1PTOH

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
TPGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 45
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
H PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoH02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1ptoH01
1EU3A 1LLRD 1PTOC 2RDHA 1DJRD 3G4NA 1S5FD 4C56C 3URYA 1PRTD 1AN8A 1G8ZD 2G9HD 1KTKA 4OHJA 2IJ0A 1EEFD 1LTGD 1D6EC 5ELEA 5ELBA 1I4RA 1S5BD 1HXYD 3OWEB 4BWGB 3W2DA 1B44D 4UDUC 1QILA 5ELFA 1PZJD 1FGBD 4RHRA 1LTRD 3CHBD 1BCPD 3C0NA 4K6LA 1FNWA 1JWSD 1PTOF 3BZDB 5D3IB 3SEBA 1PYWD 1CK1A 1LTBD 4RH6A 1ESFA 1I4GA 3DWPA 1I4HA 1M4VA 1JWMD 4TSSA 5FK9C 1S5CD 1ET9A 3R2TA 2XN9C 3GP7A 1JQYD 1JWUD 1SJED 1GOZA 1PTOH 1EWCA 2RDGA 1PTOB 4O1NA 1V1PB 1I4XA 1TY2A 1PREA 3G4OA 1XTCD 3BVZA 3DWQA 4DXGA 5TSSA 1CQVA 1ET6A 1HQRD 4RGTA 1UUPA 1ENFA 1MD2D 2AQ1B 4ZYSA 1LTTD 1SBBB 1BXTA 1F77A 3DWAA 3V05A 2NTTA 1LT3D 5I4DA 4RFBA 2IPKD 1LT4D 2O2LD 1RCVD 1PZKD 1SE4A 1UNSA 1PRTC 1Z52A 1PTOD 2J4XA 1V1OA 1FNVA 1RDPD 1FD7D 1JR0D 2WV6D 2XRQD 5ELDA 3BVMA 1CT1D 3MC0B 1CHQD 3BYTB 1PRTB 1TS2A 1T5XD 2QILA 4RCOA 1FNUA 1LT5D 2R61A 3BYYB 1RF2D 1LTID 1HTLD 1HA5A 2CHBD 1I4QA 5D3DA 1BCPC 1D5XC 2AQ2B 4RGNA 3O13A 2SEBD 3BVGA 1KLUD 4RGOS 1SE2A 5ELCA 1S5DD 2XRSD 4L63B 4L6TB 1LTSD 1EEID 1EFID 1PRTF 2AQ3B 1BCPB 1L0YB 1CHPD 3C0OA 4DXFA 1V1PA 3EA6A 1SE3A 1AW7A 3C0MA 1TS5A 1TS3A 2XNAC 3KLSX 5FKAC 1JCKB 4Z9CB 1B1ZA 1S5ED 1I4PA 3EFXD 2TSSA 1TY0A 1RD9D 2QEJC 3R8BA 1PZID 1BCPF 1XXGA 1KLGD 1D5MC 1L0XB 2NTSA 1LO5D 4RHSA 1SEBD 2Z8LA 3TSSA 1SXTA 1SJHD 1STEA 1DYQA 2ICIA 1D5ZC 4RGMA 1EU4A 1LT6D 3MFGA 1LTAD 1TS4A 3R2IA
chains in the Genus database with same CATH superfamily
