CP0 A;  1Z6H A;  4X3K A;  2XNA C;  3ZYY X;  2JXM B;  1GUO A;  3MXG A;  1KD1 C;  3OW2 A;  4BY7 H;  3GTP B;  1HZA A;  1UE7 A;  2B3G A;  4PMC A;  5FOB B;  2LMC B;  4CKC A;  2NVQ B;  4S3S A;  2WIN B;  2KCC A;  3V2T A;  3ULJ A;  1Y14 B;  4DV5 L;  4RMF A;  1DOK A;  3I8Z A;  2AHO B;  2HIV A;  4O1N A;  2E2I B;  5DLQ E;  1C7Y A;  3NBI A;  4BBS G;  4JI2 L;  3S1N H;  1F2Y A;  2ZTC A;  3L9A X;  1I94 Q;  1JB7 A;  4QL5 A;  2K5Q A;  1X32 A;  1VS0 A;  1SE4 A;  2O5I C;  1F9P A;  2A74 C;  1IYU A;  4A3J G;  5C3E G;  1D5Z C;  1QUQ A;  1EY7 A;  4RG1 A;  1CKN B;  3BU2 A;  2DJG C;  4FF3 A;  2PQA B;  2JEA I;  4JI3 L;  1H9S B;  1SN8 A;  2R93 H;  5C4X H;  1EY8 A;  3SEB A;  1LM0 A;  4IPC A;  4M8A A;  2RCN A;  2CVR A;  5FJ8 G;  4DNI A;  4C2M H;  1BDO A;  1SNQ A;  2HUG A;  2WAQ B;  3Q23 A;  1BBW A;  1X3E A;  3GTO H;  4TVA B;  2FIN B;  1FNW A;  3CRL C;  4LAA A;  4R8I A;  4JI6 Q;  1S5D D;  3P1H A;  1GXD C;  5GAD C;  4A3D B;  3TZD A;  1Q90 A;  3HRZ C;  1Q7Y C;  2BA0 A;  1L1O B;  1PXU A;  5KND A;  1Q8I A;  2EYJ A;  3ITP A;  4LUV A;  4C3I B;  5IP9 H;  1EU3 A;  1LAB A;  1DZ1 A;  1IBL Q;  4ZLT F;  1Q8K A;  4RH6 A;  2HQL A;  5E1F A;  1B9M A;  2F0M A;  2F0H A;  1SMY C;  1V1O A;  3KK7 A;  4K5X A;  2PQA A;  4JI6 L;  1H9S A;  1X56 A;  1K8M A;  4HSV A;  3I7F A;  3E6Z X;  5A35 A;  5IWA Q;  1DOL A;  3F1Z A;  4RA8 A;  4DR3 L;  4HIK A;  4OWW B;  2PI2 A;  2KEC A;  1GO3 E;  3D31 A;  1HH2 P;  1KAB A;  1A15 A;  4GKK L;  3E9H A;  4IJL A;  1JWM D;  3BVZ A;  1L1O A;  3R2I A;  4A76 A;  1HRJ A;  2VQE Q;  1YNJ D;  3M4Y A;  1ROD A;  2AWO A;  1EOV A;  1JT8 A;  5IT9 E;  1I5F A;  1JJ2 A;  3NK9 A;  3K5O A;  3HKS A;  1HZC A;  1VDZ A;  1U5K A;  4X64 Q;  3RMH A;  1KIX A;  3SHL A;  5EAY A;  3T51 B;  5L37 A;  4C3H H;  3F2C A;  2K5H A;  4OX9 L;  1Q1B A;  4ODG A;  4FF4 A;  5IGC A;  5HGQ A;  1Q1E A;  4HMJ A;  1DOM A;  2DNE A;  2V1C C;  5G3L D;  1VQ7 A;  4PZ7 A;  3HOX H;  5COR A;  1SFO B;  3HOV G;  3UDG A;  3NQI A;  4KKS A;  3G4O A;  1D6E C;  1KAA A;  3VYS A;  2ALY B;  5KIX