1PTOH

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
TPGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
total genus 45
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
H PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoH02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoH01
2RDHA 3G4OA 1FGBD 1PRTC 2J4XA 5FK9C 3BYTB 1JWMD 1Z52A 1LTRD 1S5BD 1S5ED 1PZJD 3URYA 1D5XC 3C0OA 1PREA 1EU3A 1LT5D 2XNAC 5ELFA 5D3IB 1D5MC 1PTOB 1DJRD 1TS2A 3R8BA 3C0NA 1I4RA 1I4PA 3BVMA 4RGOS 3MFGA 2G9HD 1HXYD 3KLSX 1D6EC 1GOZA 1LTBD 1PZID 1STEA 2ICIA 4L63B 1QILA 3EA6A 1V1PB 1JCKB 1PYWD 1B44D 2AQ1B 3BVZA 4RGMA 1PTOH 5FKAC 1BCPF 4BWGB 1ESFA 1HQRD 1LT4D 2TSSA 4L6TB 4Z9CB 1LTID 1CHQD 1I4XA 1PRTD 1LT6D 1PTOC 1G8ZD 1EEFD 1S5CD 4TSSA 1EEID 4OHJA 4RHSA 3GP7A 1TY2A 2IJ0A 2SEBD 4RFBA 4RCOA 1TS3A 1SE4A 2QILA 1T5XD 3O13A 1KTKA 1RD9D 1UUPA 1PZKD 1SE3A 1ET6A 3DWQA 3C0MA 3BZDB 1EFID 3BYYB 1JWUD 5TSSA 1LTTD 1SJED 1I4GA 1FNUA 1EWCA 3MC0B 1S5FD 1LTGD 3G4NA 1DYQA 1RDPD 3DWPA 1M4VA 1SEBD 3W2DA 4RGNA 2WV6D 1I4QA 5ELCA 2QEJC 1D5ZC 1XTCD 1BCPB 1PRTF 1PTOD 1SJHD 1MD2D 4UDUC 1BCPC 1RCVD 1XXGA 2XRQD 1KLUD 3CHBD 1FD7D 1HTLD 3OWEB 1TY0A 1ENFA 1LLRD 1CQVA 1S5DD 3BVGA 1PTOF 2NTSA 5ELEA 4O1NA 1AN8A 4RGTA 1PRTB 1L0XB 5D3DA 1AW7A 1SE2A 5I4DA 1RF2D 1BXTA 3V05A 1I4HA 2AQ2B 4RHRA 1ET9A 4RH6A 3DWAA 1TS5A 2RDGA 2XRSD 2XN9C 1JWSD 1HA5A 1JQYD 2O2LD 2NTTA 3TSSA 2IPKD 4ZYSA 1JR0D 5ELDA 1FNWA 1UNSA 2AQ3B 1TS4A 1F77A 4DXFA 3R2IA 3SEBA 1CK1A 1LO5D 1SXTA 2CHBD 1CHPD 1V1PA 2Z8LA 1CT1D 4DXGA 2R61A 4C56C 1V1OA 1B1ZA 1FNVA 1BCPD 1EU4A 1LT3D 1SBBB 4K6LA 5ELBA 1LTSD 3R2TA 1L0YB 1KLGD 3EFXD 1LTAD
chains in the Genus database with same CATH superfamily
5IYDH 2VQEQ 4DV4Q 1QE6A 2NZOA 3NBHA 3OTOL 4A3IH 4JI1Q 3SK5A 2JA6B 1SNMA 3S2HH 1S5ED 1HR0W 3LWUA 1R4PB 5IYCH 2LXKA 3GTMH 3HKZB 1WCMB 2B63G 3RLOA 1YNND 1H9RA 5D14A 2X69A 4QMGA 4LAAA 3I73A 3OIPA 1PA6A 1D7QA 1AE2A 3NBHB 1AFPA 2ZXRA 1D6EC 4ZRZA 5I9OA 1JB7A 4OXPA 5GAGC 4GZYC 1NTGA 2Q8TA 2A68D 4X62Q 3NP8A 3S15B 5H1SE 3I4NB 3HEJA 2RHQB 5I6YA 3MXUA 3MXNA 2WFWA 3PSIA 4JPBW 4PMWA 4A93G 1HJPA 3GTLH 4Z9CB 3PO3H 4LF4L 2K50A 4K8IA 2DJFC 3MA2B 4DV5Q 3NQIA 3ER0A 1Q3LA 4KY7A 3L9AX 2EYJA 4AYBB 5M3FH 1I6HH 2NVXB 1PFSA 2F0EA 2ID0A 5EPKA 1SLJA 1GD7A 2C9OA 3PMFA 2CCZA 1OXXK 3ULLA 4JC0A 1L0WA 1AP0A 3KLWA 1X3PA 1Y8OB 1F9PA 2EY1A 5K36G 4CDCC 2B2WC 1XMOL 1V9PA 2Z1CA 4LF7L 4WORA 4BY1G 1E22A 1MSGA 1SYFA 1U4PA 3EQLC 2EZVA 4L5SA 3B6YA 3UDGA 2R92G 3AU7A 2QDBA 4DK3C 3HOXG 1Y1WG 3PIO3 4XQJA 5IYBH 3J7A5 2WAQE 2F0FA 1HA6A 1S3OA 1MHWC 2YTVA 3OWFA 2F0UA 1X56A 4Q0FA 1UE1A 1H9SB 4RKBA 3CCUA 3TSSA 2NVQH 1DCZA 1I3QH 2YV5A 5JVG3 1UNSA 1F77A 3S2DH 3SEBA 4DNTB 2LSSA 5C44B 2IX3A 2B8FA 1N34Q 2CH4W 4C56C 5IIFA 1EY6A 1B2TA 1EU4A 5CV8A 3OSOA 1VCIA 3NWTA 2E5LQ 4A3GH 1TWFH 1JWMD 1LTRD 5HURA 1Y1WB 1PXUA 3PQIA 4JVZA 4LF4Q 1D5XC 3KOJA 2KENA 2K01A 1WTVA 4A3FH 1IL2A 5DNFA 4ZLTF 2UUBQ 3FKIB 4K2KA 2EYOA 2HUGA 5M9OA 2LS01 1NY4A 3S1NH 3E0JA 1GOZA 3NE5B 1TIID 1ENCA 5C5LA 4DNRB 3K59A 3EA6A 1MBYA 1Z6HA 2A6ED 2PZUA 3KFUA 5I6WA 5HGTA 1VS0A 4WJ3M 2B63H 4G7ZC 4BWGB 1UEBA 2XTIA 3TREA 4CKCA 2VUMH 1Q86C 5D65A 4IPDA 4A93B 2JEAI 4XYQA 5FO7B 3VR5A 4HIKA 3A8JE 3ND9A 3NEMA 1VQIA 3HKSA 1HFGA 1AH9A 2EIFA 4X3UA 4IPCA 1VQLA 3T1HL 2B8GA 1RL2A 2Y0SB 1CI3M 2B39A 2DNCA 5FLXE 5IGFA 2Y0SE 1F9QA 1KD1C 4BA2I 1EUJA 1I50H 3K5LA 2R93B 4G4KA 5C3EG 1MD2D 4JI7Q 3DHQA 4H7BA 2OWOA 4JBMA 2VQEL 5CC4A 3BVGA 5ELEA 1QNUA 4XTCS 4DR5L 2L55A 4A3MB 5HY6A 1AW7A 4JI5Q 1KAWA 1J8IA 5KIXA 3RZDB 1BXTA 4RG1A 3PIP3 1ESRA 4DAVA 3ULJA 1WD0A 1JQYD 1OXTA 2EE1A 3AYHB 2NZHA 3MXPA 4BBSG 2CHBD 1FGUA 3LWEA 4FF3A 4KI0A 4NXML 3I4OA 1LTSD 3R2TA 5AJ3Q 1LTAD 1X65A 4KK7A 2DNEA 4DUYQ 2AHOB 2IHEA 5LL6S 2RF4A 3S1RB 4IJLA 4X65L 4YY3Q 5IGEA 4XXEA 4C3IB 5CBAE 1IBKL 2EVBA 1CZWA 3K57A 1IBLQ 1G6ZA 3AFPA 4J6HA 5CYUA 1LM0A 3GTPH 5LL6X 1STEA 1X6OA 4JK1C 2ICIA 3F8TA 4L63B 4KY5A 2JA6H 5CV5A 3KJPA 2F0WA 2UXDL 4B9WA 4OGQC 4B3MQ 1LT4D 4IO9A 2YTXA 5BR8Q 2BE5C 4DV6Q 1SYDA 4HJ8A 2HQEA 4AQYL 4PG3A 3M3YH 2K32A 3MEHA 4P72A 1Q46A 1H9JA 3I4NH 5J39A 1G2SA 2BCOA 2A6HC 2JEBI 4U68A 2F0LA 3VYRA 4BA1I 4K0KL 2R7ZB 3R3OA 4JI0L 4KKTA 3GTLB 3PO3B 3FKIG 4UAIA 4MTNA 2F0DA 2I5MX 3ZYYX 3G6EA 3MC0B 1G291 2M00A 4KLKA 2FINB 4KN4C 1C7YA 2B2TC 1RKNA 2ZTEA 2MNAA 1I4QA 1KDAA 1SDFA 1G2TA 2PCFB 5GQOA 2NB0A 5FLMH 2YU9H 5J22A 2K05A 2NBFA 4KY6A 2NN6G 1B70B 2KA7A 1KLUD 3CHBD 3E6ZX 3U9SA 4CKEA 1YHQA 3HOZG 4UHVA 2RA4A 1AN8A 4GLVB 1I94L 1A0IA 2MHVA 4BBRG 3DWAA 3NSWA 5GADC 1JWSD 4DR2Q 3F2CA 5C3WA 4JI8L 4OWXB 2F3WA 2L5TA 3ERSX 5CMDA 3LGJA 2JQOA 4EQNA 2X6GA 1B1ZA 4JI2Q 3WWVA 3JC66 1H9KA 4IOCA 5CV9A 2LFNA 2VL6A 1VQ8A 2PNHA 2PQEA 4FXDA 3RUZA 5GAHC 4C3JH 1TKWB 4ZCKA 1Z52A 4MN3A 4KHPQ 1LT5D 3J80E 3GTKH 3IFDA 3OYYA 2PI2E 5M5WH 4QIWB 5BN4A 1Q7YC 3MTSA 2LMCB 1GKHA 4DV1L 3BVMA 1II3A 4FP5D 1N9WA 4HJ9A 2EY5A 1STYA 3VR2A 1PZID 3EBEA 4POFA 2WAQG 2NVTB 4A3KB 4C3HB 4LUVA 3GTGH 1SNPA 4QJFA 2QF7A 2ZT9C 2K5DA 1UE5A 3T1YL 3KDFB 5ELNA 2RQXA 3GDEA 2RCNA 2R92H 1V1QA 1O80A 4LK1C 1VQHA 3D6WA 1Q82C 4HIMA 2K1BA 2F0QA 2FMMA 3K58A 2RHSB 3C0MA 4CGYB 1EY8A 3GTQB 4F8MA 1LTLA 3S9WA 1WTXA 4BY7B 5C4XB 4DFAA 2F0HA 4G7HC 3AEVA 4YCUA 1MSHA 3SE0A 3OHXC 2K52A 3BZCA 2Z6KA 1D1KA 3RMHA 4P74A 4E6IA 4LF5L 2LXJA 2ICEC 5JJLA 1FD7D 2DGYA 3Q24A 1DONA 5A2QE 1YEZA 4KTAA 5D3DA 2A1AA 1BVSA 3V05A 2L1BA 2K28A 1T9HA 3A8IE 3S16H 5CV4A 2WB1E 4GLAC 2ZTDA 1STHA 2Z0SA 1WTRA 2JA8B 1CKOA 1VQJA 4A3MH 1TVXA 1AZPA 3P75A 5FLXc 3RZDH 4LF6L 5IOCA 4A76A 2K5HA 1NE3A 4K5XA 4FXKC 3IAYA 4K6LA 4C3JG 1L0YB 1C8CA 5E3FA 4JBJA 1F9RA 1PH1A 2K14A 3RLNA 3BYTB 1EY4A 3HFZB 1RTOA 1PZJD 2F0NA 4O42A 2QKIC 5D3IB 4BY1B 1A2UA 4HJ7A 1I4PA 4ILWA 4LFAQ 1U9RA 2XWJB 3FHWA 1BQQT 4JOIA 1F2YA 4ID6A 1Y1VH 4NXMQ 1NCVA 4DKAC 4QY7A 1YHBA 1HNZL 2ZTCA 1GM5A 2CH4A 4IPHA 2UUCQ 3PO2H 1Y14B 2RBMA 1NUCA 4C3IH 1CQFA 5BN3A 4RGMA 1F2LA 5EKKA 4XDXA 2KEDA 1LTID 4LF5Q 3RR5A 1KXLA 4K5VA 2MPMA 2B2UC 1KHIA 3EN2A 3DUZA 4DR6Q 1JJ2A 4I65A 2RSNA 1GUTA 4OWTB 2N49A 1G91A 1EFID 4PZ7A 1SN8A 5JPNC 2RKSA 3F2UA 3I4LA 3NK9A 4K14A 3M3YB 1EWCA 1WTHA 2QA4A 4KKSA 4K5WA 5A2QL 3P20A 4IUQA 5E4XA 5FOBB 4HIOA 4K6DA 3BDLA 2HIXA 5JAVA 1EOVA 3I56A 3HKZE 2DJGC 3NQTA 5KGUA 2R7ZH 3Q0AA 1NJIC 4A3IB 2F0TA 4B3TL 4DF7A 1HTLD 2Q2HA 2RDFA 1PTOF 3IL8A 4HMJA 1U0LA 3IFTA 5C0XI 2A69D 3J7ZC 4LMQD 2L9HA 1NNXA 2XGTA 1I4HA 5M5YB 1TS5A 2JA7G 1HA5A 4DV1Q 2ASBA 2GA4B 1W3SA 3S15H 4DV5L 1SYBA 1EQVA 1TS4A 3BU2A 2JA6G 4K8JA 4H0LC 2LY7A 2A68C 5CV6A 4N8FA 1FR3A 1I6VC 1VQMA 4A3DH 3DXJC 4WRDA 5EPLA 5M3MG 3I3CA 1LT3D 2DY7A 1YNJD 3OW7A 3JAMc 1NMGA 3G4OA 2L0CA 3K6OA 1D1IA 2NVXH 3VA7A 2E76C 2NZ1D 5LMUL 1EQRA 1TWAH 2NN6I 1PTOB 3U50C 2UXBL 1XX8A 2JJQA 1Y1VG 1VQ4A 2A8VA 1CKMA 4CJ0B 2KEEA 2XWBB 4CKBA 2R7FA 1EY7A 1N34L 2EYMA 4DV2L 3T1HQ 3UE1A 4A3GG 1HQRD 1ILPA 1WCMG 5F2DA 4DUZL 1K28A 1PRTD 3UDXA 2KQ3A 2PW5A 2EYPA 1RJTA 4J15A 3L2PA 1VQNA 3H0GB 1IYUA 2NVTH 4B3ML 1GUNA 4C3HH 1E7ZA 1K0SA 2YTYA 2QILA 4FNFA 1JOKA 2EY2A 1UUPA 1TWHH 4R8NA 4DR5Q 4HIDA 4POGA 3S2DB 4OO1I 2R92B 1FNUA 2NVYH 1Q12A 3CXCA 3CC2A 1Q8IA 3HOYB 1Z9FA 4X3TA 3M4PA 1BBUA 1MJCA 2ZM6L 2N78A 4U673 1HH2P 1IBMQ 2QEJC 3BZKA 3MVVA 3CCVA 2A74C 5BR8L 1TWFB 3MEFA 3GV3A 3I2ZA 1Y1WH 1BCPC 3KF6B 1MGSA 1TY0A 3A8KE 1LLRD 1E2WA 5C4XH 3J7YW 3STBD 4A3FB 4H02A 4LW1A 4NW2A 3ITPA 4X62L 3RZOH 2N88A 1VQPA 4HCEA 5C3XA 3S1NB 2DN8A 4YWMA 2ZJRA 2K75A 5JEAJ 3RN5A 1CUKA 2PMZB 1SAPA 1TT2A 4B3SL 3HOWB 3E3XA 2O2LD 4LF8Q 1I5FA 2CWPA 1PH7A 5G3LF 3GD7A 3A5UA 2B2WA 3OIQA 1GJXA 1SNCA 2HHHQ 4ZUIA 5IWAL 1NAPA 2UU9Q 4LNQA 2Z8LA 3PUVA 2KHSA 4IUPA 1CT1D 4FYDA 3PO3G 3HP3A 1EFWA 5JJKA 4A93H 2J0TD 4C2MB 1SBBB 3S16B 4I7AA 4JG2A 4UP7A 4C1NI 4PNYA 4TRDA 4PZ8A 2EYFA 1ASZA 2KHIA 3BS1A 1CTMA 1VQKA 4ME3A 1FJGL 2K03A 4JV5Q 1KAAA 1Q1EA 4FF1A 1LABA 1TWGH 4DR3Q 5ELFA 2BA1A 3NWSA 5FJ8G 4P73A 1ONLA 4F88A 4B3RQ 2C5CA 1EYGA 4PZ6A 1HXYD 3TRZA 4K2LA 5JEAH 3RD4A 2NUCA 1UE6A 3AB9A 4X3SA 5IGBA 1QCBD 3CAMA 3M4OB 5JOBA 3S14B 1YHAA 1C48A 3OPOA 2TSSA 4OIKA 2EYHA 1AEXA 3CPFA 4TSSA 2F0SA 4DAYA 2Y0SG 4OIJA 5IGCA 1EOTA 3OOCA 1PHJA 2UUCL 3SHLA 4RFBA 2G9DA 4DR3L 4JI0Q 4HAEA 4R4IA 3HOXH 3R93A 3T1YQ 1AZQA 2WKDA 1EIGA 1KDBA 5JJZA 1WTQA 3QIAA 3HOVG 4EX5A 4HR7B 3NHHA 4LFCQ 1WYDA 4GS3A 2JA8G 4HCSA 5IGGA 1U4LA 2AKWB 4HN7A 3W2DA 1XTDA 1YZ6A 4L5QA 3G6JB 3I91A 1D5ZC 3S1MH 3JAMi 4IUNA 1HZBA 4NMZA 2HDLA 3TZDA 2KHJA 4UDUC 3KBXA 1D2BA 2VB2X 