3DM1A 5COYA 1HZBA 4CDCC 2PMZB 3D0FA 4ALPA 2RVLA 2JEBI 1NBWA 3RZDB 2K01A 4PG3A 5C4HA 1B44D 1PH7A 1G2SA 4DK1A 3A8JE 2M00A 2I5MX 1EQVA 2OEOA 1O7LA 5IE8A 2Q2IA 3CC4A 1PHJA 1K8MA 2JA6G 3GTMB 2SDFA 4K2LA 1YI2A 3F2BA 1VQLA 1I4GA 2HHHQ 4GNXB 2QCPX 3G7LA 2PO4A 2VQEQ 1SLJA 2B8FA 2MHVA 2XN9C 1WCMH 4GLVB 1TY2A 1E2ZA 3NELA 1YZ6A 1XTCD 4PNYA 5C4JB 5FLXc 1AFPA 3CQZB 1IKLA 3X3NA 1WTHA 3SGIA 1QVCA 5M9OA 4RKBA 3T1HQ 4IO9A 4JV5L 2CKZB 2EXZA 4ME5A 3NBHA 1A62A 2NVYB 1V8QA 1KDAA 3S1QH 4DAYB 2F0TA 1TS2A 4RCOA 3WOEA 1LT5D 5IGEA 4DR1Q 1RF2D 4GOPB 3JAME 1GJXA 4V0BA 5HURA 3BVGA 2PQEA 4JI2Q 2D2CC 2MJ8A 3A5UA 5LMUQ 1HUMA 1O7ZA 5J39A 1SFOH 2YYZA 2Y0SE 4X65L 3M4QA 1BVSA 3C0MA 2A69C 1TWFH 3KF6B 3A7AB 4N8FA 5FO7B 2JA8G 1D5MC 1S72A 3F8TA 2RQXA 4IALA 1XMQQ 1Q86C 1X55A 2VW9A 5GADC 2QKIC 2JJQA 1FYCA 1KRSA 3DXJC 2R92B 4J6HA 2M2LA 2E74C 3RMHA 3PUWA 3K58A 3HOWB 1YITA 3TQYA 4HJ9A 3DM3A 4XQQA 4A3GB 5KYLA 2NYZD 3C2PA 4DR6L 4C3IH 1AN8A 2G9DA 5A2QE 2XIWA 4K8JA 3GV6A 1A6XA 5FLXL 3BS1A 3PQIA 3KLSA 1J5EQ 1PV4A 4I7ZC 4B9XA 4IQZA 2D9UA 1SYBA 1PFSA 1N33Q 3BZDB 5L37A 1O7IA 1B3QA 4DNIA 1KDBA 5I6YA 3S16B 1LTBD 2PZUA 3HOXG 3S2HH 4HTHA 4FF4A 2K52A 1B70B 4A3DB 3K0YA 1I4HA 1GUTA 2DJGC 4CKEA 1BNZA 1WTPA 1EQTA 2VQFQ 3LX0A 1Y8PB 1OXSC 2XWBB 4ME3A 5ELOA 1WD0A 3PGZA 4DR5Q 1JB7A 1U4PA 3NTKA 1SNDA 4FF1A 4H0LC 1CKMA 5K36H 2L5TA 2UU9Q 4JI1Q 1HQRD 3J81E 2VQEL 3GTJB 4R8NA 3KYHC 3RR5A 1N34L 4LAAA 4A3MH 2D0PA 5CV9A 4IUNA 3CCVA 3ULPA 2R6GA 1X3PA 2SOBA 3H15A 2J4XA 5JEAH 3TBIB 1EIHA 2HDLA 1K8OA 4NXNQ 2F0QA 1FVIA 3SXHA 1ZYRC 4C2MB 1FNUA 2R7ZB 1LTID 3C1FA 4GLAC 3J80E 2WKCA 3MHBA 4C3IG 1KHIA 3DEPA 1F2YA 3TRZA 1EY4A 2NB0A 3W3AA 2AQ3B 4NKLA 3T56B 4ODGA 1BQQT 3C0OA 3RUZA 3K5NA 2K5VA 4G57A 4O42A 4E6IA 4DN4M 4C3JB 4M8AA 5EGTA 3GV3A 1VQDA 4U68A 