A;  1PVO A;  1YJ9 A;  1AH9 A;  1Y8O B;  2CQO A;  1QB5 D;  1XXG A;  1EYG A;  4A3J B;  5IYC H;  2EE1 A;  4X65 Q;  5FLM H;  2JA5 G;  3UE0 A;  2YYZ A;  3J80 c;  1SNC A;  1Y8N B;  4A93 H;  3FEW X;  2WB1 E;  2K5D A;  3FHW A;  2N49 A;  1VQK A;  4DR4 Q;  5KNB A;  5M3M G;  3NTK A;  4GLV B;  5DEH A;  2K28 A;  4X66 L;  3M4O B;  5EGT A;  3HOY G;  3SDZ A;  1XX8 A;  1PTO F;  3NEM A; 
#chains in the Genus database with same CATH homology
 5EKL A;  3A8K E;  1F9S A;  4L63 B;  5IT9 L;  5COY A;  4NP5 A;  2PNR C;  1G8Z D;  1LLR D;  4HCS A;  2DNC A;  3C0O A;  1LTR D;  1EIG A;  4E6I A;  4IZ8 A;  2FMC A;  2XN9 C;  2KHS A;  2JE6 I;  2JEB I;  5E4X A;  5T1I A;  3A54 A;  3T56 B;  1D1I A;  4JBW A;  4XTC S;  4KV6 A;  4ZUI A;  3MVV A;  3BDC A;  1HTP A;  2QKI C;  4IUP A;  4G7Z C;  1SAP A;  2L55 A;  4K8J A;  3HGB A;  4K6D A;  3VYR A;  1UUP A;  5C5M A;  4RHS A;  3HP3 A;  3K58 A;  3BZD B;  3CHB D;  1UAP A;  4OO1 I;  1GUW A;  2CQA A;  3VA7 A;  2H1E A;  2NWG A;  1CI3 M;  1PRT C;  3MHB A;  2AUJ D;  5CR3 A;  1PFM A;  4ULL A;  1EL0 A;  3TP6 A;  3A55 A;  4G57 A;  3HOV B;  5M9O A;  5FO7 B;  3CQZ B;  1S5E D;  1M4V A;  3NHH A;  3BDO A;  4N9P A;  4A3F B;  1MD2 D;  2J0T D;  2JA5 B;  4NMZ A;  1JWU D;  4DXG A;  5TSS A;  1F2L A;  5KNC A;  1I4H A;  1B9N A;  1BCP D;  5EPJ A;  2KVM A;  2I07 B;  3W2D A;  2DY7 A;  1B53 A;  2BCO A;  2NTS A;  4IFD G;  2L0C A;  3TBI B;  5IGB A;  4K14 A;  5CMD A;  2F0D A;  3HOY B;  3DMU A;  2AQ2 B;  3HOU B;  1EEF D;  3I70 A;  4BA1 I;  4CKB A;  1K83 B;  3IL8 A;  1C8C A;  3GTK B;  3OWF A;  2WAC A;  3MC0 B;  4BY1 B;  2D5D A;  1LTI D;  1A2U A;  4KY5 A;  1WTP A;  1SYD A;  4EGV A;  2A73 B;  2F0G A;  2F0K A;  3PV0 A;  3PO3 B;  4A3G B;  3PUV A;  1A3V A;  1FNV A;  1FNU A;  1ICW A;  4FNF A;  2PW7 A;  4B9X A;  5JJZ A;  2O5J C;  4KY6 A;  3I4M B;  3P7J A;  1U4R A;  3FRP B;  5I4D A;  4F87 A;  3A56 A;  5C0X J;  4IUN A;  1Q3L A;  4ABN A;  2FJ2 A;  4K5W A;  3RUZ A;  4EQO A;  1SSO A;  3S2D B;  1VF7 A;  2D2C C;  3HEJ A;  3K5N A;  2PO4 A;  1LTB