4MIUA 4UP8A 2F4VL 1JOOA 2HD3A 3MZ5A 2I0QA 4LUZA 1ICWA 3UI2A 1VQ5A 1EYAA 3DEPA 1VQOA 1SROA 3UE0A 2ENBA 3GTPB 4GKJQ 4IQZA 2VY3A 2O5JC 5C4ZA 4JV5L 2XRSD 2HIVA 1IHZA 2PZTA 1X9NA 4ZYSA 2R93G 4DV4L 1DM0B 1MI2A 1LO5D 1X3QA 3PCOB 5C0XJ 1BKBA 5IP7H 1KRTA 1GVPA 4ODGA 4KV6A 4FVMA 4DR4L 1PYBA 1N32Q 5M5YH 1B53A 4A3CH 1H9SA 5KEEA 4LF9Q 1SMYC 4OO1G 2J4XA 3PIOA 1S5BD 1STGA 3A0JA 1E24A 1KL9A 1SSOA 2B2YA 1B7YB 2XNAC 2HCCA 2O4XA 3H15A 3MHBA 3L3OC 4DR2L 4RGOS 1PFBA 1VQDA 1LTBD 4JI7L 4RMFA 1VQ9A 1J5EL 1B44D 3BVZA 2YU9B 1M90C 1PTOH 2Q2TA 2F0OA 1S4ZA 2CQOA 5I9PA 4TQUS 2YYZA 4KMUC 4DUYL 2JA7B 2MO0A 3CQZB 4IFDJ 2KBNA 1QVFA 4LFBQ 2BDNA 1SE4A 3K80C 5ELOA 4RAUC 3H09A 1KTKA 4KD4A 3NTHA 1SE3A 4BBSH 3BZDB 1QNKA 3FPUB 2B2VA 2KOLA 2CW0C 3FEWX 4A3EH 1XNQL 3I4MH 3FRPB 4B08A 2EJFC 3H0GH 1S5FD 3K0XA 3T53B 1DYQA 4YHHQ 1E1TA 2FMCA 2KCCA 2E2HH 4QB4A 3N6RA 1SFOB 1TWHB 3D8GA 5CGKA 3S1QB 4C3JB 5BN5A 2OXPA 2XRQD 1C9OA 1SYCA 5LHY1 3S17H 2N3SA 3GTKB 2B2VC 1T5EA 3E9IA 3K8AA 3HOYH 2UUAQ 1NMFA 2G5DA 3CC7A 3MFYA 5KNCA 4J1MA 4NDXA 3E5SA 3C2PA 4QUFA 4ABNA 5LMNW 3A74A 3ONAB 1H95A 2O5IC 2MFIA 5IGDA 1FL0A 1DOMA 2AMCB 1AE3A 5ELBA 2OTLA 3T16A 5EPJA 5FO8B 1Y69U 2OQKA 1FGBD 1MIUA 1R4QB 3J7AV 3GTOH 4R1JA 1K83B 3A55A 5IP9H 3GTQH 2KUMA 2QCPX 1N33L 1J5EQ 4C2MH 3C0NA 4GOPC 1I4RA 4A3CG 4DV3L 3ERQA 4BS9A 4X6AH 2N55A 1UAPA 4ULLA 2CW0D 2QW7A 1VQ6A 1LV9A 5C3EB 1M8AA 1O78A 1SRUA 4NP5A 3RN2A 1QILA 1A8VA 3DM3A 1TWGB 2P5ZX 3VYTA 2UXBQ 4QF4A 2KCMA 3HOUG 3ZJYC 1PH9A 1XPRA 3TN2A 4P2CB 5DM63 2VQFL 1DGSA 1EEID 2E2DC 3CRKC 4OHJA 2FFKB 1FVIA 3OMCA 2IJ0A 4WFN3 3TMEA 2SEBD 1ZYRC 4DUZQ 4YY3L 1HCZA 4RCOA 1TS3A 1SE8A 4N9TA 4GKKQ 3F2DA 1B9MA 1ET6A 1CFMA 2V1CC 2E8GA 2JA8H 5TSSA 4CHTB 1HNXL 5EBCA 3ND8A 3J80c 3KF8B 4YWKA 2JA9A 2NYZD 5M5XB 2KECA 1LYLA 3MXGA 4M8AA 2PO4A 3NPPA 3Q8DA 3IKJA 4A3JB 3EIVA 1XTCD 1PTOD 2K33A 1O7ZA 2CQAA 3PUXA 4DAYB 4QCLA 1EY9A 3SK8A 1XXGA 2VS1A 2VB3X 4BY1H 1HRJA 4RWSC 1KABA 2L15A 1L0XB 5AJ3L 4OWWB 5A35A 1XMQL 2ZXOA 2K5WA 1M1KC 3I70A 5KNDA 1DOKA 1Y1VB 4X65Q 5T1GA 1IXRA 4XYOA 1PMRA 2F52A 1BDOA 5ELDA 1WI5A 2WAQB 1NSNS 1KC8C 4DR1Q 3K7AH 1PDQA 3PUYA 3CCMA 4DV0L 3I72A 5ISRA 1ZXTA 2R61A 3NUCA 3H94A 5IWAQ 1QZHA 4A3FG 1PLFA 1TQOA 2BE5D 1QUQA 2JA5G 3V2TA 2QEXA 3L0OA 3K0YA 2K7VA 5T1IA 5C4HA 2UXCQ 3TP7A 1Z7TA 1ZKOA 2SOBA 1TS2A 3BDCA 3R8BA 2A6HD 1WTPA 3QOJA 1CSQA 1STNA 4DK6C 4A3JG 3LX0A 1B3QA 1NR4A 1NR2A 4IFDI 1E0BA 2EJMA 2HT1A 3G7LA 4YCVA 4FO2A 4LWCA 3RLFA 1JT8A 2MP1A 1GUOA 2D9UA 5IE8A 1F9SA 2GVBA 3X3NA 3T4AC 4AQYQ 4AYBG 5GROA 2CWAA 4UPAA 3HOZH 2JSOA 1PTOC 1EEFD 1S5CD 1CKNA 2K04A 2X6LA 1L1OA 2EDGA 3QG1A 1E1OA 4DR7L 1JJGA 2F3IA 4L5TA 5C4XG 3VYSA 1OXSC 1G51A 1UEAB 5EBDA 3SVMA 5CORA 1VDZA 1PZKD 2SNSA 1HR0Q 1JWUD 2BOSA 3E9HA 3U9OA 4X66L 5C4JB 1I4GA 4RCNA 5LMNL 1EIYB 3H3VI 2JA7H 1IYJB 3CQZH 4A3DB 4IURA 1HZAA 1M4VA 2FJ2A 3CF5A 4NB3A 3U4VA 5I2YA 1N33Q 1LACA 4APVA 2M9VA 1EWHA 4IZ8A 4UY8C 4A3EB 2Q2IA 3D4WA 1OXUA 1YNJC 3I4MB 2MUYA 5JJIA 4X64L 3OWEB 2B2TA 2PQAB 1TWAB 3LNNA 3CKIB 2BA0A 4O1NA 1WTWA 1IKMA 4RGTA 1K73C 4RKLA 2E2HB 1SFOH 3KLSA 3TS0A 1XPUA 4JCVE 3S1QH 4KJNA 4MZ9A 2RDGA 3I4MG 3S17B 4A3BB 1PH2A 2F4IA 2IPKD 4BXXH 4EQ5A 3KF8A 2OCEA 4DA2A 2A73B 1ZEQX 2DY8A 2WACA 3R2IA 1IZ6A 3QO2A 2I5LX 1PFNA 2WIIB 2MGSA 1FJGQ 2VUMG 4G57A 4GLXA 1EZ8A 5E7NA 1HNXQ 2K6AA 4ME5A 2IL8A 3Q6SA 5DAUA 3DM1A 5IP9G 3NELA 1PRTC 5J3BA 3CC4A 4GOPB 1MKHA 2A5HA 2WB1G 1DD2A 1G6PA 4JYAL 2NVYB 3VDYA 5M3MH 4JI4Q 1V43A 2D0PA 3KLSX 1QB5D 1E3PA 2E2IH 2E2JH 1YNXA 3GTOB 3HRZC 3DEOA 1K83H 1BO0A 3VYUA 2D0OA 3D4DA 2AQ1B 3QWNA 1VMPA 5C0XG 5FKAC 1BCPF 3KBGA 2N8NA 3KK7A 3UDFA 3FPPA 1I4XA 3GTJH 3BG3A 4OX9Q 5C3EH 3GP7A 1GUSA 3RZOB 4PMCA 5C6AA 2F0JA 3E0EA 1K9MC 2K5QA 5IP7G 4Y7NH 4YHHL 1K3BC 2HDMA 4X64Q 1BBXC 1STAA 1RD9D 3DWQA 5COYA 1YI2A 3HOWH 1XMQQ 1L1OB 1SJED 3J80i 2I5HA 3TP8A 4QQBX 2XVSA 1HNWL 3G4NA 3HGBA 2CKZB 4YCWA 5G3LD 2OT2A 1F2MA 5EGTA 4NKLA 3W3AA 2EXZA 5KYIA 5I2XA 3HOVB 1EY5A 1KDCA 1U4RA 2EQSA 2JN4A 4V190 1GHKA 1O7YA 4Q5VA 3KDFA 3J7AF 4JI1L 1CQVA 1TWCB 1SR3A 4DV2Q 4H44C 4C3IG 1R9TB 5I4DA 4GKKL 2Z9HA 1XNRL 2F0KA 2UUBL 2C35B 1X3EA 3M4OH 3PO2G 3W5OA 1HPCA 3HKZG 5L37A 2AQ3B 3FP9A 2K4KA 3QB3A 4JBWA 3S14H 4A3BG 3A54A 1EZ6A 4XT1B 1SXTA 4ZAIA 1BCPD 3HOUH 4B3TQ 4LUOA 5LMNQ 4LJZC 2R7DA 4FDBA 4MTKA 3STBC 3HOXB 1IW7D 4HEDA 4DV0Q 1L2FA 4OO1H 2VXWA 1N36L 4LFAL 1BR9A 5E4WC 3DMUA 3PUZA 1DJRD 4TVAB 2F1MA 3FDTA 3M4QA 1WJJA 3FVQA 2G9HD 3VR4A 3PF5A 1A6XA 3FMCA 2B29A 4A3MG 2BH8A 3CU7A 1Q90A 3S1MB 3M9BA 5FJ8H 1A63A 3S24A 3MAQA 4GNXB 1ESFA 4KJOA 2L4NA 3M7GA 1PH5A 4QGUA 4AYBE 3K5NA 3MXNB 4M1UB 4LFBL 2JE6I 5IT9c 2D2CC 3X3MA 1DXMA 5FLXL 1N8RC 3D4RA 4DV6L 4KHPL 2UXCL 3GQBA 4N9PA 1T5XD 1YVCA 4OONA 2Z4IA 3C46A 1HHVA 4GOPA 3S2HB 3PIPA 4IPGA 4BBRH 3GTMB 1JORA 4O2DA 2F3VA 5IODA 3CMEA 1B8AA 2PZWA 1SMXA 1YBYA 4R9WA 3CMAA 1PV4A 1U4MA 2K5VA 4JI6Q 1SEBD 3CCSA 4IJHA 1ML0D 2EOTA 3VR3A 1JC7A 5KNBA 2UUAL 4IFDH 5EJWA 3CCJA 4Y52H 1XJVA 2ZM6Q 1N32L 1XNRQ 3HG9A 1RCVD 2PW7A 3QJYA 2OEOA 2B3GA 1SMYD 4IUVA 1S5DD 4DNIA 3SK4A 3H0GG 4EQPA 5NUCA 3SXHA 2B2YC 3HS0C 4JOIC 1O7IA 2QGQA 1EWIA 2FHTA 2PMZE 2F0GA 1RTNA 1A2TA 2R6GA 1IKLA 4DAMA 2UU9L 1B9NA 1KNEA 3TBIB 3PV0A 2XN9C 5M3FB 1HZCA 4JI4L 4KN7C 2F0PA 2D5DA 1B3AA 4A75A 1I94Q 3GO5A 3H6MA 3J81E 3TS2A 2PYKA 4CDEC 2JYOA 2QDLA 1H9MA 2UXDQ 5JEAG 3OMGA 2A6EC 1TXYA 1VMCA 1A3UA 4NXNQ 4C3HG 4IN3A 4A3IG 3NTKA 1NBWA 5IYDG 2HCIA 4I7ZC 1IBLL 4F7XA 4BBSB 3URYA 1JE4A 5C0XH 3A7LA 1C4QA 1D5MC 4GKJL 1RODA 1V8QA 2EY6A 2E75C 2F03A 4G7OC 3MFGA 4B3SQ 2Q2UA 4DU9A 4FF2A 1EIHA 2VW9A 1QOHA 1K8MA 1KQSA 4IUTA 1VF7A 3WOFA 2PI2A 2F4VQ 2OF1A 4V0BA 2NVQB 1K8OA 1LUZA 1JICA 1I3QB 4HJ5A 4DR4Q 1E2ZA 3MWYW 4DV7L 4GN5A 5GAEC 5M3MB 4L6TB 1Y8NB 3PF4A 3H91A 1HUNA 2IX1A 2XIWA 4EQOA 4BY7G 2E2IB 2E2JB 3H3VC 4QUCA 3UDIA 2BH2A 4A3GB 4DN4M 3V96A 2NN6H 3W1GA 1VQBA 1PVOA 3D6CA 5JVH3 2SDFA 4KHVA 3GTJB 2VZAA 4MHEA 4B9XA 2BDOA 5DM73 1XPOA 3IRBA 3FKIH 2H1EA 1IBML 3CCLA 2ZJQA 3HOWG 1N36Q 2HHHL 1QVGA 2B2UA 4RGNA 2KVMA 3W1BA 3I4NG 4R4CA 1EQQA 4WJWA 2I07B 2B63B 3PGZA 3A56A 4LF7Q 5E1FA 4ZKBB 1PFMA 2L11A 3C1EA 2J7ZA 2Z6BA 1STBA 2K5NA 4ZKCB 1PRTB 3H3VH 5J1ZA 3CD6A 4JW0A 2WINB 5EQ0A 1W6KA 3HOVH 1SNQA 4RHRA 1VQEA 2F0MA 4RH6A 3J81i 1F2ZA 4O0AA 1XMOQ 2IWHA 4P71A 3WOEA 3M4YA 4OELB 2KJXA 3I55A 4IALA 3EROA 1W2BA 2V4DA 1R9TH 4TKOB 4DXGA 1CHPD 1V1PA 4K0KQ 3OW2A 4L5RC 3A5ZB 3G4SA 1BOSA 4R4TA 1VQAA 3K5MA 5AFWA 1I50B 4ZK9B 3NBIA 1CKNB 2ZXPA 1CSPA 1MJEA 3KF6A 2SNMA 2Z4HA 4DK0A 3HOUB 4BXXG 3J81j 5M5XH 1PYSB 3U58A 3TZUA 4A3JH 2E74C 2RVLA 1KRSA 3EVQA 2JA5H 4YIJA 1JCKB 3CW2C 4GNXC 1YJNA 4JYAQ 1O7LA 1PYWD 5C44G 3F1ZA 2PQAA 1OTCA 2RSOA 1GUWA 4PV1C 5CR3A 1CHQD 3VR6A 1X3GA 1QG7A 3TP5A 1HTPA 1CZGA 4R4OA 3D3RA 5IT9E 4X3KA 4A3KG 5LMUQ 1GXDC 1HNWQ 4R4QA 5KYLA 2CFMA 3O13A 4NXNL 3S1RH 3Q22A 4JI5L 3BYYB 2IT1A 4F87A 2R7ZG 1XWEA 2DUDA 1BUVT 4LF8L 3K7AB 5IYBG 2VNUD 1QVCA 3DWPA 4AH6A 1JJCB 3ICEA 4UP9A 3NENA 1J6QA 2I46A 4BBRB 2VQFQ 1P16A 1Z47A 4C1NK 1ZYRD 1ENFA 4NPSA 4CJ1B 4QL5A 2WKCA 3TDQA 1OO9B 2OTJA 5DEHA 3BDOA 1SE2A 1VF5C 2AUJD 2WB1B 4DAPA 1RF2D 2ZJPA 1SNDA 4DGZA 3TP6A 2AQ2B 3AMUA 1ET9A 3T56B 1IL8A 4DK1A 4KD3A 5IY0A 2Z6KC 2MJ8A 4CJ2C 4DR7Q 4EVOA 4LF9L 1JR0D 3I90A 3P1HA 2E5LL 1CK1A 3CCEA 2JP1A 3HOZB 1WCMH 1QJOA 1V1OA 1QUQB 4FF4A 1CA6A 4LFCL 2RDHA 2IY5B 1A3VA 3CCRA 3K5OA 3G71A 3M7NA 3JAME 4ALPA 4LF6Q 3D31A 3C0OA 4DR6L 3J80L 3I8ZA 1EU3A 3RNUA 1PREA 4AIMA 1WOCA 3KJOA 2CVRA 5C4JH 1ILQA 2JK8A 4PMBA 3GV6A 3T13A 1PH8A 3D0FA 1HZ9A 4XT3B 4CBVA 4KKUA 1HR0L 1RHPA 3T51B 4HTHA 4R8IA 1Q81C 1XNQQ 3I7FA 3KLRA 3J81c 1UWVA 4YWLA 2AWNA 1K3RA 1EYCA 4H13C 4GN3B 1WD1A 1ASYA 1I6HB 2GVAA 2H5XA 1YJ9A 3TEHB 1RIPA 2AUKA 1OXVA 2NWGA 4A3DG 1LT6D 1KIXA 1G8ZD 4RHSA 3QR8A 2EPBA 1TY2A 2FXQA 4JBKA 1GHJA 3NXWA 3L7ZC 5CBEE 4XQNA 5C5MA 4JI6L 2H4OA 5EKLA 4DPGA 1WTOA 1EY0A 4A3BH 1A3TA 1A15A 1SNOA 1DOLA 2LKVA 1LTTD 5M5WB 1S72A 4WJ4A 1CA5A 3CRLC 1JOQA 1X3FA 5K36H 5M3FG 1WFQA 1HFNA 3DLLA 1Q1BA 4HMIA 5ELCA 4DV7Q 2MO1A 3N52A 4A3KH 1TR5A 3Q23A 1K8AC 3GTGB 1PRTF 1SJHD 1VQGA 4A4IA 3AFQA 3SR1A 2PPBC 4JI3Q 1K0RA 1L1OC 1EL0A 2EXDA 2IW3A 3NTIA 1PH3A 2PNRC 4IUUA 1UE7A 3OTOQ 3SDZA 2D62A 2F0IA 5C44H 2A19A 2ALYB 4OEMB 1GO3E 5KRUA 4CDFC 1WVLA 1K8GA 1IBKQ 3G48A 1Y8PB 1YITA 3P7JA 1S40A 1BF4A 1X55A 4XQQA 1U5KA 1YJWA 2WP8J 3J81L 3JAML 1PH4A 4BY7H 1FYCA 5IYCG 3CP0A 4L8JA 1EIFA 1KLGD 4ZQ3A 4X66Q 1TU2B 3C1FA 5FK9C 1JE5A 3ULPA 4Y7NB 4OX9L 4RA8A 3AQQA 3BJUA 3KUPA 3CCQA 4DV3Q 1QWYA 3U4ZA 1C0AA 2RCFA 4KHZA 1A62A 2VUMB 5K5PA 1HQMC 3K81C 2EJGC 1D8LA 1JB3A 4DR1L 3TQYA 1V1PB 1PH6A 2F0VA 2EYLA 4J8QA 2IX0A 4EGVA 1SYGA 1EQTA 5HGQA 2L12A 5FO9B 3SK6A 4A3LG 1TWCH 4JI3L 1SYEA 4N8X1 5EAYA 1P8LA 4XIGS 1J9OA 4FXGC 4HSVA 4S3SA 1KNAA 2JA5B 3HOYG 1XYIA 3EJIA 3A7AB 4MNOA 1YNNC 2AWOA 1EYDA 4GN4B 2A69C 2Q8IB 1B50A 1HUMA 5FLMG 2JXMB 1VQ7A 2R93H 2MQHA 5CV7A 1BBWA 4A3EG 4P75A 2XSCA 1GUGA 2KCNA 1LTGD 1VQCA 5IT9L 1RDPD 1Q8KA 4OL7A 1X54A 3K7UC 2WV6D 3KYHC 1BNZA 3M85A 3HZXA 1ICFB 4PQXA 2Q8RE 3C3LA 2GN5A 4CDDC 1W6JA 2ATWA 4IFDG 3PO2B 1BCPB 1ENAA 2OQ0A 5EKIA 1YIJA 4JI2L 1E2VA 3VA5A 5DLQE 3F2BA 1JMCA 2KCTA 1VQFA 4ZUJA 5JPMC 2NTSA 3PUWA 1IW7C 3SGIA 1HNZQ 1CM9A 4JI8Q 1DZ1A 4HJAA 2TMPA 2HQLA 4A3LH 4IOAA 2IHFA 3WDNA 4B3RL 4HSPA 2NTTA 1B4OA 2ES2A 1IYVA 1FNWA 4DXFA 3CPWA 4GNXA 1X32A 1QZGA 2R3ZA 1FNVA 3QOLA 4QIWE 2M2LA 3EFXD