1IKMA 4DAVA 1AEXA 4X3UA 5T1IA 4JI5L 3M7NA 4GLXA 2RBMA 4PQXA 3G6EA 5LMNW 2XGTA 2D62A 4JOIA 3CW2C 1SJHD 2QGQA 1IYVA 3EN2A 3TP8A 4I7AA 4L5SA 5CV4A 4QGUA 3FHWA 5K36G 1Y1VB 2I46A 1S40A 2PZWA 3PUVA 3ZJYC 4P73A 2KEEA 4JCVE 4WJ4A 2A6ED 1TWGH 1B53A 4B3RL 3I4OA 2EY5A 5D65A 4Q5VA 1PZJD 5J3BA 1TVXA 2F0VA 4YWLA 4YCVA 3UI2A 1JE4A 1SSOA 4QMGA 1Q7YC 1E2WA 1XNRQ 4DK6C 4DV4Q 1J5EL 1M4VA 1JWMD 2MQHA 3AMUA 3LWUA 1W6JA 1VQNA 1D8LA 3TZUA 2RDGA 4XQNA 1ONLA 1CA5A 4R4OA 3EVQA 2EYMA 1E7ZA 4KN7C 1PFMA 3QJYA 2HIXA 3UDGA 5CGKA 3H94A 1J8IA 2WKDA 1ZKOA 1YJ9A 4DR5L 3AFQA 1LT3D 1WTXA 1RODA 3T1YL 1GHKA 2WAQG 4KY5A 3JAMc 1SE4A 2A1AA 3GO5A 5T1GA 2HDMA 5I2YA 3QIAA 4JBWA 4LFAQ 2KENA 3CC7A 2O5IC 4KHPQ 1N32Q 4PZ6A 3ITPA 4XTCS 2LY7A 4LJZC 1Z6HA 5CV8A 1ENAA 1VQ4A 2AUJD 3OMCA 3GTOH 3BZKA 2LSSA 5CMDA 1VQAA 4L5QA 4AIMA 1STHA 3S1MH 3NQIA 1EQQA 4LF5Q 2F0OA 4XYQA 4B3SL 3SK6A 2RCNA 2LMCB 4OONA 4UP9A 3TP7A 3Q8DA 5DNFA 3I70A 4X64Q 2XNAC 3KLSX 1B1ZA 2R93H 2PCFB 4TVAB 4P2CB 2PPBC 3BU2A 2WP8J 3CPWA 4MTKA 1DXMA 5KNBA 3NBHB 4YCWA 1EFWA 1GXDC 2AWNA 1E1OA 1SNPA 2K5WA 2ICIA 3I4MG 4IPCA 3F1ZA 2K03A 1C8CA 4A3BH 3HP3A 1LTAD 4LFBL 4X3SA 3A54A 4ZUJA 3ULLA 1WI5A 2ZTCA 4HJ5A 2CVRA 4A3LG 1NNXA 1YBYA 3HKZE 3C3LA 1EL0A 1PYSB 4DUYL 3HOVG 4WJWA 3JAML 4YHHQ 1EOTA 1ICWA 2K6AA 3U4VA 3GTPB 1S5CD 3J81c 2NUCA 2A5HA 2M9VA 3T51B 4OL7A 1GOZA 5CBEE 1SNQA 4LK1C 2VB3X 4O1NA 3KF8A 1SYFA 3H0GB 1XYIA 5CC4A 1NTGA 2YU9B 4MNOA 5DM63 1W3SA 3BVZA 3D4DA 3HOYG 5LMNQ 4RAUC 1YNND 2WB1B 2JYOA 1NY4A 3M4OH 2K5DA 1S4ZA 5HGQA 4C3HB 5I9PA 3MEFA 1LTTD 2B8GA 2V1CC 3RLFA 2DY7A 3EQLC 1IL2A 1GVPA 3OIQA 4JPBW 5BR8Q 4A3CG 1PLFA 4CJ0B 2UXBQ 4APVA 1VQBA 1UNSA 3J80c 3AB9A 2LXJA 4A3FB 3QOLA 4QUCA 5BN3A 4A3BG 3GTGB 1IL8A 3E5SA 4XT1B 5A2QL 