D;  3J80 E;  2PZT A;  4OO1 H;  2WKD A;  1SMY D;  1JR0 D;  5J22 A;  5F2D A;  5C44 B;  1B4O A;  2L1B A;  1SE2 A;  2XRS D;  1DYQ A;  1L0Y B;  3D4W A;  3U9S A;  1WTX A;  2EYL A;  3DHQ A;  4QIW B;  3JAM E;  1RKN A;  1WTO A;  1S5F D;  3LX0 A;  3X3M A;  1AP0 A;  1ZKO A;  1II3 A;  2LFN A;  2K1B A;  3ERO A;  4RGM A;  3TP7 A;  2A6E C;  1TII D;  4QUF A;  1SE3 A;  4RWS C;  2E76 C;  3GV6 A;  2F1M A;  5DM7 3;  3H0G B;  2EY5 A;  1ZXT A;  3TZU A;  2K6A A;  2LKV A;  4HTH A;  1PLF A;  1H9M A;  2F0F A;  2O4X A;  4H44 C;  3J80 L;  5I2Y A;  1SNP A;  1S4Z A;  1I50 B;  1OXV A;  1U4M A;  2K33 A;  1HUM A;  1ZEQ X;  3MEH A;  4DU9 A;  2RA4 A;  1C4Q A;  1ENC A;  2L4N A;  1EIH A;  1O7Y A;  4AYB B;  3O13 A;  5JVH 3;  2OF1 A;  4TSS A;  3QB3 A;  1QJO A;  2F03 A;  2K01 A;  1HFN A;  3OHX C;  2EJM A;  4ZKC B;  3JAM L;  1MGS A;  5C4H A;  1A6X A;  3HS0 C;  1Y1V B;  1STB A;  5ELE A;  1IW7 C;  3IAY A;  3S1Q B;  4ZAI A;  2B63 B;  3S16 B;  2F0T A;  2RDG A;  1H9K A;  1EZ8 A;  4BY7 B;  3RLF A;  1STE A;  2VNU D;  4KY7 A;  4ID6 A;  5C5L A;  1JCK B;  1LT6 D;  3SK4 A;  4WJW A;  1JQY D;  3Q24 A;  3S1N B;  2EYH A;  2KOL A;  3IKJ A;  3H94 A;  3NQT A;  3D6W A;  1T5X D;  3NUC A;  4KN7 C;  5E4W C;  1KDA A;  2R93 B;  2BE5 D;  5C4X B;  4JK1 C;  4ZUJ A;  1I4Q A;  1F77 A;  4C2M B;  2B2V C;  1S5C D;  1PRT D;  1EZ6 A;  4RKB A;  2HDM A;  1PYW D;  3SK8 A;  1ILP A;  3J7Y W;  1ET9 A;  3GQB A;  5I2X A;  4FP5 D;  3ND9 A;  1RTO A;  3BVG A;  1BUV T;  2EJG C;  3QG1 A;  1VF5 C;  1I6V C;  5DNF A;  3LWE A;  2KEE A;  2PQE A;  4MIU A;  4KI0 A;  1HUN A;  5K36 G;  5CV9 A;  4CHT B;  4FYD A;  1KDC A;  5DAU A;  1TWH B;  3BYT B;  4KKU A;  2EYO A;  2BDN A;  1ZYR D;  3GTM B;  5I9O A;  1PZK D;  5C0X G;  2MJ8 A;  4KJN A;  3MXU A;  4HAE A;  5KYI A;  5KGU A;  1SYE A;  4WOR A;  5FO9 B;  2F4I A;  1LTS D;  4LMQ D;  3K5L A;  3GTG B;  4C3H B;  4IFD J;  1TY2 A;  1G2T A;  2RKS A;  3HOX B;  2XVS A;  4IUQ A;  4X3S A;  1Y8P B;  4KHV A;  1E2Z A;  2QF7 A;  5AFW A;  2NN6 G;  1QNK A;  3FPU B;  3V96 