chains in the Genus database with same CATH topology
1QE6A 3NBHA 3SK5A 2JA6B 1SNMA 1S5ED 3LWUA 1R4PB 3HKZB 1WCMB 1YNND 1H9RA 5D14A 2X69A 4QMGA 4LAAA 3I73A 3OIPA 1AFPA 2ZXRA 1D6EC 4ZRZA 5I9OA 4GZYC 2Q8TA 2A68D 3NP8A 3S15B 3I4NB 3HEJA 5I6YA 3MXUA 3MXNA 4PMWA 4Z9CB 4K8IA 3MA2B 3NQIA 1Q3LA 4KY7A 3L9AX 2EYJA 4AYBB 2NVXB 2F0EA 2ID0A 5EPKA 2C9OA 3PMFA 1OXXK 1AP0A 1X3PA 1Y8OB 1F9PA 2EY1A 5K36G 2B2WC 2Z1CA 4WORA 3EQLC 2EZVA 1MSGA 1SYFA 1U4PA 3AU7A 2QDBA 3PIO3 4XQJA 2F0FA 1HA6A 3OWFA 2F0UA 4Q0FA 1H9SB 4RKBA 3TSSA 1DCZA 5JVG3 1UNSA 1F77A 3SEBA 4DNTB 5C44B 2IX3A 2B8FA 4C56C 5IIFA 1EY6A 1B2TA 1EU4A 5CV8A 3OSOA 1VCIA 3NWTA 1JWMD 1LTRD 5HURA 1Y1WB 1PXUA 1D5XC 1WTVA 2K01A 5DNFA 4ZLTF 3FKIB 4K2KA 2EYOA 2HUGA 5M9OA 2LS01 3E0JA 1GOZA 1TIID 3NE5B 1ENCA 5C5LA 3K59A 4DNRB 3EA6A 1MBYA 1Z6HA 2A6ED 2PZUA 5I6WA 5HGTA 4G7ZC 4BWGB 4CKCA 5D65A 4A93B 2JEAI 4XYQA 5FO7B 3VR5A 3A8JE 3ND9A 1HFGA 4X3UA 2B8GA 2Y0SB 1CI3M 2B39A 2DNCA 5FLXE 5IGFA 1F9QA 4BA2I 3K5LA 2R93B 4G4KA 1MD2D 3DHQA 4H7BA 5CC4A 3BVGA 5ELEA 1QNUA 4XTCS 2L55A 4A3MB 1AW7A 1J8IA 5KIXA 3RZDB 1BXTA 3PIP3 1ESRA 4DAVA 1WD0A 1JQYD 1OXTA 2EE1A 3MXPA 2CHBD 3LWEA 4FF3A 4KI0A 1LTSD 3R2TA 1LTAD 4KK7A 2DNEA 5LL6S 3S1RB 5IGEA 4XXEA 4C3IB 5CBAE 2EVBA 1CZWA 3K57A 1G6ZA 4J6HA 5CYUA 5LL6X 1STEA 2ICIA 4L63B 4JK1C 4KY5A 5CV5A 2F0WA 4B9WA 4OGQC 1LT4D 2BE5C 1SYDA 2HQEA 2K32A 3MEHA 1H9JA 5J39A 1G2SA 2BCOA 2A6HC 2JEBI 4U68A 2F0LA 3VYRA 4BA1I 2R7ZB 3R3OA 4KKTA 3GTLB 3PO3B 4UAIA 2F0DA 3ZYYX 3MC0B 1G291 2M00A 2FINB 4KN4C 2B2TC 1RKNA 1I4QA 1KDAA 1SDFA 1G2TA 2PCFB 2NB0A 5J22A 2K05A 2NBFA 2NN6G 3E6ZX 2KA7A 1KLUD 3CHBD 4KY6A 3U9SA 4CKEA 2RA4A 1AN8A 2MHVA 3DWAA 3NSWA 1JWSD 5C3WA 2F3WA 2L5TA 5CMDA 4EQNA 2X6GA 1B1ZA 1H9KA 5CV9A 2LFNA 2PQEA 4FXDA 3RUZA 1TKWB 1Z52A 4MN3A 1LT5D 3J80E 3IFDA 4QIWB 5BN4A 3MTSA 2LMCB 3BVMA 1II3A 4FP5D 2EY5A 1STYA 3VR2A 1PZID 2NVTB 4A3KB 4C3HB 1SNPA 2QF7A 2ZT9C 2K5DA 2RQXA 1O80A 4LK1C 3D6WA 2K1BA 2F0QA 3K58A 2FMMA 3C0MA 4CGYB 1EY8A 3GTQB 4F8MA 3S9WA 1WTXA 4BY7B 5C4XB 4DFAA 2F0HA 4G7HC 1MSHA 3SE0A 3OHXC 1D1KA 3RMHA 4E6IA 2ICEC 1FD7D 3Q24A 1DONA 5A2QE 4KTAA 5D3DA 3V05A 2L1BA 2K28A 3A8IE 5CV4A 1STHA 1WTRA 2JA8B 1TVXA 1AZPA 3P75A 5IOCA 4K5XA 4FXKC 3IAYA 4K6LA 4C3JG 1L0YB 1C8CA 5E3FA 1F9RA 3BYTB 1EY4A 1RTOA 1PZJD 2F0NA 4O42A 2QKIC 5D3IB 4BY1B 1A2UA 1I4PA 4ILWA 1U9RA 2XWJB 1BQQT 1F2YA 4ID6A 1NCVA 2RBMA 1NUCA 1CQFA 5BN3A 4RGMA 1F2LA 5EKKA 4XDXA 2KEDA 1LTID 4K5VA 2MPMA 2B2UC 3DUZA 4I65A 2RSNA 1GUTA 1G91A 1EFID 5JPNC 2RKSA 3F2UA 3I4LA 3NK9A 4K14A 3M3YB 1EWCA 4KKSA 4K5WA 5A2QL 3P20A 4IUQA 5E4XA 5FOBB 4K6DA 3BDLA 5JAVA 5KGUA 3NQTA 3Q0AA 4A3IB 2F0TA 4DF7A 1HTLD 2RDFA 1PTOF 3IL8A 4HMJA 3IFTA 5C0XI 2A69D 4LMQD 2L9HA 1I4HA 5M5YB 1TS5A 1HA5A 2GA4B 1SYBA 1EQVA 1TS4A 4K8JA 4H0LC 2LY7A 2A68C 5CV6A 1FR3A 1I6VC 3DXJC 4WRDA 5EPLA 3I3CA 1LT3D 2DY7A 1YNJD 3OW7A 3G4OA 2L0CA 3K6OA 1D1IA 3VA7A 2E76C 2NZ1D 2NN6I 1PTOB 1XX8A 4CJ0B 2KEEA 2XWBB 4CKBA 1EY7A 2EYMA 1HQRD 1ILPA 5F2DA 1PRTD 2KQ3A 2PW5A 2EYPA 1RJTA 3H0GB 1IYUA 1GUNA 2QILA 4FNFA 1JOKA 2EY2A 1UUPA 4R8NA 3S2DB 4OO1I 2R92B 1FNUA 1Q12A 1Q8IA 3HOYB 4X3TA 4U673 2QEJC 3MVVA 2A74C 1TWFB 3GV3A 1BCPC 1MGSA 1TY0A 3A8KE 1LLRD 1E2WA 3J7YW 4A3FB 4NW2A 3ITPA 2N88A 4HCEA 5C3XA 3S1NB 2DN8A 5JEAJ 2PMZB 1SAPA 1TT2A 3HOWB 2O2LD 5G3LF 3GD7A 2B2WA 3OIQA 1GJXA 1SNCA 4ZUIA 1NAPA 2Z8LA 3PUVA 2KHSA 4IUPA 1CT1D 4FYDA 3HP3A 2J0TD 4C2MB 1SBBB 3S16B 4C1NI 4PNYA 4TRDA 2EYFA 3BS1A 1CTMA 2K03A 1KAAA 1Q1EA 4FF1A 1LABA 5ELFA 2BA1A 3NWSA 1ONLA 4F88A 2C5CA 1HXYD 4K2LA 5JEAH 3RD4A 2NUCA 3AB9A 4X3SA 5IGBA 1QCBD 3M4OB 5JOBA 3S14B 1C48A 3OPOA 2TSSA 4OIKA 2EYHA 1AEXA 4TSSA 2F0SA 4DAYA 4OIJA 5IGCA 1EOTA 3OOCA 3SHLA 4RFBA 2G9DA 4HAEA 1AZQA 3R93A 2WKDA 1EIGA 1KDBA 5JJZA 1WTQA 3QIAA 4HR7B 3NHHA 4HCSA 5IGGA 1U4LA 4HN7A 3W2DA 3G6JB 3I91A 1D5ZC 4IUNA 4NMZA 2HDLA 3TZDA 4UDUC 3KBXA 1D2BA 2VB2X 4MIUA 1JOOA 3MZ5A 1ICWA 3UI2A 1EYAA 3DEPA 2ENBA 3GTPB 4IQZA 2O5JC 5C4ZA 2XRSD 1IHZA 2PZTA 4ZYSA 1DM0B 1MI2A 1LO5D 1X3QA 5C0XJ 4ODGA 4KV6A 4FVMA 1B53A 1H9SA 5KEEA 1SMYC 4OO1G 2J4XA 1S5BD 1STGA 1SSOA 2B2YA 2XNAC 2HCCA 2O4XA 3MHBA 3L3OC 4RGOS 1PFBA 1LTBD 1B44D 3BVZA 2YU9B 1PTOH 2F0OA 1S4ZA 5I9PA 4TQUS 2YYZA 4KMUC 2JA7B 3CQZB 4IFDJ 2BDNA 1SE4A 4RAUC 3H09A 1KTKA 4KD4A 3NTHA 1SE3A 3BZDB 1QNKA 3FPUB 2B2VA 2KOLA 2CW0C 3FEWX 3FRPB 4B08A 2EJFC 1S5FD 3T53B 1DYQA 2FMCA 2KCCA 4QB4A 3N6RA 1SFOB 1TWHB 3D8GA 5CGKA 3S1QB 4C3JB 5BN5A 2OXPA 2XRQD 1SYCA 5LHY1 3GTKB 2B2VC 1T5EA 3MFYA 5KNCA 4J1MA 4NDXA 3E5SA 3C2PA 4QUFA 4ABNA 3ONAB 2O5IC 5IGDA 1DOMA 5ELBA 3T16A 5FO8B 5EPJA 1Y69U 1FGBD 1R4QB 3J7AV 1K83B 3A55A 2KUMA 2QCPX 3C0NA 1I4RA 3ERQA 4BS9A 2N55A 1UAPA 4ULLA 2CW0D 1LV9A 5C3EB 1M8AA 1O78A 4NP5A 1QILA 1TWGB 3VYTA 4QF4A 3TN2A 4P2CB 5DM63 1EEID 2E2DC 3CRKC 4OHJA 2FFKB 3OMCA 2IJ0A 4WFN3 3TMEA 2SEBD 1ZYRC 1HCZA 4RCOA 1TS3A 4N9TA 1ET6A 1B9MA 1CFMA 5TSSA 4CHTB 5EBCA 3ND8A 2NYZD 5M5XB 2KECA 3MXGA 4M8AA 2PO4A 3NPPA 3IKJA 4A3JB 1XTCD 1PTOD 2K33A 1O7ZA 2CQAA 3PUXA 4QCLA 1EY9A 3SK8A 1XXGA 2VB3X 1HRJA 4RWSC 1KABA 1L0XB 5A35A 2ZXOA 2K5WA 3I70A 5KNDA 1DOKA 1Y1VB 5T1GA 4XYOA 1PMRA 1BDOA 5ELDA 2WAQB 1NSNS 1PDQA 3PUYA 3I72A 5ISRA 1ZXTA 2R61A 3NUCA 3H94A 1PLFA 1TQOA 2BE5D 3V2TA 3K0YA 2K7VA 5T1IA 5C4HA 3TP7A 1Z7TA 1ZKOA 2SOBA 1TS2A 1WTPA 3BDCA 2A6HD 3R8BA 3QOJA 1STNA 3LX0A 1NR4A 1NR2A 4IFDI 1E0BA 2EJMA 3G7LA 3RLFA 4FO2A 2MP1A 1GUOA 2D9UA 1F9SA 3X3NA 3T4AC 2JSOA 1PTOC 1EEFD 1S5CD 2K04A 2X6LA 2EDGA 3QG1A 3VYSA 1OXSC 1UEAB 5EBDA 3SVMA 5CORA 1VDZA 1PZKD 2SNSA 1JWUD 2BOSA 3U9OA 5C4JB 1I4GA 4RCNA 4A3DB 4IURA 1M4VA 2FJ2A 5I2YA 1LACA 2M9VA 1EWHA 4IZ8A 4A3EB 3D4WA 1OXUA 1YNJC 3I4MB 2MUYA 3OWEB 2B2TA 3LNNA 1TWAB 3CKIB 2BA0A 1WTWA 4O1NA 1IKMA 4RGTA 4RKLA 2E2HB 3KLSA 4KJNA 2RDGA 3S17B 4A3BB 2F4IA 2IPKD 3KF8A 4DA2A 2A73B 1ZEQX 2DY8A 2WACA 3R2IA 3QO2A 1PFNA 2WIIB 2MGSA 4G57A 1EZ8A 2K6AA 4ME5A 2IL8A 3Q6SA 5DAUA 3DM1A 1PRTC 2A5HA 1DD2A 2NVYB 1V43A 3KLSX 1QB5D 3GTOB 3HRZC 3DEOA 1BO0A 3VYUA 3D4DA 2AQ1B 3QWNA 1VMPA 5C0XG 5FKAC 1BCPF 3KBGA 3KK7A 1I4XA 3FPPA 3BG3A 3GP7A 1GUSA 3RZOB 4PMCA 5C6AA 2F0JA 2K5QA 1BBXC 2HDMA 1STAA 1RD9D 3DWQA 5COYA 1SJED 3TP8A 2XVSA 3G4NA 3HGBA 5G3LD 2OT2A 1F2MA 5EGTA 4NKLA 3W3AA 2EXZA 5KYIA 5I2XA 3HOVB 1EY5A 1KDCA 1U4RA 4V190 1GHKA 1O7YA 4Q5VA 3J7AF 1CQVA 1TWCB 4H44C 4C3IG 1R9TB 5I4DA 2F0KA 1HPCA 2AQ3B 3QB3A 4JBWA 3A54A 1EZ6A 4XT1B 1SXTA 4ZAIA 1BCPD 4LJZC 3HOXB 1IW7D 4HEDA 4OO1H 2VXWA 1BR9A 5E4WC 3DMUA 3PUZA 1DJRD 2F1MA 3FDTA 3FVQA 2G9HD 3VR4A 1A6XA 3FMCA 3CU7A 1Q90A 3S1MB 3MAQA 1ESFA 2L4NA 3M7GA 4KJOA 3K5NA 4M1UB 2JE6I 2D2CC 3X3MA 1DXMA 5FLXL 3D4RA 3GQBA 4N9PA 1T5XD 2Z4IA 3C46A 1HHVA 3S2HB 1JORA 3GTMB 2F3VA 5IODA 2PZWA 4R9WA 1U4MA 1SEBD 1ML0D 2EOTA 3VR3A 1JC7A 5KNBA 4IFDH 5EJWA 3HG9A 1RCVD 2PW7A 3QJYA 2OEOA 1SMYD 4IUVA 1S5DD 3SK4A 4EQPA 5NUCA 3SXHA 2B2YC 3HS0C 2FHTA 2F0GA 1RTNA 1A2TA 2R6GA 1IKLA 1B9NA 1KNEA 3TBIB 3PV0A 2XN9C 5M3FB 2F0PA 4KN7C 2D5DA 1B3AA 3GO5A 3H6MA 3J81E 2PYKA 2JYOA 1H9MA 5JEAG 3OMGA 2A6EC 1VMCA 1A3UA 4C3HG 4IN3A 3NTKA 2HCIA 4I7ZC 4F7XA 4BBSB 3URYA 1JE4A 5C0XH 3A7LA 1C4QA 1D5MC 1RODA 1V8QA 2EY6A 2E75C 2F03A 4G7OC 3MFGA 4DU9A 4FF2A 1EIHA 1QOHA 1K8MA 4IUTA 1VF7A 3WOFA 2OF1A 4V0BA 2NVQB 1K8OA 1JICA 1I3QB 1E2ZA 3MWYW 5M3MB 4L6TB 1Y8NB 3H91A 1HUNA 2IX1A 2XIWA 4EQOA 2E2IB 2E2JB 3H3VC 4QUCA 4A3GB 4DN4M 3V96A 2NN6H 3D6CA 5JVH3 2SDFA 4KHVA 3GTJB 4MHEA 4B9XA 2BDOA 5DM73 2H1EA 2B2UA 4RGNA 2KVMA 4WJWA 2I07B 2B63B 3A56A 5E1FA 