4JYAQ 2ZTDA 2SNSA 1PH3A 1R4QB 1I4QA 4GKJQ 2L12A 4IUTA 3SK8A 1VQJA 4LF9L 4NP5A 2K33A 5ELCA 2K04A 1KD1C 4BY1H 1LTSD 1TWHH 2Z4HA 3IFTA 4S3SA 2K14A 1I94L 4A93B 2LFNA 1CSQA 1J6QA 2VS1A 1MSGA 4JC0A 1TU2B 4LF5L 1B4OA 3X3MA 4A3JG 2F3IA 2A8VA 1CKNA 1RIPA 2OQKA 4RHSA 3V2TA 1I50H 1TWAB 5JOBA 4AQYL 1IW7C 2OTJA 1PH8A 3M3YH 4R4QA 1UEBA 1BKBA 2F0KA 4DR3Q 2E2IH 1KL9A 4A3IH 2EY1A 1SE8A 3J81L 3S1RH 4QJFA 3D6CA 3FP9A 1EY5A 3VR4A 1A2TA 5M5XH 1EU3A 3G4NA 3T16A 1WFQA 3URYA 1C9OA 1A3UA 1RL2A 3CMAA 2EDGA 3HRZC 3E9IA 4OEMB 2F0GA 2H5XA 1FGBD 3PO2B 3CF5A 3J80L 2NVTB 1K8AC 1DOMA 4JW0A 3I73A 2JA7G 1JMCA 4FO2A 5EPKA 2Q2TA 4K0KQ 4A3KG 5GAGC 2WFWA 4GN4B 4QUFA 4IFDG 2OT2A 1GUSA 2VZAA 4BY1G 4YWKA 1AP0A 3M9BA 2N88A 3UDXA 1PTOB 2H4OA 3PO3H 1XPRA 1UAPA 3E0JA 3G4OA 1SYEA 1SYGA 1QUQB 5TSSA 1AE3A 3CRKC 1CA6A 5C3EH 5C44B 3CMEA 1ENFA 5FLMH 5M3FH 2PNHA 4EVOA 4DFAA 2MP1A 1K0RA 2NTTA 1V43A 2Q2HA 4XQJA 3M4YA 4K2KA 1NR2A 2EJFC 4BBRH 2A68C 2EYLA 2UUCL 2BE5C 2L11A 1IBML 4P75A 2E8GA 1F2ZA 3RN2A 5IT9E 3QR8A 1M8AA 1SMYD 1HA5A 2PI2A 4WORA 1R4PB 4K6DA 4BA1I 4RGNA 1D5XC 4JV5Q 3WWVA 3H0GG 1WVLA 4BBSB 4L63B 1F2MA 3ULJA 5BN5A 2F0IA 2PW7A 1WTVA 4FF3A 1CHPD 2WB1G 3CCEA 4FNFA 3I4NH 5JVH3 1CFMA 3PIO3 3VDYA 5IYDG 3FPPA 1S5ED 1GUNA 1I4PA 5KNDA 2C9OA 2JA6H 4V190 4DKAC 3I72A 1L0XB 4OWXB 2CH4A 3L2PA 4X65Q 1K73C 2ENBA 2KOLA 4FF2A 1STBA 2F0NA 4HJ8A 1XNQL 1D5ZC 1EU4A 1HA6A 3MFGA 1EWIA 1PTOC 1HFNA 1KNAA 5C3EG 4KY7A 5FLMG 5M3FG 1WCMB 3VR3A 4AYBG 3HOZH 3IKJA 5IGGA 2RSOA 4A93G 1QG7A 1Y1WH 5F2DA 1EY7A 1JC7A 2K5QA 1STAA 3FPUB 4DR6Q 4JG2A 4IFDJ 1SNOA 3I3CA 3FEWX 4RH6A 3E6ZX 4H02A 5C0XG 4OWTB 2A6HC 1VQOA 1AZPA 1P8LA 3MTSA 1ET9A 3UE0A 1EY8A 1X3QA 2E2HH 3K6OA 1PH6A 3HOUB 1D2BA 2B3GA 4K0KL 1ENCA 3I4NG 1JJGA 