A;  5ELC A;  5ELB A;  4FVM A;  1TWF B;  5JEA H;  2F0I A;  1F2Z A;  3DWP A;  4A93 B;  3K7A B;  3Q22 A;  5C0X I;  4QCL A;  2K05 A;  3U9O A;  4CKE A;  5I9P A;  4CJ2 C;  3OMC A;  2EDG A;  2G9D A;  4PMB A;  5EQ0 A;  1EOT A;  5FLX E;  3AU7 A;  5LL6 S;  3S17 B;  5CYU A;  4X3T A;  3VYU A;  3SK6 A;  3S15 B;  1NR4 A;  3Q0A A;  4WFN 3;  1AFP A;  3NPP A;  1JOQ A;  1JB3 A;  1U9R A;  3NWS A;  1J8I A;  5M5Y B;  1HXY D;  3K0Y A;  2L11 A;  3D4R A;  1TVX A;  4DNR B;  2HCI A;  1HQR D;  2NN6 I;  4I7Z C;  3QIA A;  4HR7 B;  1KTK A;  3TME A;  1GHK A;  1EFI D;  4EVO A;  4FO2 A;  2GA4 B;  1PFB A;  3MTS A;  2JP1 A;  5HGT A;  2X6G A;  1KLU D;  4XQQ A;  1PTO C;  3IFD A;  3J81 E;  4Q5V A;  1AZQ A;  4CJ0 B;  3SR1 A;  3A7A B;  3URY A;  3DUZ A;  4L6T B;  3VYT A;  2A6E D;  5D14 A;  3TP5 A;  2IPK D;  5FLX L;  3TSS A;  2MP1 A;  1RD9 D;  4A3M B;  5IGE A;  2M2L A;  2CHB D;  4MN3 A;  2EZV A;  2IL8 A;  2AWN A;  4NW2 A;  5CBA E;  2NYZ D;  3RD4 A;  1BBX C;  2SOB A;  1WTQ A;  4IAL A;  1PRE A;  1NAP A;  2A6H C;  3NTI A;  4L8J A;  1SEB D;  3DEP A;  3NP8 A;  4RAU C;  4N9T A;  2NUC A;  3VR3 A;  4ME5 A;  1O7Z A;  5ISR A;  4KTA A;  2B2U A;  5M5W B;  1LAC A;  1CZW A;  1PFN A;  3KF8 A;  3D4D A;  3H6M A;  5IGF A;  5KEE A;  5BN5 A;  1OXU A;  1RF2 D;  4ILW A;  3ERQ A;  5EKK A;  2L5T A;  4IUV A;  3J81 L;  3NWT A;  4Y7N B;  5ELF A;  1IW7 D;  3DWQ A;  1B44 D;  1SJE D;  1MSH A;  1I3Q B;  4GZY C;  3F2U A;  2OEO A;  1HA5 A;  5IIF A;  1X3Q A;  4V0B A;  2F3V A;  4F7X A;  4LJZ C;  3S14 B;  1Z7T A;  3PIO 3;  2K5W A;  1I6H B;  1NSN S;  3K6O A;  1WVL A;  1IYV A;  1V8Q A;  1WCM B;  3KLR A;  4HN7 A;  4RFB A;  2ZXO A;  4J6H A;  4A3E B;  4RCO A;  2NZ1 D;  2YU9 B;  1JC7 A;  2SEB D;  3MZ5 A;  5T1G A;  1AW7 A;  2C5C A;  1WD0 A;  1JIC A;  2XIW A;  2FFK B;  2IT1 A;  3VA5 A;  3EJI A;  4U68 A;  1RTN A;  2EOT A;  1BCP B;  3M7G A;  3NSW A;  1LO5 D;  2A69 C;  2KQ3 A;  3E0J A;  1AZP A;  2EVB A;  2DN8 A;  1BXT A;  2F0N A;  3HG9 A;  3P75 A;  1SYF A;  2B2T A;  4H13 C;  1QNU A;  4C56 C;  