4ZKBB 1PFMA 2L11A 3C1EA 2J7ZA 1STBA 4ZKCB 1PRTB 5J1ZA 2WINB 5EQ0A 1W6KA 1SNQA 4RHRA 2F0MA 4RH6A 1F2ZA 2IWHA 3WOEA 3M4YA 2KJXA 4IALA 3EROA 2V4DA 4TKOB 4DXGA 1CHPD 1V1PA 1BOSA 3K5MA 5AFWA 1I50B 4ZK9B 3NBIA 2ZXPA 2SNMA 2Z4HA 4DK0A 3HOUB 3TZUA 2E74C 2RVLA 3EVQA 4YIJA 1JCKB 1O7LA 1PYWD 2RSOA 1GUWA 4PV1C 5CR3A 1CHQD 3VR6A 1QG7A 3TP5A 1HTPA 1CZGA 3D3RA 5IT9E 4X3KA 1GXDC 5KYLA 3O13A 3Q22A 3BYYB 2IT1A 4F87A 1XWEA 1BUVT 3K7AB 2VNUD 3DWPA 2I46A 4BBRB 1Z47A 4C1NK 1ZYRD 1ENFA 4CJ1B 2WKCA 3TDQA 1OO9B 5DEHA 3BDOA 1SE2A 1VF5C 2AUJD 2WB1B 4DAPA 1RF2D 1SNDA 4DGZA 3TP6A 2AQ2B 3AMUA 1ET9A 3T56B 1IL8A 4DK1A 4KD3A 2MJ8A 4CJ2C 4EVOA 1JR0D 3I90A 3P1HA 1CK1A 2JP1A 3HOZB 1QJOA 1V1OA 4FF4A 1CA6A 2RDHA 1A3VA 3K5OA 3M7NA 3JAME 3D31A 3C0OA 3J80L 3I8ZA 1EU3A 1PREA 2CVRA 1ILQA 4PMBA 3GV6A 3T13A 4XT3B 4CBVA 4KKUA 1RHPA 3T51B 4HTHA 4R8IA 3KLRA 2AWNA 1EYCA 4H13C 1WD1A 1I6HB 2AUKA 1OXVA 2NWGA 1LT6D 1G8ZD 4RHSA 2EPBA 1TY2A 1GHJA 3NXWA 3L7ZC 4XQNA 5CBEE 5C5MA 2H4OA 5EKLA 1WTOA 1EY0A 1A3TA 1A15A 1SNOA 1DOLA 2LKVA 1LTTD 5M5WB 1CA5A 3CRLC 1JOQA 5K36H 1HFNA 1Q1BA 4HMIA 5ELCA 3N52A 1TR5A 3Q23A 3GTGB 1PRTF 1SJHD 3SR1A 2PPBC 1EL0A 3NTIA 2IW3A 2PNRC 4IUUA 3SDZA 2D62A 2F0IA 5KRUA 1WVLA 1Y8PB 3P7JA 1BF4A 4XQQA 2WP8J 3J81L 3JAML 1FYCA 4L8JA 1KLGD 4ZQ3A 1TU2B 3C1FA 5FK9C 4Y7NB 4RA8A 3KUPA 1QWYA 4KHZA 2VUMB 5K5PA 1HQMC 2EJGC 1JB3A 1V1PB 2F0VA 2EYLA 4J8QA 2IX0A 4EGVA 1SYGA 1EQTA 2L12A 5FO9B 3SK6A 1SYEA 4XIGS 1J9OA 4FXGC 4HSVA 4S3SA 1KNAA 2JA5B 1XYIA 3EJIA 3A7AB 1YNNC 2AWOA 1EYDA 2Q8IB 2A69C 1B50A 1HUMA 2JXMB 5CV7A 2XSCA 1GUGA 2KCNA 1LTGD 5IT9L 1RDPD 4OL7A 2WV6D 1BNZA 3M85A 3HZXA 4PQXA 2Q8RE 3C3LA 1W6JA 4IFDG 3PO2B 1BCPB 1ENAA 5EKIA 1E2VA 3VA5A 4ZUJA 5JPMC 2NTSA 3PUWA 1IW7C 1CM9A 1DZ1A 2TMPA 3WDNA 4HSPA 2NTTA 1B4OA 1IYVA 1FNWA 4DXFA 1X32A 2R3ZA 1FNVA 3QOLA 2M2LA 3EFXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDH A;  3G4O A;  1FGB D;  1PRT C;  2J4X A;  5FK9 C;  3BYT B;  1JWM D;  1Z52 A;  1LTR D;  1S5B D;  1S5E D;  1PZJ D;  3URY A;  1D5X C;  3C0O A;  1PRE A;  1EU3 A;  1LT5 D;  2XNA C;  5ELF A;  5D3I B;  1D5M C;  1PTO B;  1DJR D;  1TS2 A;  3R8B A;  3C0N A;  1I4R A;  1I4P A;  3BVM A;  4RGO S;  3MFG A;  2G9H D;  1HXY D;  3KLS X;  1D6E C;  1GOZ A;  1LTB D;  1PZI D;  1STE A;  2ICI A;  4L63 B;  1QIL A;  3EA6 A;  1V1P B;  1JCK B;  1PYW D;  1B44 D;  2AQ1 B;  3BVZ A;  4RGM A;  1PTO H;  5FKA C;  1BCP F;  4BWG B;  1ESF A;  1HQR D;  1LT4 D;  2TSS A;  4L6T B;  4Z9C B;  1LTI D;  1CHQ D;  1I4X A;  1PRT D;  1LT6 D;  1PTO C;  1G8Z D;  1EEF D;  1S5C D;  4TSS A;  1EEI D;  4OHJ A;  4RHS A;  3GP7 A;  1TY2 A;  2IJ0 A;  2SEB D;  4RFB A;  4RCO A;  1TS3 A;  1SE4 A;  2QIL A;  1T5X D;  3O13 A;  1KTK A;  1RD9 D;  1UUP A;  1PZK D;  1SE3 A;  1ET6 A;  3DWQ A;  3C0M A;  3BZD B;  1EFI D;  3BYY B;  1JWU D;  5TSS A;  1LTT D;  1SJE D;  1I4G A;  1FNU A;  1EWC A;  3MC0 B;  1S5F D;  1LTG D;  3G4N A;  1DYQ A;  1RDP D;  3DWP A;  1M4V A;  1SEB D;  3W2D A;  4RGN A;  2WV6 D;  1I4Q A;  5ELC A;  2QEJ C;  1D5Z C;  1XTC D;  1BCP B;  1PRT F;  1PTO D;  1SJH D;  1MD2 D;  4UDU C;  1BCP C;  1RCV D;  1XXG A;  2XRQ D;  1KLU D;  3CHB D;  1FD7 D;  1HTL D;  3OWE B;  1TY0 A;  1ENF A;  1LLR D;  1CQV A;  1S5D D;  3BVG A;  1PTO F;  2NTS A;  5ELE A;  4O1N A;  1AN8 A;  4RGT A;  1PRT B;  1L0X B;  5D3D A;  1AW7 A;  1SE2 A;  5I4D A;  1RF2 D;  1BXT A;  3V05 A;  1I4H A;  2AQ2 B;  4RHR A;  1ET9 A;  4RH6 A;  3DWA A;  1TS5 A;  2RDG A;  2XRS D;  2XN9 C;  1JWS D;  1HA5 A;  1JQY D;  2O2L D;  2NTT A;  3TSS A;  2IPK D;  4ZYS A;  1JR0 D;  5ELD A;  1FNW A;  1UNS A;  2AQ3 B;  1TS4 A;  1F77 A;  4DXF A;  3R2I A;  3SEB A;  1CK1 A;  1LO5 D;  1SXT A;  2CHB D;  1CHP D;  1V1P A;  2Z8L A;  1CT1 D;  4DXG A;  2R61 A;  4C56 C;  1V1O A;  1B1Z A;  1FNV A;  1BCP D;  1EU4 A;  1LT3 D;  1SBB B;  4K6L A;  5ELB A;  1LTS D;  3R2T A;  1L0Y B;  1KLG D;  3EFX D;  1LTA D; 
#chains in the Genus database with same CATH topology
 5IYD H;  2VQE Q;  4DV4 Q;  1QE6 A;  2NZO A;  3NBH A;  3OTO L;  4A3I H;  4JI1 Q;  3SK5 A;  2JA6 B;  1SNM A;  3S2H H;  1S5E D;  1HR0 W;  3LWU A;  1R4P B;  5IYC H;  2LXK A;  3GTM H;  3HKZ B;  1WCM B;  2B63 G;  3RLO A;  1YNN D;  1H9R A;  5D14 A;  2X69 A;  4QMG A;  4LAA A;  3I73 A;  3OIP A;  1PA6 A;  1D7Q A;  1AE2 A;  3NBH B;  1AFP A;  2ZXR A;  1D6E C;  4ZRZ A;  5I9O A;  1JB7 A;  4OXP A;  5GAG C;  4GZY C;  1NTG A;  2Q8T A;  2A68 D;  4X62 Q;  3NP8 A;  3S15 B;  5H1S E;  3I4N B;  3HEJ A;  2RHQ B;  5I6Y A;  3MXU A;  3MXN A;  2WFW A;  3PSI A;  4JPB W;  4PMW A;  4A93 G;  1HJP A;  3GTL H;  4Z9C B;  3PO3 H;  4LF4 L;  2K50 A;  4K8I A;  2DJF C;  3MA2 B;  4DV5 Q;  3NQI A;  3ER0 A;  1Q3L A;  4KY7 A;  3L9A X;  2EYJ A;  4AYB B;  5M3F H;  1I6H H;  2NVX B;  1PFS A;  2F0E A;  2ID0 A;  5EPK A;  1SLJ A;  1GD7 A;  2C9O A;  3PMF A;  2CCZ A;  1OXX K;  3ULL A;  4JC0 A;  1L0W A;  1AP0 A;  3KLW A;  1X3P A;  1Y8O B;  1F9P A;  2EY1 A;  5K36 G;  4CDC C;  2B2W C;  1XMO L;  1V9P A;  2Z1C A;  4LF7 L;  4WOR A;  4BY1 G;  1E22 A;  1MSG A;  1SYF A;  1U4P A;  3EQL C;  2EZV A;  4L5S A;  3B6Y A;  3UDG A;  2R92 G;  3AU7 A;  2QDB A;  4DK3 C;  3HOX G;  1Y1W G;  3PIO 3;  4XQJ A;  5IYB H;  3J7A 5;  2WAQ E;  2F0F A;  1HA6 A;  1S3O A;  1MHW C;  2YTV A;  3OWF A;  2F0U A;  1X56 A;  4Q0F A;  1UE1 A;  1H9S B;  4RKB A;  3CCU A;  3TSS A;  2NVQ H;  1DCZ A;  1I3Q H;  2YV5 A;  5JVG 3;  1UNS A;  1F77 A;  3S2D H;  3SEB A;  4DNT B;  2LSS A;  5C44 B;  2IX3 A;  2B8F A;  1N34 Q;  2CH4 W;  4C56 C;  5IIF A;  1EY6 A;  1B2T A;  1EU4 A;  5CV8 A;  3OSO A;  1VCI A;  3NWT A;  2E5L Q;  4A3G H;  1TWF H;  1JWM D;  1LTR D;  5HUR A;  1Y1W B;  1PXU A;  3PQI A;  4JVZ A;  4LF4 Q;  1D5X C;  3KOJ A;  2KEN A;  2K01 A;  1WTV A;  4A3F H;  1IL2 A;  5DNF A;  4ZLT F;  2UUB Q;  3FKI B;  4K2K A;  2EYO A;  2HUG A;  5M9O A;  2LS0 1;  1NY4 A;  3S1N H;  3E0J A;  1GOZ A;  3NE5 B;  1TII D;  1ENC A;  5C5L A;  4DNR B;  3K59 A;  3EA6 A;  1MBY A;  1Z6H A;  2A6E D;  2PZU A;  3KFU A;  5I6W A;  5HGT A;  1VS0 A;  4WJ3 M;  2B63 H;  4G7Z C;  4BWG B;  1UEB A;  2XTI A;  3TRE A;  4CKC A;  2VUM H;  1Q86 C;  5D65 A;  4IPD A;  4A93 B;  2JEA I;  4XYQ A;  5FO7 B;  3VR5 A;  4HIK A;  3A8J E;  3ND9 A;  3NEM A;  1VQI A;  3HKS A;  1HFG A;  1AH9 A;  2EIF A;  4X3U A;  4IPC A;  1VQL A;  3T1H L;  2B8G A;  1RL2 A;  2Y0S B;  1CI3 M;  2B39 A;  2DNC A;  5FLX E;  5IGF A;  2Y0S E;  1F9Q A;  1KD1 C;  4BA2 I;  1EUJ A;  1I50 H;  3K5L A;  2R93 B;  4G4K A;  5C3E G;  1MD2 D;  4JI7 Q;  3DHQ A;  4H7B A;  2OWO A;  4JBM A;  2VQE L;  5CC4 A;  3BVG A;  5ELE A;  1QNU A;  4XTC S;  4DR5 L;  2L55 A;  4A3M B;  5HY6 A;  1AW7 A;  4JI5 Q;  1KAW A;  1J8I A;  5KIX A;  3RZD B;  1BXT A;  4RG1 A;  3PIP 3;  1ESR A;  4DAV A;  3ULJ A;  1WD0 A;  1JQY D;  1OXT A;  2EE1 A;  3AYH B;  2NZH A;  3MXP A;  4BBS G;  2CHB D;  1FGU A;  3LWE A;  4FF3 A;  4KI0 A;  4NXM L;  3I4O A;  1LTS D;  3R2T A;  5AJ3 Q;  1LTA D;  1X65 A;  4KK7 A;  2DNE A;  4DUY Q;  2AHO B;  2IHE A;  5LL6 S;  2RF4 A;  3S1R B;  4IJL A;  4X65 L;  4YY3 Q;  5IGE A;  4XXE A;  4C3I B;  5CBA E;  1IBK L;  2EVB A;  1CZW A;  3K57 A;  1IBL Q;  1G6Z A;  3AFP A;  4J6H A;  5CYU A;  1LM0 A;  3GTP H;  5LL6 X;  1STE A;  1X6O A;  4JK1 C;  2ICI A;  3F8T A;  4L63 B;  4KY5 A;  2JA6 H;  5CV5 A;  3KJP A;  2F0W A;  2UXD L;  4B9W A;  4OGQ C;  4B3M Q;  1LT4 D;  4IO9 A;  2YTX A;  5BR8 Q;  2BE5 C;  4DV6 Q;  1SYD A;  4HJ8 A;  2HQE A;  4AQY L;  4PG3 A;  3M3Y H;  2K32 A;  3MEH A;  4P72 A;  1Q46 A;  1H9J A;  3I4N H;  5J39 A;  1G2S A;  2BCO A;  2A6H C;  2JEB I;  4U68 A;  2F0L A;  3VYR A;  4BA1 I;  4K0K L;  2R7Z B;  3R3O A;  4JI0 L;  4KKT A;  3GTL B;  3PO3 B;  3FKI G;  4UAI A;  4MTN A;  2F0D A;  2I5M X;  3ZYY X;  3G6E A;  3MC0 B;  1G29 1;  2M00 A;  4KLK A;  2FIN B;  4KN4 C;  1C7Y A;  2B2T C;  1RKN A;  2ZTE A;  2MNA A;  1I4Q A;  1KDA A;  1SDF A;  1G2T A;  2PCF B;  5GQO A;  2NB0 A;  5FLM H;  2YU9 H;  5J22 A;  2K05 A;  2NBF A;  4KY6 A;  2NN6 G;  1B70 B;  2KA7 A;  1KLU D;  3CHB D;  3E6Z X;  3U9S A;  4CKE A;  1YHQ A;  3HOZ G;  4UHV A;  2RA4 A;  1AN8 A;  4GLV B;  1I94 L;  1A0I A;  2MHV A;  4BBR G;  3DWA A;  3NSW A;  5GAD C;  1JWS D;  4DR2 Q;  3F2C A;  5C3W A;  4JI8 L;  4OWX B;  2F3W A;  2L5T A;  3ERS X;  5CMD A;  3LGJ A;  2JQO A;  4EQN A;  2X6G A;  1B1Z A;  4JI2 Q;  3WWV A;  3JC6 6;  1H9K A;  4IOC A;  5CV9 A;  2LFN