1P16A 5JVG3 1EQRA 2PQAB 4QIWE 1WTQA 4A4IA 1XTDA 3MFYA 2F3WA 1Q81C 4KD3A 1BXTA 2NVQB 1Y8NB 5EKKA 4YY3L 3HFZB 2OQ0A 1OXVA 1LT4D 3OTOL 2B63B 2JA8H 1L1OC 2X6LA 4QQBX 4X6AH 1EIFA 1HNWL 2Z0SA 2BDNA 3S17H 4OO1G 2MO1A 4DNRB 1N34Q 2X6GA 3TDQA 2C35B 2NVXH 3HOZG 1LACA 1SE2A 1UE1A 4UY8C 5I9OA 2UXDL 1L0YB 1Y1WG 4DPGA 4DXFA 5C44G 2NZHA 2F4VL 4F87A 4A76A 3AQQA 1DONA 5IIFA 1Z9FA 3M4PA 3K5LA 1DD2A 3I4LA 1LYLA 2JA5B 3HOXH 3K7AB 4J8QA 2ID0A 5GROA 2Z8LA 3GTKH 1SXTA 2Z9HA 4ILWA 5HY6A 3KUPA 3GTQB 1C0AA 2AKWB 3TEHB 4MTNA 5H1SE 3OHXC 4LFCL 2LKVA 4RKLA 4JI5Q 1S5FD 4G7ZC 2F0DA 1A8VA 3ONAB 1PRTD 2E2JB 5C4XG 1MJCA 2IJ0A 2B2VC 1F9PA 5C0XJ 2L4NA 5KGUA 2B2YC 3GTMH 1CKNB 1VQKA 2RDFA 1QZHA 2E75C 5FJ8G 1VQFA 5D3IB 4GNXC 3OWFA 1OO9B 4DR7Q 4UPAA 4A3EB 4B3RQ 1YNJD 1BOSA 2WAQE 3NEMA 3FKIB 1WTOA 4KKSA 1KXLA 4DR4L 1QCBD 4JBJA 3KJOA 3BDCA 1Z47A 2IL8A 4CDEC 1KRTA 4IUQA 1LABA 2UUBL 3WDNA 2NN6H 5C4JH 2Y0SB 2I0QA 3U50C 4GN5A 1UUPA 3CQZH 3OOCA 4DAPA 1MD2D 4UP8A 1GUOA 3NUCA 5EQ0A 3CCQA 2KVMA 3TMEA 1VQ8A 2HT1A 4HSPA 3PV0A 1PH1A 2I5HA 2QDBA 4HSVA 4J15A 2O2LD 5IT9c 5EAYA 3C46A 5LL6S 3IFDA 3FRPB 1H9SB 5CV7A 2L0CA 4MN3A 4GOPC 1FD7D 3S9WA 5M5WB 2PI2E 3ERSX 5EKLA 4FXKC 1SN8A 3SDZA 4DF7A 3QB3A 1EIGA 1G91A 3J81j 3T1YQ 1E3PA 1MJEA 5IY0A 4MHEA 1YIJA 5CV6A 4EQNA 3HOUG 4L6TB 1EFID 1PRTF 2FMMA 5IOCA 1Q12A 4IPGA 4DGZA 1V1PA 1YJWA 4DAMA 5CYUA 1MGSA 4DR2L 2K5NA 5M3MB 2ZXRA 2QEJC 3RN5A 1TWGB 2L55A 2RHQB 2B63G 3NHHA 4B3SQ 1KDCA 1M90C 2GA4B 1PYBA 2NTSA 1K28A 4P74A 4OGQC 3STBC 3E9HA 1HUNA 4KI0A 4EQ5A 2ZJRA 3AEVA 2KCNA 1VQCA 2EYFA 2EOTA 1MIUA 4LF4L 1YHBA 3N6RA 2NN6G 2PNRC 1CSPA 3NBIA 4POGA 1YVCA 1I5FA 3HKSA 1EZ6A 3VA7A 1U0LA 2MGSA 3S14B 3U9OA 2AUKA 1I4RA 2OF1A 1EUJA 2UXCL 3HZXA 2WACA 4LFBQ 5NUCA 