2MUY A;  4DAV A;  1G91 A;  1F9R A;  3BDL A;  1DJR D;  1ENF A;  3NXW A;  5JOB A;  3QOJ A;  1TS5 A;  2X6L A;  3SE0 A;  2J7Z A;  2PPB C;  5CV5 A;  3R3O A;  1VMP A;  4OL7 A;  2ICI A;  1SDF A;  4OIJ A;  3QO2 A;  4O42 A;  4A3B B;  5JAV A;  1LTA D;  2K04 A;  1FYC A;  4IFD I;  4BWG B;  1IL8 A;  2M00 A;  5M3F B;  5D3I B;  3FPP A;  1S5B D;  2EPB A;  3C1E A;  2SNS A;  3K59 A;  3M85 A;  1QWY A;  1SNO A;  3DEO A;  2NBF A;  4CBV A;  4RGT A;  3H91 A;  1RHP A;  2WP8 J;  1B2T A;  1XWE A;  1CHP D;  2JA8 B;  1D2B A;  1CQF A;  4ZKB B;  2R61 A;  3MAQ A;  1V1P B;  4F8M A;  5IGG A;  1WTW A;  2K03 A;  4QB4 A;  2Q8I B;  4G4K A;  4V19 0;  1CT1 D;  3GTQ B;  1LT3 D;  4P2C B;  1EYA A;  1O78 A;  2OXP A;  1CTM A;  2O2L D;  3X3N A;  2KUM A;  4C1N K;  4G7O C;  4PV1 C;  3HKZ B;  2DY8 A;  2F0W A;  3GD7 A;  1LT4 D;  3TP8 A;  5KRU A;  4K5V A;  1EYD A;  2WKC A;  2EJF C;  3OSO A;  4C1N I;  5IOD A;  3W3A A;  1V1P A;  2ID0 A;  3OIQ A;  4ZQ3 A;  4FF2 A;  1ILQ A;  2PMZ B;  4CJ1 B;  4OGQ C;  1V43 A;  2TMP A;  2FMM A;  4IN3 A;  2VXW A;  2WV6 D;  2A68 C;  2E2J B;  3ONA B;  2QEJ C;  3T13 A;  3MA2 B;  3GV3 A;  4XQJ A;  3FKI B;  4XIG S;  1SYC A;  4DFA A;  3DXJ C;  1XYI A;  3MWY W;  4C3J B;  4H7B A;  2MHV A;  4ZRZ A;  4HMI A;  2F0L A;  5G3L F;  1HHV A;  1ET6 A;  2EY6 A;  4FF1 A;  5FK9 C;  3H09 A;  3KLS A;  1DD2 A;  5E3F A;  4QF4 A;  5CC4 A;  3N52 A;  3H3V C;  2MGS A;  2H4O A;  3K57 A;  1G29 1;  2HQE A;  1NUC A;  2Z4H A;  2Q8R E;  5EJW A;  5HUR A;  2IX1 A;  1GJX A;  3GTJ B;  3BG3 A;  5CBE E;  2RDF A;  1Y1W B;  4HED A;  4IFD H;  1FD7 D;  3G4N A;  3AMU A;  3V05 A;  3PUX A;  4UDU C;  1SNM A;  3J7A V;  4IUT A;  3SXH A;  3FDT A;  4PQX A;  4C3H G;  1DXM A;  2KED A;  3EVQ A;  4IUR A;  1I4R A;  3CU7 A;  2VB2 X;  2NVT B;  3BYY B;  2KJX A;  2F3W A;  2PZW A;  1CZG A;  1J9O A;  5D3D A;  2BOS A;  2Z1C A;  3PMF A;  1I4G A;  2CW0 C;  4BBR B;  1I4P A;  1OXX K;  1PTO H;  2F0O A;  4OIK A;  3OW7 A;  3GTO B;  4IQZ A;  1PRT B;  2B2W A;  4KN4 C;  3L7Z C;  5FKA C;  2NVY B;  