A;  2VL6 A;  1VQ8 A;  2PNH A;  2PQE A;  4FXD A;  3RUZ A;  5GAH C;  4C3J H;  1TKW B;  4ZCK A;  1Z52 A;  4MN3 A;  4KHP Q;  1LT5 D;  3J80 E;  3GTK H;  3IFD A;  3OYY A;  2PI2 E;  5M5W H;  4QIW B;  5BN4 A;  1Q7Y C;  3MTS A;  2LMC B;  1GKH A;  4DV1 L;  3BVM A;  1II3 A;  4FP5 D;  1N9W A;  4HJ9 A;  2EY5 A;  1STY A;  3VR2 A;  1PZI D;  3EBE A;  4POF A;  2WAQ G;  2NVT B;  4A3K B;  4C3H B;  4LUV A;  3GTG H;  1SNP A;  4QJF A;  2QF7 A;  2ZT9 C;  2K5D A;  1UE5 A;  3T1Y L;  3KDF B;  5ELN A;  2RQX A;  3GDE A;  2RCN A;  2R92 H;  1V1Q A;  1O80 A;  4LK1 C;  1VQH A;  3D6W A;  1Q82 C;  4HIM A;  2K1B A;  2F0Q A;  2FMM A;  3K58 A;  2RHS B;  3C0M A;  4CGY B;  1EY8 A;  3GTQ B;  4F8M A;  1LTL A;  3S9W A;  1WTX A;  4BY7 B;  5C4X B;  4DFA A;  2F0H A;  4G7H C;  3AEV A;  4YCU A;  1MSH A;  3SE0 A;  3OHX C;  2K52 A;  3BZC A;  2Z6K A;  1D1K A;  3RMH A;  4P74 A;  4E6I A;  4LF5 L;  2LXJ A;  2ICE C;  5JJL A;  1FD7 D;  2DGY A;  3Q24 A;  1DON A;  5A2Q E;  1YEZ A;  4KTA A;  5D3D A;  2A1A A;  1BVS A;  3V05 A;  2L1B A;  2K28 A;  1T9H A;  3A8I E;  3S16 H;  5CV4 A;  2WB1 E;  4GLA C;  2ZTD A;  1STH A;  2Z0S A;  1WTR A;  2JA8 B;  1CKO A;  1VQJ A;  4A3M H;  1TVX A;  1AZP A;  3P75 A;  5FLX c;  3RZD H;  4LF6 L;  5IOC A;  4A76 A;  2K5H A;  1NE3 A;  4K5X A;  4FXK C;  3IAY A;  4K6L A;  4C3J G;  1L0Y B;  1C8C A;  5E3F A;  4JBJ A;  1F9R A;  1PH1 A;  2K14 A;  3RLN A;  3BYT B;  1EY4 A;  3HFZ B;  1RTO A;  1PZJ D;  2F0N A;  4O42 A;  2QKI C;  5D3I B;  4BY1 B;  1A2U A;  4HJ7 A;  1I4P A;  4ILW A;  4LFA Q;  1U9R A;  2XWJ B;  3FHW A;  1BQQ T;  4JOI A;  1F2Y A;  4ID6 A;  1Y1V H;  4NXM Q;  1NCV A;  4DKA C;  4QY7 A;  1YHB A;  1HNZ L;  2ZTC A;  1GM5 A;  2CH4 A;  4IPH A;  2UUC Q;  3PO2 H;  1Y14 B;  2RBM A;  1NUC A;  4C3I H;  1CQF A;  5BN3 A;  4RGM A;  1F2L A;  5EKK A;  4XDX A;  2KED A;  1LTI D;  4LF5 Q;  3RR5 A;  1KXL A;  4K5V A;  2MPM A;  2B2U C;  1KHI A;  3EN2 A;  3DUZ A;  4DR6 Q;  1JJ2 A;  4I65 A;  2RSN A;  1GUT A;  4OWT B;  2N49 A;  1G91 A;  1EFI D;  4PZ7 A;  1SN8 A;  5JPN C;  2RKS A;  3F2U A;  3I4L A;  3NK9 A;  4K14 A;  3M3Y B;  1EWC A;  1WTH A;  2QA4 A;  4KKS A;  4K5W A;  5A2Q L;  3P20 A;  4IUQ A;  5E4X A;  5FOB B;  4HIO A;  4K6D A;  3BDL A;  2HIX A;  5JAV A;  1EOV A;  3I56 A;  3HKZ E;  2DJG C;  3NQT A;  5KGU A;  2R7Z H;  3Q0A A;  1NJI C;  4A3I B;  2F0T A;  4B3T L;  4DF7 A;  1HTL D;  2Q2H A;  2RDF A;  1PTO F;  3IL8 A;  4HMJ A;  1U0L A;  3IFT A;  5C0X I;  2A69 D;  3J7Z C;  4LMQ D;  2L9H A;  1NNX A;  2XGT A;  1I4H A;  5M5Y B;  1TS5 A;  2JA7 G;  1HA5 A;  4DV1 Q;  2ASB A;  2GA4 B;  1W3S A;  3S15 H;  4DV5 L;  1SYB A;  1EQV A;  1TS4 A;  3BU2 A;  2JA6 G;  4K8J A;  4H0L C;  2LY7 A;  2A68 C;  5CV6 A;  4N8F A;  1FR3 A;  1I6V C;  1VQM A;  4A3D H;  3DXJ C;  4WRD A;  5EPL A;  5M3M G;  3I3C A;  1LT3 D;  2DY7 A;  1YNJ D;  3OW7 A;  3JAM c;  1NMG A;  3G4O A;  2L0C A;  3K6O A;  1D1I A;  2NVX H;  3VA7 A;  2E76 C;  2NZ1 D;  5LMU L;  1EQR A;  1TWA H;  2NN6 I;  1PTO B;  3U50 C;  2UXB L;  1XX8 A;  2JJQ A;  1Y1V G;  1VQ4 A;  2A8V A;  1CKM A;  4CJ0 B;  2KEE A;  2XWB B;  4CKB A;  2R7F A;  1EY7 A;  1N34 L;  2EYM A;  4DV2 L;  3T1H Q;  3UE1 A;  4A3G G;  1HQR D;  1ILP A;  1WCM G;  5F2D A;  4DUZ L;  1K28 A;  1PRT D;  3UDX A;  2KQ3 A;  2PW5 A;  2EYP A;  1RJT A;  4J15 A;  3L2P A;  1VQN A;  3H0G B;  1IYU A;  2NVT H;  4B3M L;  1GUN A;  4C3H H;  1E7Z A;  1K0S A;  2YTY A;  2QIL A;  4FNF A;  1JOK A;  2EY2 A;  1UUP A;  1TWH H;  4R8N A;  4DR5 Q;  4HID A;  4POG A;  3S2D B;  4OO1 I;  2R92 B;  1FNU A;  2NVY H;  1Q12 A;  3CXC A;  3CC2 A;  1Q8I A;  3HOY B;  1Z9F A;  4X3T A;  3M4P A;  1BBU A;  1MJC A;  2ZM6 L;  2N78 A;  4U67 3;  1HH2 P;  1IBM Q;  2QEJ C;  3BZK A;  3MVV A;  3CCV A;  2A74 C;  5BR8 L;  1TWF B;  3MEF A;  3GV3 A;  3I2Z A;  1Y1W H;  1BCP C;  3KF6 B;  1MGS A;  1TY0 A;  3A8K E;  1LLR D;  1E2W A;  5C4X H;  3J7Y W;  3STB D;  4A3F B;  4H02 A;  4LW1 A;  4NW2 A;  3ITP A;  4X62 L;  3RZO H;  2N88 A;  1VQP A;  4HCE A;  5C3X A;  3S1N B;  2DN8 A;  4YWM A;  2ZJR A;  2K75 A;  5JEA J;  3RN5 A;  1CUK A;  2PMZ B;  1SAP A;  1TT2 A;  4B3S L;  3HOW B;  3E3X A;  2O2L D;  4LF8 Q;  1I5F A;  2CWP A;  1PH7 A;  5G3L F;  3GD7 A;  3A5U A;  2B2W A;  3OIQ A;  1GJX A;  1SNC A;  2HHH Q;  4ZUI A;  5IWA L;  1NAP A;  2UU9 Q;  4LNQ A;  2Z8L A;  3PUV A;  2KHS A;  4IUP A;  1CT1 D;  4FYD A;  3PO3 G;  3HP3 A;  1EFW A;  5JJK A;  4A93 H;  2J0T D;  4C2M B;  1SBB B;  3S16 B;  4I7A A;  4JG2 A;  4UP7 A;  4C1N I;  4PNY A;  4TRD A;  4PZ8 A;  2EYF A;  1ASZ A;  2KHI A;  3BS1 A;  1CTM A;  1VQK A;  4ME3 A;  1FJG L;  2K03 A;  4JV5 Q;  1KAA A;  1Q1E A;  4FF1 A;  1LAB A;  1TWG H;  4DR3 Q;  5ELF A;  2BA1 A;  3NWS A;  5FJ8 G;  4P73 A;  1ONL A;  4F88 A;  4B3R Q;  2C5C A;  1EYG A;  4PZ6 A;  1HXY D;  3TRZ A;  4K2L A;  5JEA H;  3RD4 A;  2NUC A;  1UE6 A;  3AB9 A;  4X3S A;  5IGB A;  1QCB D;  3CAM A;  3M4O B;  5JOB A;  3S14 B;  1YHA A;  1C48 A;  3OPO A;  2TSS A;  4OIK A;  2EYH A;  1AEX A;  3CPF A;  4TSS A;  2F0S A;  4DAY A;  2Y0S G;  4OIJ A;  5IGC A;  1EOT A;  3OOC A;  1PHJ A;  2UUC L;  3SHL A;  4RFB A;  2G9D A;  4DR3 L;  4JI0 Q;  4HAE A;  4R4I A;  3HOX H;  3R93 A;  3T1Y Q;  1AZQ A;  2WKD A;  1EIG A;  1KDB A;  5JJZ A;  1WTQ A;  3QIA A;  3HOV G;  4EX5 A;  4HR7 B;  3NHH A;  4LFC Q;  1WYD A;  4GS3 A;  2JA8 G;  4HCS A;  5IGG A;  1U4L A;  2AKW B;  4HN7 A;  3W2D A;  1XTD A;  1YZ6 A;  4L5Q A;  3G6J B;  3I91 A;  1D5Z C;  3S1M H;  3JAM i;  4IUN A;  1HZB A;  4NMZ A;  2HDL A;  3TZD A;  2KHJ A;  4UDU C;  3KBX A;  1D2B A;  2VB2 X;  4MIU A;  4UP8 A;  2F4V L;  1JOO A;  2HD3 A;  3MZ5 A;  2I0Q A;  4LUZ A;  1ICW A;  3UI2 A;  1VQ5 A;  1EYA A;  3DEP A;  1VQO A;  1SRO A;  3UE0 A;  2ENB A;  3GTP B;  4GKJ Q;  4IQZ A;  2VY3 A;  2O5J C;  5C4Z A;  4JV5 L;  2XRS D;  2HIV A;  1IHZ A;  2PZT A;  1X9N A;  4ZYS A;  2R93 G;  4DV4 L;  1DM0 B;  1MI2 A;  1LO5 D;  1X3Q A;  3PCO B;  5C0X J;  1BKB A;  5IP7 H;  1KRT A;  1GVP A;  4ODG A;  4KV6 A;  4FVM A;  4DR4 L;  1PYB A;  1N32 Q;  5M5Y H;  1B53 A;  4A3C H;  1H9S A;  5KEE A;  4LF9 Q;  1SMY C;  4OO1 G;  2J4X A;  3PIO A;  1S5B D;  1STG A;  3A0J A;  1E24 A;  1KL9 A;  1SSO A;  2B2Y A;  1B7Y B;  2XNA C;  2HCC A;  2O4X A;  3H15 A;  3MHB A;  3L3O C;  4DR2 L;  4RGO S;  1PFB A;  1VQD A;  1LTB D;  4JI7 L;  4RMF A;  1VQ9 A;  1J5E L;  1B44 D;  3BVZ A;  2YU9 B;  1M90 C;  1PTO H;  2Q2T A;  2F0O A;  1S4Z A;  2CQO A;  5I9P A;  4TQU S;  2YYZ A;  4KMU C;  4DUY L;  2JA7 B;  2MO0 A;  3CQZ B;  4IFD J;  2KBN A;  1QVF A;  4LFB Q;  2BDN A;  1SE4 A;  3K80 C;  5ELO A;  4RAU C;  3H09 A;  1KTK A;  4KD4 A;  3NTH A;  1SE3 A;  4BBS H;  3BZD B;  1QNK A;  3FPU B;  2B2V A;  2KOL A;  2CW0 C;  3FEW X;  4A3E H;  1XNQ L;  3I4M H;  3FRP B;  4B08 A;  2EJF C;  3H0G H;  1S5F D;  3K0X A;  3T53 B;  1DYQ A;  4YHH Q;  1E1T A;  2FMC A;  2KCC A;  2E2H H;  4QB4 A;  3N6R A;  1SFO B;  1TWH B;  3D8G A;  5CGK A;  3S1Q B;  4C3J B;  5BN5 A;  2OXP A;  2XRQ D;  1C9O A;  1SYC A;  5LHY 1;  3S17 H;  2N3S A;  3GTK B;  2B2V C;  1T5E A;  3E9I A;  3K8A A;  3HOY H;  2UUA Q;  1NMF A;  2G5D A;  3CC7 A;  3MFY A;  5KNC A;  4J1M A;  4NDX A;  3E5S A;  3C2P A;  4QUF A;  4ABN A;  5LMN W;  3A74 A;  3ONA B;  1H95 A;  2O5I C;  2MFI A;  5IGD A;  1FL0 A;  1DOM A;  2AMC B;  1AE3 A;  5ELB A;  2OTL A;  3T16 A;  5EPJ A;  5FO8 B;  1Y69 U;  2OQK A;  1FGB D;  1MIU A;  1R4Q B;  3J7A V;  3GTO H;  4R1J A;  1K83 B;  3A55 A;  5IP9 H;  3GTQ H;  2KUM A;  2QCP X;  1N33 L;  1J5E Q;  4C2M H;  3C0N A;  4GOP C;  1I4R A;  4A3C G;  4DV3 L;  3ERQ A;  4BS9 A;  4X6A H;  2N55 A;  1UAP A;  4ULL A;  2CW0 D;  2QW7 A;  1VQ6 A;  1LV9 A;  5C3E B;  1M8A A;  1O78 A;  1SRU A;  4NP5 A;  3RN2 A;  1QIL A;  1A8V A;  3DM3 A;  1TWG B;  2P5Z X;  3VYT A;  2UXB Q;  4QF4 A;  2KCM A;  3HOU G;  3ZJY C;  1PH9 A;  1XPR A;  3TN2 A;  4P2C B;  5DM6 3;  2VQF L;  1DGS A;  1EEI D;  2E2D C;  3CRK C;  4OHJ A;  2FFK B;  1FVI A;  3OMC A;  2IJ0 A;  4WFN 3;  3TME A;  2SEB D;  1ZYR C;  4DUZ Q;  4YY3 L;  1HCZ A;  4RCO A;  1TS3 A;  1SE8 A;  4N9T A;  4GKK Q;  3F2D A;  1B9M A;  1ET6 A;  1CFM A;  2V1C C;  2E8G A;  2JA8 H;  5TSS A;  4CHT B;  1HNX L;  5EBC A;  3ND8 A;  3J80 c;  3KF8 B;  4YWK A;  2JA9 A;  2NYZ D;  5M5X B;  2KEC A;  1LYL A;  3MXG A;  4M8A A;  2PO4 A;  3NPP A;  3Q8D A;  3IKJ A;  4A3J B;  3EIV A;  1XTC D;  1PTO D;  2K33 A;  