2B2WC 1BBWA 2K1BA 4RHRA 1HR0L 1LTLA 1LTRD 2IY5B 4U673 1OTCA 3RLNA 5IT9L 2Q8IB 3OMGA 1O78A 2NN6I 4RA8A 4R4CA 3K80C 2F0LA 5FOBB 2ZXPA 4UP7A 1K3RA 1EYAA 1YHAA 2DY8A 3W1BA 3S15B 4LNQA 4DUYQ 3U58A 2ZM6L 4DR7L 3PCOB 2B29A 3T4AC 2WIIB 1U9RA 3GTOB 2KJXA 5I6WA 4JK1C 4DXGA 1IBLL 3GTJH 1XJVA 5DM73 1X6OA 3CAMA 3S1MB 1E1TA 4BS9A 1Z7TA 1SBBB 1VQ5A 2JXMB 2F0SA 1JICA 3PUXA 1WTRA 2RF4A 1E24A 5E4XA 5ISRA 1STYA 1Y14B 2KHSA 3GDEA 2R93B 2R92G 2DNCA 1DM0B 5ELDA 4CJ1B 2CFMA 2RKSA 4DV5L 2EQSA 4A3EG 1PRTB 1PH9A 3HOWG 2R61A 3FKIG 3I4MH 4DNTB 1TWCB 2VB2X 4A3GG 2KHJA 2CHBD 5DEHA 1B9MA 4HIKA 2VY3A 1K83H 1STGA 3RZOB 1S5DD 1B8AA 1JT8A 3OYYA 1E0BA 1UWVA 4A3LH 2K50A 1RJTA 5D14A 3F2CA 3KLRA 4C3JH 5IP9G 1N9WA 1VQIA 1JE5A 4EGVA 3L7ZC 4LF9Q 4IPHA 2K4KA 5IYBH 4IPDA 3HOVH 4A3DG 3QWNA 1II3A 1PH5A 1Q3LA 1I94Q 1Q1BA 3S2DH 4JI3L 1VF5C 3R93A 2VUMB 2KA7A 1B50A 4LWCA 4IURA 5GAEC 1KAAA 4RGMA 2F0MA 1LM0A 3K59A 1L1OA 4X62L 3VR6A 5KRUA 1AH9A 3EJIA 2N78A 1NMGA 4PMCA 3HOYH 1SAPA 4AQYQ 1EEFD 3MXUA 3QG1A 4YWMA 4DUZQ 4GZYC 3MVVA 2H1EA 2AHOB 1GO3E 4UDUC 3M4OB 3TZDA 1QILA 2F0HA 4A3CH 4JI4L 1BCPD 4ULLA 3GTLH 1FNWA 2F1MA 1HJPA 1PDQA 2R7ZG 2PZTA 3NWSA 5CBAE 3BDLA 2ZJQA 4ZCKA 1GD7A 4N8X1 3VYUA 1BO0A 3PMFA 5DLQE 4B9WA 2A73B 4A75A 1NCVA 4CHTB 3BJUA 1ZEQX 4EQOA 3SE0A 3D4RA 1I4XA 4LF6L 4C3JG 3MXGA 4QL5A 3VR2A 2CW0D 3CXCA 1ET6A 3CCMA 2JEAI 4OX9L 3ICEA 1WYDA 1QB5D 1I6HB 5IYBG 3TREA 3CCLA 1TWHB 2OCEA 4PV1C 2Q8RE 1A15A 4A3JH 1QJOA 2JSOA 2AWOA 1GKHA 1ESRA 4AH6A 1V1OA 1B3AA 2B2VA 4ID6A 2FJ2A 1I6VC 1Y1VG 4JI0L 4HEDA 3E0EA 1CQFA 1HTLD 3I55A 2B2YA 3AFPA 3J7YW 4MIUA 1I50B 4XIGS 2AQ2B 4GNXA 3PUZA 3GD7A 3CC2A 4BXXH 1A3TA 2CWAA 5EBDA 2UUCQ 2EY6A 4A3IB 1I3QH 1NJIC 1IBMQ 3KBGA 4IOAA 3S1RB 3ZYYX 5JPMC 4LF8L 