1MI2 A;  4HSP A;  1U4P A;  1EQT A;  1KNE A;  4WRD A;  1BQQ T;  4IUU A;  2B8F A;  1IHZ A;  1RCV D;  4U67 3;  1SJH D;  5JPM C;  2IW3 A;  4MHE A;  2BDO A;  5BN3 A;  4DGZ A;  5C6A A;  2HDL A;  3PUZ A;  2C9O A;  1STA A;  2RBM A;  3VR2 A;  3MFY A;  2A69 D;  1EWH A;  3R8B A;  1BF4 A;  5CV7 A;  2BA1 A;  5I6Y A;  1CK1 A;  1LTT D;  1Y69 U;  3VR5 A;  1BCP F;  3WOE A;  1H9J A;  3KBX A;  4KD4 A;  2PCF B;  1JOK A;  1X3P A;  4G7H C;  4KKT A;  1B1Z A;  1DCZ A;  2K7V A;  3KBG A;  3DWA A;  3S9W A;  2NTT A;  5I6W A;  3PIP 3;  1CQV A;  4FXK C;  3R93 A;  2G9H D;  2TSS A;  1CA5 A;  4K8I A;  3G6J B;  5EKI A;  1EEI D;  1STG A;  4QMG A;  1QG7 A;  5CGK A;  2LS0 1;  2B39 A;  1TS4 A;  4J1M A;  2B8G A;  4PMW A;  1EU4 A;  2PW5 A;  2B2Y A;  2I46 A;  1GUN A;  4KHZ A;  5NUC A;  2EYP A;  1C48 A;  2RSO A;  5LHY 1;  3N6R A;  1VCI A;  1GUS A;  1TU2 B;  1LT5 D;  1RJT A;  1KNA A;  2F0P A;  3TDQ A;  1G6Z A;  3IFT A;  1R9T B;  1STH A;  1CHQ D;  1EQV A;  1M8A A;  4EQP A;  3T16 A;  3CRK C;  2IX0 A;  2L12 A;  1GHJ A;  3SVM A;  1B3A A;  2XWJ B;  1HTL D;  1ESR A;  3OPO A;  1HQM C;  1GUT A;  1Z52 A;  2F0U A;  1EWC A;  3SK5 A;  2R6G A;  2QCP X;  3P20 A;  3I3C A;  3GTL B;  4DNT B;  4A3K B;  4K2K A;  4DN4 M;  2XSC A;  3MFG A;  1Q12 A;  3J7A F;  1AEX A;  1R4P B;  4DXF A;  1FR3 A;  4FXD A;  5IOC A;  1LTG D;  5IGD A;  1H9R A;  2F0V A;  3NBH A;  1W6K A;  1A3U A;  4M1U B;  2RSN A;  4BBS B;  1LV9 A;  1STN A;  4TQU S;  2A68 D;  1ESF A;  5C3E B;  3R2T A;  1QIL A;  3KLS X;  4DK1 A;  2IWH A;  1HCZ A;  3LWU A;  3WDN A;  1ENA A;  1ONL A;  1O7L A;  2RQX A;  1MBY A;  3Q6S A;  2ZXP A;  2Y0S B;  4OO1 G;  3I73 A;  4XDX A;  2ICE C;  2E2D C;  1NCV A;  3D3R A;  2Q8T A;  3VR4 A;  1O80 A;  1PMR A;  3AB9 A;  3ND8 A;  3NE5 B;  4TRD A;  4XT3 B;  1E2W A;  5JEA J;  2A5H A;  2IX3 A;  1UNS A;  4XYO A;  1QOH A;  4RKL A;  2R7Z B;  2XWB B;  5K36 H;  4QUC A;  1HPC A;  1TQO A;  1KLG D;  2B2W C;  3QJY A;  2R92 B;  3MXP A;  1QE6 A;  1CA6 A;  5C0X H;  3C0N A;  1DON A;  2QDB A;  5FO8 B;  