1O7Z A;  2CQA A;  3PUX A;  4DAY B;  4QCL A;  1EY9 A;  3SK8 A;  1XXG A;  2VS1 A;  2VB3 X;  4BY1 H;  1HRJ A;  4RWS C;  1KAB A;  2L15 A;  1L0X B;  5AJ3 L;  4OWW B;  5A35 A;  1XMQ L;  2ZXO A;  2K5W A;  1M1K C;  3I70 A;  5KND A;  1DOK A;  1Y1V B;  4X65 Q;  5T1G A;  1IXR A;  4XYO A;  1PMR A;  2F52 A;  1BDO A;  5ELD A;  1WI5 A;  2WAQ B;  1NSN S;  1KC8 C;  4DR1 Q;  3K7A H;  1PDQ A;  3PUY A;  3CCM A;  4DV0 L;  3I72 A;  5ISR A;  1ZXT A;  2R61 A;  3NUC A;  3H94 A;  5IWA Q;  1QZH A;  4A3F G;  1PLF A;  1TQO A;  2BE5 D;  1QUQ A;  2JA5 G;  3V2T A;  2QEX A;  3L0O A;  3K0Y A;  2K7V A;  5T1I A;  5C4H A;  2UXC Q;  3TP7 A;  1Z7T A;  1ZKO A;  2SOB A;  1TS2 A;  3BDC A;  3R8B A;  2A6H D;  1WTP A;  3QOJ A;  1CSQ A;  1STN A;  4DK6 C;  4A3J G;  3LX0 A;  1B3Q A;  1NR4 A;  1NR2 A;  4IFD I;  1E0B A;  2EJM A;  2HT1 A;  3G7L A;  4YCV A;  4FO2 A;  4LWC A;  3RLF A;  1JT8 A;  2MP1 A;  1GUO A;  2D9U A;  5IE8 A;  1F9S A;  2GVB A;  3X3N A;  3T4A C;  4AQY Q;  4AYB G;  5GRO A;  2CWA A;  4UPA A;  3HOZ H;  2JSO A;  1PTO C;  1EEF D;  1S5C D;  1CKN A;  2K04 A;  2X6L A;  1L1O A;  2EDG A;  3QG1 A;  1E1O A;  4DR7 L;  1JJG A;  2F3I A;  4L5T A;  5C4X G;  3VYS A;  1OXS C;  1G51 A;  1UEA B;  5EBD A;  3SVM A;  5COR A;  1VDZ A;  1PZK D;  2SNS A;  1HR0 Q;  1JWU D;  2BOS A;  3E9H A;  3U9O A;  4X66 L;  5C4J B;  1I4G A;  4RCN A;  5LMN L;  1EIY B;  3H3V I;  2JA7 H;  1IYJ B;  3CQZ H;  4A3D B;  4IUR A;  1HZA A;  1M4V A;  2FJ2 A;  3CF5 A;  4NB3 A;  3U4V A;  5I2Y A;  1N33 Q;  1LAC A;  4APV A;  2M9V A;  1EWH A;  4IZ8 A;  4UY8 C;  4A3E B;  2Q2I A;  3D4W A;  1OXU A;  1YNJ C;  3I4M B;  2MUY A;  5JJI A;  4X64 L;  3OWE B;  2B2T A;  2PQA B;  1TWA B;  3LNN A;  3CKI B;  2BA0 A;  4O1N A;  1WTW A;  1IKM A;  4RGT A;  1K73 C;  4RKL A;  2E2H B;  1SFO H;  3KLS A;  3TS0 A;  1XPU A;  4JCV E;  3S1Q H;  4KJN A;  4MZ9 A;  2RDG A;  3I4M G;  3S17 B;  4A3B B;  1PH2 A;  2F4I A;  2IPK D;  4BXX H;  4EQ5 A;  3KF8 A;  2OCE A;  4DA2 A;  2A73 B;  1ZEQ X;  2DY8 A;  2WAC A;  3R2I A;  1IZ6 A;  3QO2 A;  2I5L X;  1PFN A;  2WII B;  2MGS A;  1FJG Q;  2VUM G;  4G57 A;  4GLX A;  1EZ8 A;  5E7N A;  1HNX Q;  2K6A A;  4ME5 A;  2IL8 A;  3Q6S A;  5DAU A;  3DM1 A;  5IP9 G;  3NEL A;  1PRT C;  5J3B A;  3CC4 A;  4GOP B;  1MKH A;  2A5H A;  2WB1 G;  1DD2 A;  1G6P A;  4JYA L;  2NVY B;  3VDY A;  5M3M H;  4JI4 Q;  1V43 A;  2D0P A;  3KLS X;  1QB5 D;  1E3P A;  2E2I H;  2E2J H;  1YNX A;  3GTO B;  3HRZ C;  3DEO A;  1K83 H;  1BO0 A;  3VYU A;  2D0O A;  3D4D A;  2AQ1 B;  3QWN A;  1VMP A;  5C0X G;  5FKA C;  1BCP F;  3KBG A;  2N8N A;  3KK7 A;  3UDF A;  3FPP A;  1I4X A;  3GTJ H;  3BG3 A;  4OX9 Q;  5C3E H;  3GP7 A;  1GUS A;  3RZO B;  4PMC A;  5C6A A;  2F0J A;  3E0E A;  1K9M C;  2K5Q A;  5IP7 G;  4Y7N H;  4YHH L;  1K3B C;  2HDM A;  4X64 Q;  1BBX C;  1STA A;  1RD9 D;  3DWQ A;  5COY A;  1YI2 A;  3HOW H;  1XMQ Q;  1L1O B;  1SJE D;  3J80 i;  2I5H A;  3TP8 A;  4QQB X;  2XVS A;  1HNW L;  3G4N A;  3HGB A;  2CKZ B;  4YCW A;  5G3L D;  2OT2 A;  1F2M A;  5EGT A;  4NKL A;  3W3A A;  2EXZ A;  5KYI A;  5I2X A;  3HOV B;  1EY5 A;  1KDC A;  1U4R A;  2EQS A;  2JN4 A;  4V19 0;  1GHK A;  1O7Y A;  4Q5V A;  3KDF A;  3J7A F;  4JI1 L;  1CQV A;  1TWC B;  1SR3 A;  4DV2 Q;  4H44 C;  4C3I G;  1R9T B;  5I4D A;  4GKK L;  2Z9H A;  1XNR L;  2F0K A;  2UUB L;  2C35 B;  1X3E A;  3M4O H;  3PO2 G;  3W5O A;  1HPC A;  3HKZ G;  5L37 A;  2AQ3 B;  3FP9 A;  2K4K A;  3QB3 A;  4JBW A;  3S14 H;  4A3B G;  3A54 A;  1EZ6 A;  4XT1 B;  1SXT A;  4ZAI A;  1BCP D;  3HOU H;  4B3T Q;  4LUO A;  5LMN Q;  4LJZ C;  2R7D A;  4FDB A;  4MTK A;  3STB C;  3HOX B;  1IW7 D;  4HED A;  4DV0 Q;  1L2F A;  4OO1 H;  2VXW A;  1N36 L;  4LFA L;  1BR9 A;  5E4W C;  3DMU A;  3PUZ A;  1DJR D;  4TVA B;  2F1M A;  3FDT A;  3M4Q A;  1WJJ A;  3FVQ A;  2G9H D;  3VR4 A;  3PF5 A;  1A6X A;  3FMC A;  2B29 A;  4A3M G;  2BH8 A;  3CU7 A;  1Q90 A;  3S1M B;  3M9B A;  5FJ8 H;  1A63 A;  3S24 A;  3MAQ A;  4GNX B;  1ESF A;  4KJO A;  2L4N A;  3M7G A;  1PH5 A;  4QGU A;  4AYB E;  3K5N A;  3MXN B;  4M1U B;  4LFB L;  2JE6 I;  5IT9 c;  2D2C C;  3X3M A;  1DXM A;  5FLX L;  1N8R C;  3D4R A;  4DV6 L;  4KHP L;  2UXC L;  3GQB A;  4N9P A;  1T5X D;  1YVC A;  4OON A;  2Z4I A;  3C46 A;  1HHV A;  4GOP A;  3S2H B;  3PIP A;  4IPG A;  4BBR H;  3GTM B;  1JOR A;  4O2D A;  2F3V A;  5IOD A;  3CME A;  1B8A A;  2PZW A;  1SMX A;  1YBY A;  4R9W A;  3CMA A;  1PV4 A;  1U4M A;  2K5V A;  4JI6 Q;  1SEB D;  3CCS A;  4IJH A;  1ML0 D;  2EOT A;  3VR3 A;  1JC7 A;  5KNB A;  2UUA L;  4IFD H;  5EJW A;  3CCJ A;  4Y52 H;  1XJV A;  2ZM6 Q;  1N32 L;  1XNR Q;  3HG9 A;  1RCV D;  2PW7 A;  3QJY A;  2OEO A;  2B3G A;  1SMY D;  4IUV A;  1S5D D;  4DNI A;  3SK4 A;  3H0G G;  4EQP A;  5NUC A;  3SXH A;  2B2Y C;  3HS0 C;  4JOI C;  1O7I A;  2QGQ A;  1EWI A;  2FHT A;  2PMZ E;  2F0G A;  1RTN A;  1A2T A;  2R6G A;  1IKL A;  4DAM A;  2UU9 L;  1B9N A;  1KNE A;  3TBI B;  3PV0 A;  2XN9 C;  5M3F B;  1HZC A;  4JI4 L;  4KN7 C;  2F0P A;  2D5D A;  1B3A A;  4A75 A;  1I94 Q;  3GO5 A;  3H6M A;  3J81 E;  3TS2 A;  2PYK A;  4CDE C;  2JYO A;  2QDL A;  1H9M A;  2UXD Q;  5JEA G;  3OMG A;  2A6E C;  1TXY A;  1VMC A;  1A3U A;  4NXN Q;  4C3H G;  4IN3 A;  4A3I G;  3NTK A;  1NBW A;  5IYD G;  2HCI A;  4I7Z C;  1IBL L;  4F7X A;  4BBS B;  3URY A;  1JE4 A;  5C0X H;  3A7L A;  1C4Q A;  1D5M C;  4GKJ L;  1ROD A;  1V8Q A;  2EY6 A;  2E75 C;  2F03 A;  4G7O C;  3MFG A;  4B3S Q;  2Q2U A;  4DU9 A;  4FF2 A;  1EIH A;  2VW9 A;  1QOH A;  1K8M A;  1KQS A;  4IUT A;  1VF7 A;  3WOF A;  2PI2 A;  2F4V Q;  2OF1 A;  4V0B A;  2NVQ B;  1K8O A;  1LUZ A;  1JIC A;  1I3Q B;  4HJ5 A;  4DR4 Q;  1E2Z A;  3MWY W;  4DV7 L;  4GN5 A;  5GAE C;  5M3M B;  4L6T B;  1Y8N B;  3PF4 A;  3H91 A;  1HUN A;  2IX1 A;  2XIW A;  4EQO A;  4BY7 G;  2E2I B;  2E2J B;  3H3V C;  4QUC A;  3UDI A;  2BH2 A;  4A3G B;  4DN4 M;  3V96 A;  2NN6 H;  3W1G A;  1VQB A;  1PVO A;  3D6C A;  5JVH 3;  2SDF A;  4KHV A;  3GTJ B;  2VZA A;  4MHE A;  4B9X A;  2BDO A;  5DM7 3;  1XPO A;  3IRB A;  3FKI H;  2H1E A;  1IBM L;  3CCL A;  2ZJQ A;  3HOW G;  1N36 Q;  2HHH L;  1QVG A;  2B2U A;  4RGN A;  2KVM A;  3W1B A;  3I4N G;  4R4C A;  1EQQ A;  4WJW A;  2I07 B;  2B63 B;  3PGZ A;  3A56 A;  4LF7 Q;  5E1F A;  4ZKB B;  1PFM A;  2L11 A;  3C1E A;  2J7Z A;  2Z6B A;  1STB A;  2K5N A;  4ZKC B;  1PRT B;  3H3V H;  5J1Z A;  3CD6 A;  4JW0 A;  2WIN B;  5EQ0 A;  1W6K A;  3HOV H;  1SNQ A;  4RHR A;  1VQE A;  2F0M A;  4RH6 A;  3J81 i;  1F2Z A;  4O0A A;  1XMO Q;  2IWH A;  4P71 A;  3WOE A;  3M4Y A;  4OEL B;  2KJX A;  3I55 A;  4IAL A;  3ERO A;  1W2B A;  2V4D A;  1R9T H;  4TKO B;  4DXG A;  1CHP D;  1V1P A;  4K0K Q;  3OW2 A;  4L5R C;  3A5Z B;  3G4S A;  1BOS A;  4R4T A;  1VQA A;  3K5M A;  5AFW A;  1I50 B;  4ZK9 B;  3NBI A;  1CKN B;  2ZXP A;  1CSP A;  1MJE A;  3KF6 A;  2SNM A;  2Z4H A;  4DK0 A;  3HOU B;  4BXX G;  3J81 j;  5M5X H;  1PYS B;  3U58 A;  3TZU A;  4A3J H;  2E74 C;  2RVL A;  1KRS A;  3EVQ A;  2JA5 H;  4YIJ A;  1JCK B;  3CW2 C;  4GNX C;  1YJN A;  4JYA Q;  1O7L A;  1PYW D;  5C44 G;  3F1Z A;  2PQA A;  1OTC A;  2RSO A;  1GUW A;  4PV1 C;  5CR3 A;  1CHQ D;  3VR6 A;  1X3G A;  1QG7 A;  3TP5 A;  1HTP A;  1CZG A;  4R4O A;  3D3R A;  5IT9 E;  4X3K A;  4A3K G;  5LMU Q;  1GXD C;  1HNW Q;  4R4Q A;  5KYL A;  2CFM A;  3O13 A;  4NXN L;  3S1R H;  3Q22 A;  4JI5 L;  3BYY B;  2IT1 A;  4F87 A;  2R7Z G;  1XWE A;  2DUD A;  1BUV T;  4LF8 L;  3K7A B;  5IYB G;  2VNU D;  1QVC A;  3DWP A;  4AH6 A;  1JJC B;  3ICE A;  4UP9 A;  3NEN A;  1J6Q A;  2I46 A;  4BBR B;  2VQF Q;  1P16 A;  1Z47 A;  4C1N K;  1ZYR D;  1ENF A;  4NPS A;  4CJ1 B;  4QL5 A;  2WKC A;  3TDQ A;  1OO9 B;  2OTJ A;  5DEH A;  3BDO A;  1SE2 A;  1VF5 C;  2AUJ D;  2WB1 B;  4DAP A;  1RF2 D;  2ZJP A;  1SND A;  4DGZ A;  3TP6 A;  2AQ2 B;  3AMU A;  1ET9 A;  3T56 B;  1IL8 A;  4DK1 A;  4KD3 A;  5IY0 A;  2Z6K C;  2MJ8 A;  4CJ2 C;  4DR7 Q;  4EVO A;  4LF9 L;  1JR0 D;  3I90 A;  3P1H A;  2E5L L;  1CK1 A;  3CCE A;  2JP1 A;  3HOZ B;  1WCM H;  1QJO A;  1V1O A;  1QUQ B;  4FF4 A;  1CA6 A;  4LFC L;  2RDH A;  2IY5 B;  1A3V A;  3CCR A;  3K5O A;  3G71 A;  3M7N A;  3JAM E;  4ALP A;  4LF6 Q;  3D31 A;  3C0O A;  4DR6 L;  3J80 L;  3I8Z A;  1EU3 A;  3RNU A;  1PRE A;  4AIM A;  1WOC A;  3KJO A;  2CVR A;  5C4J H;  1ILQ A;  2JK8 A;  4PMB A;  3GV6 A;  3T13 A;  1PH8 A;  