1SRUA 2KCTA 1SE3A 1UE6A 1VS0A 5KNCA 3HKZB 3NPPA 5I2XA 1VQHA 4Z9CB 3I7FA 4CGYB 4AYBE 5HGTA 2GVBA 4PZ7A 3K0XA 5IYCG 2EYHA 2ZT9C 1BCPF 4UHVA 3PUYA 5AJ3L 2JA7H 1LV9A 2HCIA 3IRBA 1SEBD 3CP0A 4GN3B 4DV1L 4A3KH 4L5TA 5C4ZA 4IFDH 3NXWA 1IBKQ 3RLOA 4NMZA 4KY6A 3R2IA 5E3FA 4DAYA 1H9KA 4NW2A 1EOVA 3N52A 3LGJA 4GOPA 3LWEA 3A55A 4G7OC 3PO3B 2B39A 1XNQQ 1HTPA 3CKIB 2QF7A 4DV0L 1ZXTA 3QO2A 1C4QA 3SVMA 3G71A 1UE5A 5EKIA 1W2BA 2XTIA 3KF6A 1PYWD 1CK1A 1Q1EA 2I07B 2EIFA 3A0JA 4DUZL 2MPMA 2JN4A 3VYRA 2EE1A 2L1BA 4M1UB 1IYJB 2HUGA 3NENA 4BXXG 3KDFA 2F52A 4BBRB 2ZJPA 4JI7L 5J1ZA 4R4TA 2RCFA 3H0GH 4B3MQ 5IWAQ 1QWYA 5M5YH 3OIPA 3KOJA 4BY7B 1PREA 1E2VA 4K5WA 4WJ3M 3C1EA 3AU7A 3KFUA 1HHVA 1HZAA 5IYDH 1PXUA 2L15A 4F8MA 3NE5B 2ZTEA 4DK3C 1MSHA 2EYJA 2R3ZA 3S1NB 2A6EC 3DUZA 2Z4IA 3MC0B 2JA6B 1VCIA 2YV5A 4FXGC 1UEAB 4YY3Q 4DV7Q 3CCSA 4LMQD 3OTOQ 3K5OA 3NSWA 1VMCA 1L2FA 2KUMA 2SEBD 1CKOA 4Y7NH 1KAWA 2KHIA 3U9SA 2MUYA 4GS3A 1HNWQ 1BCPB 2CQOA 2KBNA 1CUKA 4A93H 3EA6A 3VYSA 1RTOA 4B08A 3RNUA 2IX1A 4IFDI 1EYGA 1ILPA 1TR5A 2XSCA 1HR0W 1Q8KA 4ZK9B 5FO9B 4NXML 2UXDQ 4ZKBB 2DUDA 3NQTA 3H91A 5C0XH 4OELB 3FMCA 2V4DA 2PW5A 4IZ8A 3SHLA 1TWAH 1STEA 4ZAIA 2F4VQ 5JJKA 2F4IA 4XDXA 4ZLTF 3DHQA 3PIPA 1FL0A 1LLRD 3I56A 4C3HG 4PZ8A 1BBXC 4RCNA 4IUUA 1K8GA 3P7JA 1NUCA 4WFN3 1IBKL 1QOHA 4LFCQ 1X3GA 1C48A 3V96A 1HRJA 1HNZL 5ELFA 4WRDA 1T5EA 3K81C 3PO2H 4A3FG 1Q90A 3RD4A 3CHBD 2NVTH 2IW3A 4OO1H 1YJNA 4DV3Q 2UUAL 5CV5A 2JA8B 4N9PA 4Y52H 5AFWA 4FVMA 4Q0FA 5J22A 2F0PA 1VDZA 3R2TA 2WINB 5LHY1 2A74C 2F0UA 1EWHA 1EWCA 1PTOH 4HAEA 4DV6L 4HIOA 4JI6L 1ASZA 1A63A 4ZRZA 5GQOA 3T13A 2PMZE 1O80A 2NVXB 4EQPA 5C44H 1KIXA 5FO8B 4DR4Q 5IODA 1VQ9A 4X3KA 1X3FA 3V05A 4CKBA 4POFA 5IWAL 1R9TH 1M1KC 