3G7L A;  4XT1 B;  2Z4I A;  5JVG 3;  3FVQ A;  1YNN C;  3I91 A;  3PUW A;  3OWE B;  2BE5 C;  1PZJ D;  4KMU C;  1SYG A;  2ZXR A;  2OT2 A;  3BVM A;  2CW0 D;  3C1F A;  1HA6 A;  2E75 C;  4I65 A;  1OXT A;  2NN6 H;  1A3T A;  3M7N A;  5J39 A;  2F0J A;  2IJ0 A;  5C4Z A;  3QWN A;  1TWG B;  2D9U A;  2EY2 A;  1PRT F;  1B50 A;  1QCB D;  5M3M B;  2F0S A;  1BO0 A;  4LK1 C;  4DK0 A;  1IKM A;  1ZYR C;  1TR5 A;  4KJO A;  5A2Q E;  5C3X A;  3A8J E;  2B2Y C;  5KYL A;  4KD3 A;  3OOC A;  3I90 A;  2B2V A;  1FGB D;  3NTH A;  3CKI B;  1TS3 A;  3RZO B;  4RCN A;  2JYO A;  4J8Q A;  2WII B;  4NKL A;  1AN8 A;  1PZI D;  1EYC A;  1GUG A;  1TWA B;  2VUM B;  1XTC D;  4Q0F A;  4XXE A;  4CGY B;  1G2S A;  4C3J G;  1TWC B;  1WTV A;  4R9W A;  2FHT A;  2XRQ D;  4FXG C;  2AQ3 B;  2RVL A;  1ML0 D;  4A3I B;  1EY4 A;  2EYF A;  4R8N A;  5D65 A;  4TKO B;  1DM0 B;  3I4L A;  1PDQ A;  4PNY A;  2F0E A;  5J1Z A;  1CFM A;  4RHR A;  4DF7 A;  2K32 A;  5DM6 3;  1OO9 B;  1K8O A;  3C2P A;  2ZT9 C;  5A2Q L;  4F88 A;  1JE4 A;  2NB0 A;  1EY9 A;  4HCE A;  2X69 A;  1NR2 A;  5LL6 X;  3C3L A;  3T53 B;  1EY0 A;  2F0Q A;  3D6C A;  1D5M C;  4ZK9 B;  3I4N B;  1EY6 A;  2AQ1 B;  5C3W A;  1EY5 A;  2WB1 B;  1YNJ C;  5EPK A;  5CV6 A;  1D5X C;  3S1M B;  4DAP A;  3GP7 A;  2NVX B;  2V4D A;  4UAI A;  4DAY A;  3RZD B;  1E2V A;  3E5S A;  4NDX A;  3OIP A;  1F2M A;  4DA2 A;  3OMG A;  4RGN A;  2EYM A;  2PZU A;  2N88 A;  2B2U C;  3EFX D;  4B9W A;  4XYQ A;  3HZX A;  1WD1 A;  1SND A;  2VB3 X;  3DM1 A;  3WOF A;  5K5P A;  2D62 A;  3FMC A;  2L9H A;  5JEA G;  3BS1 A;  2RDH A;  1PTO D;  1MSG A;  4Z9C B;  4YIJ A;  2M9V A;  1PTO B;  5CV8 A;  3L3O C;  3HOZ B;  3PUY A;  1JOR A;  4K2L A;  1TS2 A;  2LY7 A;  1I4X A;  2E2H B;  1VMC A;  2E74 C;  4X3U A;  4BS9 A;  1RDP D;  1E0B A;  1HFG A;  1CM9 A;  2R3Z A;  3QOL A;  4H0L C;  2ENB A;  2A6H D;  1KDB A;  5ELD A;  3A7L A;  3VR6 A;  5BN4 A;  3EQL C;  4BA2 I;  1TKW B;  3PO2 B;  3KUP A;  1F9Q A;  2KCN A;  3HOW B;  2JA6 B;  3UI2 A;  4ZYS A;  1SXT A;  2QIL A;  4K6L