3D0F A;  1HZ9 A;  4XT3 B;  4CBV A;  4KKU A;  1HR0 L;  1RHP A;  3T51 B;  4HTH A;  4R8I A;  1Q81 C;  1XNQ Q;  3I7F A;  3KLR A;  3J81 c;  1UWV A;  4YWL A;  2AWN A;  1K3R A;  1EYC A;  4H13 C;  4GN3 B;  1WD1 A;  1ASY A;  1I6H B;  2GVA A;  2H5X A;  1YJ9 A;  3TEH B;  1RIP A;  2AUK A;  1OXV A;  2NWG A;  4A3D G;  1LT6 D;  1KIX A;  1G8Z D;  4RHS A;  3QR8 A;  2EPB A;  1TY2 A;  2FXQ A;  4JBK A;  1GHJ A;  3NXW A;  3L7Z C;  5CBE E;  4XQN A;  5C5M A;  4JI6 L;  2H4O A;  5EKL A;  4DPG A;  1WTO A;  1EY0 A;  4A3B H;  1A3T A;  1A15 A;  1SNO A;  1DOL A;  2LKV A;  1LTT D;  5M5W B;  1S72 A;  4WJ4 A;  1CA5 A;  3CRL C;  1JOQ A;  1X3F A;  5K36 H;  5M3F G;  1WFQ A;  1HFN A;  3DLL A;  1Q1B A;  4HMI A;  5ELC A;  4DV7 Q;  2MO1 A;  3N52 A;  4A3K H;  1TR5 A;  3Q23 A;  1K8A C;  3GTG B;  1PRT F;  1SJH D;  1VQG A;  4A4I A;  3AFQ A;  3SR1 A;  2PPB C;  4JI3 Q;  1K0R A;  1L1O C;  1EL0 A;  2EXD A;  2IW3 A;  3NTI A;  1PH3 A;  2PNR C;  4IUU A;  1UE7 A;  3OTO Q;  3SDZ A;  2D62 A;  2F0I A;  5C44 H;  2A19 A;  2ALY B;  4OEM B;  1GO3 E;  5KRU A;  4CDF C;  1WVL A;  1K8G A;  1IBK Q;  3G48 A;  1Y8P B;  1YIT A;  3P7J A;  1S40 A;  1BF4 A;  1X55 A;  4XQQ A;  1U5K A;  1YJW A;  2WP8 J;  3J81 L;  3JAM L;  1PH4 A;  4BY7 H;  1FYC A;  5IYC G;  3CP0 A;  4L8J A;  1EIF A;  1KLG D;  4ZQ3 A;  4X66 Q;  1TU2 B;  3C1F A;  5FK9 C;  1JE5 A;  3ULP A;  4Y7N B;  4OX9 L;  4RA8 A;  3AQQ A;  3BJU A;  3KUP A;  3CCQ A;  4DV3 Q;  1QWY A;  3U4Z A;  1C0A A;  2RCF A;  4KHZ A;  1A62 A;  2VUM B;  5K5P A;  1HQM C;  3K81 C;  2EJG C;  1D8L A;  1JB3 A;  4DR1 L;  3TQY A;  1V1P B;  1PH6 A;  2F0V A;  2EYL A;  4J8Q A;  2IX0 A;  4EGV A;  1SYG A;  1EQT A;  5HGQ A;  2L12 A;  5FO9 B;  3SK6 A;  4A3L G;  1TWC H;  4JI3 L;  1SYE A;  4N8X 1;  5EAY A;  1P8L A;  4XIG S;  1J9O A;  4FXG C;  4HSV A;  4S3S A;  1KNA A;  2JA5 B;  3HOY G;  1XYI A;  3EJI A;  3A7A B;  4MNO A;  1YNN C;  2AWO A;  1EYD A;  4GN4 B;  2A69 C;  2Q8I B;  1B50 A;  1HUM A;  5FLM G;  2JXM B;  1VQ7 A;  2R93 H;  2MQH A;  5CV7 A;  1BBW A;  4A3E G;  4P75 A;  2XSC A;  1GUG A;  2KCN A;  1LTG D;  1VQC A;  5IT9 L;  1RDP D;  1Q8K A;  4OL7 A;  1X54 A;  3K7U C;  2WV6 D;  3KYH C;  1BNZ A;  3M85 A;  3HZX A;  1ICF B;  4PQX A;  2Q8R E;  3C3L A;  2GN5 A;  4CDD C;  1W6J A;  2ATW A;  4IFD G;  3PO2 B;  1BCP B;  1ENA A;  2OQ0 A;  5EKI A;  1YIJ A;  4JI2 L;  1E2V A;  3VA5 A;  5DLQ E;  3F2B A;  1JMC A;  2KCT A;  1VQF A;  4ZUJ A;  5JPM C;  2NTS A;  3PUW A;  1IW7 C;  3SGI A;  1HNZ Q;  1CM9 A;  4JI8 Q;  1DZ1 A;  4HJA A;  2TMP A;  2HQL A;  4A3L H;  4IOA A;  2IHF A;  3WDN A;  4B3R L;  4HSP A;  2NTT A;  1B4O A;  2ES2 A;  1IYV A;  1FNW A;  4DXF A;  3CPW A;  4GNX A;  1X32 A;  1QZG A;  2R3Z A;  1FNV A;  3QOL A;  4QIW E;  2M2L A;  3EFX D; 
#chains in the Genus database with same CATH homology
 1QE6 A;  3NBH A;  3SK5 A;  2JA6 B;  1SNM A;  1S5E D;  3LWU A;  1R4P B;  3HKZ B;  1WCM B;  1YNN D;  1H9R A;  5D14 A;  2X69 A;  4QMG A;  4LAA A;  3I73 A;  3OIP A;  1AFP A;  2ZXR A;  1D6E C;  4ZRZ A;  5I9O A;  4GZY C;  2Q8T A;  2A68 D;  3NP8 A;  3S15 B;  3I4N B;  3HEJ A;  5I6Y A;  3MXU A;  3MXN A;  4PMW A;  4Z9C B;  4K8I A;  3MA2 B;  3NQI A;  1Q3L A;  4KY7 A;  3L9A X;  2EYJ A;  4AYB B;  2NVX B;  2F0E A;  2ID0 A;  5EPK A;  2C9O A;  3PMF A;  1OXX K;  1AP0 A;  1X3P A;  1Y8O B;  1F9P A;  2EY1 A;  5K36 G;  2B2W C;  2Z1C A;  4WOR A;  3EQL C;  2EZV A;  1MSG A;  1SYF A;  1U4P A;  3AU7 A;  2QDB A;  3PIO 3;  4XQJ A;  2F0F A;  1HA6 A;  3OWF A;  2F0U A;  4Q0F A;  1H9S B;  4RKB A;  3TSS A;  1DCZ A;  5JVG 3;  1UNS A;  1F77 A;  3SEB A;  4DNT B;  5C44 B;  2IX3 A;  2B8F A;  4C56 C;  5IIF A;  1EY6 A;  1B2T A;  1EU4 A;  5CV8 A;  3OSO A;  1VCI A;  3NWT A;  1JWM D;  1LTR D;  5HUR A;  1Y1W B;  1PXU A;  1D5X C;  1WTV A;  2K01 A;  5DNF A;  4ZLT F;  3FKI B;  4K2K A;  2EYO A;  2HUG A;  5M9O A;  2LS0 1;  3E0J A;  1GOZ A;  1TII D;  3NE5 B;  1ENC A;  5C5L A;  3K59 A;  4DNR B;  3EA6 A;  1MBY A;  1Z6H A;  2A6E D;  2PZU A;  5I6W A;  5HGT A;  4G7Z C;  4BWG B;  4CKC A;  5D65 A;  4A93 B;  2JEA I;  4XYQ A;  5FO7 B;  3VR5 A;  3A8J E;  3ND9 A;  1HFG A;  4X3U A;  2B8G A;  2Y0S B;  1CI3 M;  2B39 A;  2DNC A;  5FLX E;  5IGF A;  1F9Q A;  4BA2 I;  3K5L A;  2R93 B;  4G4K A;  1MD2 D;  3DHQ A;  4H7B A;  5CC4 A;  3BVG A;  5ELE A;  1QNU A;  4XTC S;  2L55 A;  4A3M B;  1AW7 A;  1J8I A;  5KIX A;  3RZD B;  1BXT A;  3PIP 3;  1ESR A;  4DAV A;  1WD0 A;  1JQY D;  1OXT A;  2EE1 A;  3MXP A;  2CHB D;  3LWE A;  4FF3 A;  4KI0 A;  1LTS D;  3R2T A;  1LTA D;  4KK7 A;  2DNE A;  5LL6 S;  3S1R B;  5IGE A;  4XXE A;  4C3I B;  5CBA E;  2EVB A;  1CZW A;  3K57 A;  1G6Z A;  4J6H A;  5CYU A;  5LL6 X;  1STE A;  2ICI A;  4L63 B;  4JK1 C;  4KY5 A;  5CV5 A;  2F0W A;  4B9W A;  4OGQ C;  1LT4 D;  2BE5 C;  1SYD A;  2HQE A;  2K32 A;  3MEH A;  1H9J A;  5J39 A;  1G2S A;  2BCO A;  2A6H C;  2JEB I;  4U68 A;  2F0L A;  3VYR A;  4BA1 I;  2R7Z B;  3R3O A;  4KKT A;  3GTL B;  3PO3 B;  4UAI A;  2F0D A;  3ZYY X;  3MC0 B;  1G29 1;  2M00 A;  2FIN B;  4KN4 C;  2B2T C;  1RKN A;  1I4Q A;  1KDA A;  1SDF A;  1G2T A;  2PCF B;  2NB0 A;  5J22 A;  2K05 A;  2NBF A;  2NN6 G;  3E6Z X;  2KA7 A;  1KLU D;  3CHB D;  4KY6 A;  3U9S A;  4CKE A;  2RA4 A;  1AN8 A;  2MHV A;  3DWA A;  3NSW A;  1JWS D;  5C3W A;  2F3W A;  2L5T A;  5CMD A;  4EQN A;  2X6G A;  1B1Z A;  1H9K A;  5CV9 A;  2LFN A;  2PQE A;  4FXD A;  3RUZ A;  1TKW B;  1Z52 A;  4MN3 A;  1LT5 D;  3J80 E;  3IFD A;  4QIW B;  5BN4 A;  3MTS A;  2LMC B;  3BVM A;  1II3 A;  4FP5 D;  2EY5 A;  1STY A;  3VR2 A;  1PZI D;  2NVT B;  4A3K B;  4C3H B;  1SNP A;  2QF7 A;  2ZT9 C;  2K5D A;  2RQX A;  1O80 A;  4LK1 C;  3D6W A;  2K1B A;  2F0Q A;  3K58 A;  2FMM A;  3C0M A;  4CGY B;  1EY8 A;  3GTQ B;  4F8M A;  3S9W A;  1WTX A;  4BY7 B;  5C4X B;  4DFA A;  2F0H A;  4G7H C;  1MSH A;  3SE0 A;  3OHX C;  1D1K A;  3RMH A;  4E6I A;  2ICE C;  1FD7 D;  3Q24 A;  1DON A;  5A2Q E;  4KTA A;  5D3D A;  3V05 A;  2L1B A;  2K28 A;  3A8I E;  5CV4 A;  1STH A;  1WTR A;  2JA8 B;  1TVX A;  1AZP A;  3P75 A;  5IOC A;  4K5X A;  4FXK C;  3IAY A;  4K6L A;  4C3J G;  1L0Y B;  1C8C A;  5E3F A;  1F9R A;  3BYT B;  1EY4 A;  1RTO A;  1PZJ D;  2F0N A;  4O42 A;  2QKI C;  5D3I B;  4BY1 B;  1A2U A;  1I4P A;  4ILW A;  1U9R A;  2XWJ B;  1BQQ T;  1F2Y A;  4ID6 A;  1NCV A;  2RBM A;  1NUC A;  1CQF A;  5BN3 A;  4RGM A;  1F2L A;  5EKK A;  4XDX A;  2KED A;  1LTI D;  4K5V A;  2MPM A;  2B2U C;  3DUZ A;  4I65 A;  2RSN A;  1GUT A;  1G91 A;  1EFI D;  5JPN C;  2RKS A;  3F2U A;  3I4L A;  3NK9 A;  4K14 A;  3M3Y B;  1EWC A;  4KKS A;  4K5W A;  5A2Q L;  3P20 A;  4IUQ A;  5E4X A;  5FOB B;  4K6D A;  3BDL A;  5JAV A;  5KGU A;  3NQT A;  3Q0A A;  4A3I B;  2F0T A;  4DF7 A;  1HTL D;  2RDF A;  1PTO F;  3IL8 A;  4HMJ A;  3IFT A;  5C0X I;  2A69 D;  4LMQ D;  2L9H A;  1I4H A;  5M5Y B;  1TS5 A;  1HA5 A;  2GA4 B;  1SYB A;  1EQV A;  1TS4 A;  4K8J A;  4H0L C;  2LY7 A;  2A68 C;  5CV6 A;  1FR3 A;  1I6V C;  3DXJ C;  4WRD A;  5EPL A;  3I3C A;  1LT3 D;  2DY7 A;  1YNJ D;  3OW7 A;  3G4O A;  2L0C A;  3K6O A;  1D1I A;  3VA7 A;  2E76 C;  2NZ1 D;  2NN6 I;  1PTO B;  1XX8 A;  4CJ0 B;  2KEE A;  2XWB B;  4CKB A;  1EY7 A;  2EYM A;  1HQR D;  1ILP A;  5F2D A;  1PRT D;  2KQ3 A;  2PW5 A;  2EYP A;  1RJT A;  3H0G B;  1IYU A;  1GUN A;  2QIL A;  4FNF A;  1JOK A;  2EY2 A;  1UUP A;  4R8N A;  3S2D B;  4OO1 I;  2R92 B;  1FNU A;  1Q12 A;  1Q8I A;  3HOY B;  4X3T A;  4U67 3;  2QEJ C;  3MVV A;  2A74 C;  1TWF B;  3GV3 A;  1BCP C;  1MGS A;  1TY0 A;  3A8K E;  1LLR D;  1E2W A;  3J7Y W;  4A3F B;  4NW2 A;  3ITP A;  2N88 A;  4HCE A;  5C3X A;  3S1N B;  2DN8 A;  5JEA J;  2PMZ B;  1SAP A;  1TT2 A;  3HOW B;  2O2L D;  5G3L F;  3GD7 A;  2B2W A;  3OIQ A;  1GJX A;  1SNC A;  4ZUI A;  1NAP A;  2Z8L A;  3PUV A;  2KHS A;  4IUP A;  1CT1 D;  4FYD A;  3HP3 A;  2J0T D;  4C2M B;  1SBB B;  3S16 B;  4C1N I;  4PNY A;  4TRD A;  2EYF A;  3BS1 A;  1CTM A;  2K03 A;  1KAA A;  1Q1E A;  4FF1 A;  1LAB A;  5ELF A;  2BA1 A;  3NWS A;  1ONL A;  4F88 A;  2C5C A;  1HXY D;  4K2L A;  5JEA H;  3RD4 A;  2NUC A;  3AB9 A;  4X3S A;  5IGB A;  1QCB D;  3M4O B;  5JOB A;  3S14 B;  1C48 A;  3OPO A;  2TSS A;  4OIK A;  2EYH A;  1AEX A;  4TSS A;  2F0S A;  4DAY A;  4OIJ A;  5IGC A;  1EOT A;  3OOC A;  3SHL A;  4RFB A;  2G9D A;  4HAE A;  1AZQ A;  3R93 A;  2WKD A;  1EIG A;  1KDB A;  5JJZ A;  1WTQ A;  3QIA A;  4HR7 B;  3NHH A;  4HCS A;  5IGG A;  1U4L A;  4HN7 A;  3W2D A;  3G6J B;  3I91 A;  1D5Z C;  4IUN A;  4NMZ A;  2HDL A;  3TZD A;  4UDU C;  3KBX A;  1D2B A;  2VB2 X;  4MIU A;  1JOO A;  3MZ5 A;  1ICW A;  3UI2 A;  1EYA A;  3DEP A;  2ENB A;  3GTP B;  4IQZ A;  2O5J C;  5C4Z A;  2XRS D;  1IHZ A;  2PZT A;  4ZYS A;  1DM0 B;  1MI2 A;  1LO5 D;  1X3Q A;  5C0X J;  4ODG A;  4KV6 A;  4FVM A;  1B53 A;  1H9S A;  5KEE A;  1SMY C;  4OO1 G;  2J4X A;  1S5B D;  1STG A;  1SSO A;  2B2Y A;  2XNA C;  2HCC A;  2O4X A;  3MHB A;  3L3O C;  4RGO S;  1PFB A;  1LTB D;  1B44 D;  3BVZ A;  2YU9 B;  1PTO H;  2F0O A;  1S4Z A;  5I9P A;  4TQU S;  2YYZ A;  4KMU C;  2JA7 B;  3CQZ B;  4IFD J;  2BDN A;  1SE4 A;  4RAU C;  3H09 A;  1KTK A;  4KD4 A;  3NTH A;  1SE3 A;  3BZD B;  1QNK A;  3FPU B;  2B2V A;  2KOL A;  2CW0 C;  3FEW X;  3FRP B;  4B08 A;  2EJF C;  1S5F D;  3T53 B;  1DYQ A;  2FMC A;  2KCC A;  4QB4 A;  3N6R A;  1SFO B;  1TWH B;  3D8G A;  5CGK A;  3S1Q B;  4C3J B;  5BN5 A;  2OXP A;  2XRQ D;  1SYC A;  5LHY 1;  3GTK B;  2B2V C;  1T5E A;  3MFY A;  5KNC A;  4J1M A;  4NDX A;  3E5S A;  3C2P A;  4QUF A;  4ABN A;  3ONA B;  2O5I C;  5IGD A;  1DOM A;  5ELB A;  3T16 A;  5FO8 B;  5EPJ A;  1Y69 U;  1FGB D;  1R4Q B;  3J7A V;  1K83 B;  3A55 A;  2KUM A;  2QCP X;  3C0N A;  1I4R A;  3ERQ A;  4BS9 A;  2N55 A;  1UAP A;  4ULL A;  2CW0 D;  1LV9 A;  5C3E B;  1M8A A;  1O78 A;  4NP5 A;  1QIL A;  1TWG B;  3VYT A;  4QF4 A;  3TN2 A;  4P2C B;  5DM6 3;  1EEI D;  2E2D C;  3CRK C;  4OHJ A;  2FFK B;  3OMC A;  2IJ0 A;  4WFN 3;  3TME A;  2SEB D;  1ZYR C;  1HCZ A;  4RCO A;  1TS3 A;  4N9T A;  1ET6 A;  1B9M A;  1CFM A;  5TSS A;  4CHT B;  5EBC A;  3ND8 A;  2NYZ D;  5M5X B;  2KEC A;  3MXG A;  4M8A A;  2PO4 A;  3NPP A;  3IKJ A;  4A3J B;  1XTC D;  1PTO D;  2K33 A;  1O7Z A;  2CQA A;  3PUX A;  4QCL A;  1EY9 A;  3SK8 A;  1XXG A;  2VB3 X;  1HRJ A;  4RWS C;  1KAB A;  1L0X B;  5A35 A;  2ZXO A;  2K5W A;  3I70 A;  5KND A;  1DOK A;  1Y1V B;  5T1G A;  4XYO A;  1PMR A;  1BDO A;  5ELD A;  2WAQ B;  1NSN S;  1PDQ A;  3PUY A;  3I72 A;  5ISR A;  1ZXT A;  2R61 A;  3NUC A;  3H94 A;  1PLF A;  1TQO A;  2BE5 D;  3V2T A;  3K0Y A;  2K7V A;  5T1I A;  5C4H A;  3TP7 A;  1Z7T A;  1ZKO A;  2SOB A;  1TS2 A;  1WTP A;  3BDC A;  2A6H D;  3R8B A;  3QOJ A;  1STN A;  3LX0 A;  1NR4 A;  1NR2 A;  4IFD I;  1E0B A;  2EJM A;  3G7L A;  3RLF A;  4FO2 A;  2MP1 A;  1GUO A;  2D9U A;  1F9S A;  3X3N A;  3T4A C;  2JSO A;  1PTO C;  1EEF D;  1S5C D;  2K04 A;  2X6L A;  2EDG A;  3QG1 A;  3VYS A;  1OXS C;  1UEA B;  5EBD A;  3SVM A;  5COR A;  1VDZ A;  1PZK D;  2SNS A;  1JWU D;  2BOS A;  3U9O A;  5C4J B;  1I4G A;  4RCN A;  4A3D B;  4IUR A;  1M4V A;  2FJ2 A;  5I2Y A;  1LAC A;  2M9V A;  1EWH A;  4IZ8 A;  4A3E B;  3D4W A;  1OXU A;  1YNJ C;  3I4M B;  2MUY A;  3OWE B;  2B2T A;  3LNN A;  1TWA B;  3CKI B;  2BA0 A;  1WTW A;  4O1N A;  1IKM A;  4RGT A;  4RKL A;  2E2H B;  3KLS A;  4KJN A;  2RDG A;  3S17 B;  4A3B B;  2F4I A;  2IPK D;  3KF8 A;  4DA2 A;  2A73 B;  1ZEQ X;  2DY8 A;  2WAC A;  3R2I A;  3QO2 A;  1PFN A;  2WII B;  2MGS A;  4G57 A;  1EZ8 A;  2K6A A;  4ME5 A;  2IL8 A;  3Q6S A;  5DAU A;  3DM1 A;  1PRT C;  2A5H A;  1DD2 A;  2NVY B;  1V43 A;  3KLS X;  1QB5 D;  3GTO B;  3HRZ C;  3DEO A;  1BO0 A;  3VYU A;  3D4D A;  2AQ1 B;  3QWN A;  1VMP A;  5C0X G;  5FKA C;  1BCP F;  3KBG A;  3KK7 A;  1I4X A;  3FPP A;  3BG3 A;  3GP7 A;  1GUS A;  3RZO B;  4PMC A;  5C6A A;  2F0J A;  2K5Q A;  1BBX C;  2HDM A;  1STA A;  1RD9 D;  3DWQ A;  5COY A;  1SJE D;  3TP8 A;  2XVS A;  3G4N A;  3HGB A;  5G3L D;  2OT2 A;  1F2M A;  5EGT A;  4NKL A;  3W3A A;  2EXZ A;  5KYI A;  5I2X A;  3HOV B;  1EY5 A;  1KDC A;  1U4R A;  4V19 0;  1GHK A;  1O7Y A;  4Q5V A;  3J7A F;  1CQV A;  1TWC B;  4H44 C;  4C3I G;  1R9T B;  5I4D A;  2F0K A;  1HPC A;  2AQ3 B;  3QB3 A;  4JBW A;  3A54 A;  1EZ6 A;  4XT1 B;  1SXT A;  4ZAI A;  1BCP D;  4LJZ C;  3HOX B;  1IW7 D;  4HED A;  4OO1 H;  2VXW A;  1BR9 A;  5E4W C;  3DMU A;  3PUZ A;  1DJR D;  2F1M A;  3FDT A;  3FVQ A;  2G9H D;  3VR4 A;  1A6X A;  3FMC A;  3CU7 A;  1Q90 A;  3S1M B;  3MAQ A;  1ESF A;  2L4N A;  3M7G A;  4KJO A;  3K5N A;  4M1U B;  2JE6 I;  2D2C C;  3X3M A;  1DXM A;  5FLX L;  3D4R A;  3GQB A;  4N9P A;  1T5X D;  2Z4I A;  3C46 A;  1HHV A;  3S2H B;  1JOR A;  3GTM B;  2F3V A;  5IOD A;  2PZW A;  4R9W A;  1U4M A;  1SEB D;  1ML0 D;  2EOT A;  3VR3 A;  1JC7 A;  5KNB A;  4IFD H;  5EJW A;  3HG9 A;  1RCV D;  2PW7 A;  3QJY A;  2OEO A;  1SMY D;  4IUV A;  1S5D D;  3SK4 A;  4EQP A;  5NUC A;  3SXH A;  2B2Y C;  3HS0 C;  2FHT A;  2F0G A;  1RTN A;  1A2T A;  2R6G A;  1IKL A;  1B9N A;  1KNE A;  3TBI B;  3PV0 A;  2XN9 C;  5M3F B;  2F0P A;  4KN7 C;  2D5D A;  1B3A A;  3GO5 A;  3H6M A;  3J81 E;  2PYK A;  2JYO A;  1H9M A;  5JEA G;  3OMG A;  2A6E C;  1VMC A;  1A3U A;  4C3H G;  4IN3 A;  3NTK A;  2HCI A;  4I7Z C;  4F7X A;  4BBS B;  3URY A;  1JE4 A;  5C0X H;  3A7L A;  1C4Q A;  1D5M C;  1ROD A;  1V8Q A;  2EY6 A;  2E75 C;  2F03 A;  4G7O C;  3MFG A;  4DU9 A;  4FF2 A;  1EIH A;  1QOH A;  1K8M A;  4IUT A;  1VF7 A;  3WOF A;  2OF1 A;  4V0B A;  2NVQ B;  1K8O A;  1JIC A;  1I3Q B;  1E2Z A;  3MWY W;  5M3M B;  4L6T B;  1Y8N B;  3H91 A;  1HUN A;  2IX1 A;  2XIW A;  4EQO A;  2E2I B;  2E2J B;  3H3V C;  4QUC A;  4A3G B;  4DN4 M;  3V96 A;  2NN6 H;  3D6C A;  5JVH 3;  2SDF A;  4KHV A;  3GTJ B;  4MHE A;  4B9X A;  2BDO A;  5DM7 3;  2H1E A;  2B2U A;  4RGN A;  2KVM A;  4WJW A;  2I07 B;  2B63 B;  3A56 A;  5E1F A;  4ZKB B;  1PFM A;  2L11 A;  3C1E A;  2J7Z A;  1STB A;  4ZKC B;  1PRT B;  5J1Z A;  2WIN B;  5EQ0 A;  1W6K A;  1SNQ A;  4RHR A;  2F0M A;  4RH6 A;  1F2Z A;  2IWH A;  3WOE A;  3M4Y A;  2KJX A;  4IAL A;  3ERO A;  2V4D A;  4TKO B;  4DXG A;  1CHP D;  1V1P A;  1BOS A;  3K5M A;  5AFW A;  1I50 B;  4ZK9 B;  3NBI A;  2ZXP A;  2SNM A;  2Z4H A;  4DK0 A;  3HOU B;  3TZU A;  2E74 C;  2RVL A;  3EVQ A;  4YIJ A;  1JCK B;  1O7L A;  1PYW D;  2RSO A;  1GUW A;  4PV1 C;  5CR3 A;  1CHQ D;  3VR6 A;  1QG7 A;  3TP5 A;  1HTP A;  1CZG A;  3D3R A;  5IT9 E;  4X3K A;  1GXD C;  5KYL A;  3O13 A;  3Q22 A;  3BYY B;  2IT1 A;  4F87 A;  1XWE A;  1BUV T;  3K7A B;  2VNU D;  3DWP A;  2I46 A;  4BBR B;  1Z47 A;  4C1N K;  1ZYR D;  1ENF A;  4CJ1 B;  2WKC A;  3TDQ A;  1OO9 B;  5DEH A;  3BDO A;  1SE2 A;  1VF5 C;  2AUJ D;  2WB1 B;  4DAP A;  1RF2 D;  1SND A;  4DGZ A;  3TP6 A;  2AQ2 B;  3AMU A;  1ET9 A;  3T56 B;  1IL8 A;  4DK1 A;  4KD3 A;  2MJ8 A;  4CJ2 C;  4EVO A;  1JR0 D;  3I90 A;  3P1H A;  1CK1 A;  2JP1 A;  3HOZ B;  1QJO A;  1V1O A;  4FF4 A;  1CA6 A;  2RDH A;  1A3V A;  3K5O A;  3M7N A;  3JAM E;  3D31 A;  3C0O A;  3J80 L;  3I8Z A;  1EU3 A;  1PRE A;  2CVR A;  1ILQ A;  4PMB A;  3GV6 A;  3T13 A;  4XT3 B;  4CBV A;  4KKU A;  1RHP A;  3T51 B;  4HTH A;  4R8I A;  3KLR A;  2AWN A;  1EYC A;  4H13 C;  1WD1 A;  1I6H B;  2AUK A;  1OXV A;  2NWG A;  1LT6 D;  1G8Z D;  4RHS A;  2EPB A;  1TY2 A;  1GHJ A;  3NXW A;  3L7Z C;  4XQN A;  5CBE E;  5C5M A;  2H4O A;  5EKL A;  1WTO A;  1EY0 A;  1A3T A;  1A15 A;  1SNO A;  1DOL A;  2LKV A;  1LTT D;  5M5W B;  1CA5 A;  3CRL C;  1JOQ A;  5K36 H;  1HFN A;  1Q1B A;  4HMI A;  5ELC A;  3N52 A;  1TR5 A;  3Q23 A;  3GTG B;  1PRT F;  1SJH D;  3SR1 A;  2PPB C;  1EL0 A;  3NTI A;  2IW3 A;  2PNR C;  4IUU A;  3SDZ A;  2D62 A;  2F0I A;  5KRU A;  1WVL A;  1Y8P B;  3P7J A;  1BF4 A;  4XQQ A;  2WP8 J;  3J81 L;  3JAM L;  1FYC A;  4L8J A;  1KLG D;  4ZQ3 A;  1TU2 B;  3C1F A;  5FK9 C;  4Y7N B;  4RA8 A;  3KUP A;  1QWY A;  4KHZ A;  2VUM B;  5K5P A;  1HQM C;  2EJG C;  1JB3 A;  1V1P B;  2F0V A;  2EYL A;  4J8Q A;  2IX0 A;  4EGV A;  1SYG A;  1EQT A;  2L12 A;  5FO9 B;  3SK6 A;  1SYE A;  4XIG S;  1J9O A;  4FXG C;  4HSV A;  4S3S A;  1KNA A;  2JA5 B;  1XYI A;  3EJI A;  3A7A B;  1YNN C;  2AWO A;  1EYD A;  2Q8I B;  2A69 C;  1B50 A;  1HUM A;  2JXM B;  5CV7 A;  2XSC A;  1GUG A;  2KCN A;  1LTG D;  5IT9 L;  1RDP D;  4OL7 A;  2WV6 D;  1BNZ A;  3M85 A;  3HZX A;  4PQX A;  2Q8R E;  3C3L A;  1W6J A;  4IFD G;  3PO2 B;  1BCP B;  1ENA A;  5EKI A;  1E2V A;  3VA5 A;  4ZUJ A;  5JPM C;  2NTS A;  3PUW A;  1IW7 C;  1CM9 A;  1DZ1 A;  2TMP A;  3WDN A;  4HSP A;  2NTT A;  1B4O A;  1IYV A;  1FNW A;  4DXF A;  1X32 A;  2R3Z A;  1FNV A;  3QOL A;  2M2L A;  3EFX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...