A;  1SBB B;  1BR9 A;  1GOZ A;  2EY1 A;  2SDF A;  3M3Y B;  3S2H B;  2JA7 B;  1W6J A;  4KK7 A;  2N55 A;  2PYK A;  3D8G A;  1WTR A;  1BOS A;  2MPM A;  4RGO S;  1OXS C;  2KA7 A;  5M5X B;  3C0M A;  3TN2 A;  1UEA B;  2B2T C;  2Z8L A;  2HCC A;  1YNN D;  5JPN C;  3EA6 A;  3I72 A;  1BNZ A;  1JWS D;  4XQN A;  2EXZ A;  3S1R B;  1BCP C;  2SNM A;  3K5M A;  5CV4 A;  1L0X B;  3A8I E;  3GO5 A;  4C3I G;  1R4Q B;  5C4J B;  4EQN A;  5EBD A;  3MXN A;  5EBC A;  1T5E A;  1IKL A;  1STY A;  5EPL A;  4B08 A;  1A2T A;  2J4X A;  1TY0 A;  1Z47 A;  1SYB A;  2JSO A;  3LNN A;  1D1K A;  2AUK A;  1U4L A;  1JOO A;  1TT2 A;  3C46 A;  4OHJ A;  3T4A C;  1Z6H A;  4X3K A;  2XNA C;  3ZYY X;  2JXM B;  1GUO A;  3MXG A;  3GTP B;  4PMC A;  5FOB B;  2LMC B;  4CKC A;  2NVQ B;  4S3S A;  2WIN B;  2KCC A;  3V2T A;  1DOK A;  3I8Z A;  4O1N A;  2E2I B;  3NBI A;  1F2Y A;  3L9A X;  2K5Q A;  1X32 A;  1SE4 A;  2O5I C;  1F9P A;  2A74 C;  1IYU A;  1D5Z C;  1EY7 A;  4FF3 A;  2JEA I;  1H9S B;  1EY8 A;  3SEB A;  4M8A A;  2CVR A;  1BDO A;  1SNQ A;  2HUG A;  2WAQ B;  3Q23 A;  2FIN B;  1FNW A;  3CRL C;  4LAA A;  4R8I A;  1S5D D;  3P1H A;  1GXD C;  4A3D B;  3TZD A;  1Q90 A;  3HRZ C;  2BA0 A;  1PXU A;  5KND A;  1Q8I A;  2EYJ A;  3ITP A;  4C3I B;  1EU3 A;  1LAB A;  1DZ1 A;  4ZLT F;  4RH6 A;  5E1F A;  1B9M A;  2F0M A;  2F0H A;  1SMY C;  1V1O A;  3KK7 A;  4K5X A;  1H9S A;  1K8M A;  4HSV A;  3E6Z X;  5A35 A;  1DOL A;  4RA8 A;  2KEC A;  3D31 A;  1KAB A;  1A15 A;  1JWM D;  3BVZ A;  3R2I A;  1HRJ A;  1YNJ D;  3M4Y A;  1ROD A;  2AWO A;  5IT9 E;  3NK9 A;  3K5O A;  1VDZ A;  3RMH A;  3SHL A;  3T51 B;  1Q1B A;  4ODG A;  4FF4 A;  5IGC A;  1Q1E A;  4HMJ A;  1DOM A;  2DNE A;  5G3L D;  5COR A;  1SFO B;  3NQI A;  4KKS A;  3G4O A;  1D6E C;  1KAA A;  3VYS A;  5KIX A;  1Y8O B;  1QB5 D;  1XXG A;  4A3J B;  2EE1 A;  2YYZ A;  1SNC A;  1Y8N B;  3FEW X;  2K5D A;  5KNB A;  3NTK A;  5DEH A;  2K28 A;  3M4O B;  5EGT A;  3SDZ A;  1XX8 A;  1PTO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...