4B3ML 5LL6X 3KK7A 2QDLA 4LF7L 2UUBQ 4IUPA 1BUVT 4QF4A 3DLLA 1K9MC 2EZVA 1PH2A 2QW7A 3EBEA 3ND9A 4KHVA 2WV6D 4HN7A 2BA0A 2F3VA 5IP7G 3S1QB 3HOXB 1F2LA 3NTIA 1U4MA 4L8JA 5EPLA 4OIKA 2BCOA 1HZ9A 4RGOS 1MI2A 1OXUA 5C4XH 5C0XI 4KJNA 3OPOA 4DV7L 1SFOB 1IYUA 3TS2A 3MXPA 3PO2G 1S3OA 1TWFB 2EJGC 1ILQA 2IWHA 5K5PA 3EFXD 3J7AV 3A7LA 2L9HA 2HIVA 4TQUS 1X9NA 4ZKCB 1STNA 1CI3M 1XX8A 5FJ8H 1EYDA 2GVAA 1SNCA 2B2UC 1YNNC 3CCRA 2XVSA 3D3RA 2NZOA 3TSSA 5DAUA 4HIMA 4XT3B 3KF8B 5KEEA 1YHQA 1BBUA 4DR2Q 4HMIA 1TQOA 2HCCA 5KYIA 2MNAA 1TS4A 4KKTA 2LS01 1H9MA 2KCMA 5EPJA 5A35A 3A8KE 2HD3A 4QIWB 2E5LL 1HPCA 1SYCA 2N55A 2G9HD 4C3IB 1FJGL 4OO1I 4G4KA 2OTLA 1IZ6A 1SMXA 1S5BD 3ERQA 4DV2L 4LF4Q 1RHPA 2G5DA 4QY7A 3P75A 1NMFA 3G6JB 3C0NA 4CDFC 1D7QA 4K5XA 3S2HB 5G3LF 2UXCQ 4KN4C 3CU7A 4PMBA 2R7DA 4JI8Q 4TSSA 1EZ8A 3OW2A 4BBSG 4KKUA 1HR0Q 1JQYD 1WTWA 2Z6KC 1TT2A 2FFKB 3HOUH 3RZDH 4DV3L 3DWQA 1YNXA 4KK7A 2AQ1B 4RMFA 2NVQH 2J7ZA 5C3XA 2ZM6Q 1Y8OB 5I4DA 2IPKD 4A3MB 2B63H 1FR3A 1PZKD 1IBLQ 4H7BA 4R1JA 3AYHB 1SYDA 1HNXL 1CZGA 3TS0A 4HMJA 2N3SA 3K57A 4HIDA 3KDFB 1F9SA 3A74A 1WCMG 1EIYB 4H44C 1GM5A 1PFNA 3PIOA 3O13A 3B6YA 2F0WA 1KLUD 2VL6A 2ZXOA 3Q22A 4DV5Q 3NK9A 4C1NI 3BDOA 2K32A 1Y69U 4ABNA 1TS3A 2JA9A 1N36L 4NPSA 1XMOL 1TY0A 2BH8A 1NSNS 3MAQA 2IHFA 2NVYH 5GAHC 4P71A 5C3WA 2K28A 2JA5H 1ASYA 3K7AH 5CORA 4KHZA 2WAQB 3GTQH 1DYQA 3I91A 3VYTA 4JBMA 4HCEA 1QVFA 1WJJA 3T53B 1EY0A 3K7UC 4C56C 2E2JH 4JI3Q 4F88A 2CH4W 1KTKA 2HHHL 1SMYC 2O4XA 3OWEB 1QNUA 4I65A 3W2DA 2R7FA 2Q8TA 4X62Q 3HG9A 4K8IA 1SROA 4O2DA 3MXNA 1AE2A 1E22A 1PFBA 1VQ7A 5E4WC 3SEBA 3EIVA 2DJFC 1JOKA 2R92H 1B7YB 2D5DA 4H13C 4A3EH 3HOWH 2X69A 3FKIH 4IJHA 5FK9C 1ICFB 4IN3A 4A3GH 1G51A 2OXPA 1YEZA 3JAMi 3UDIA 1KQSA 4UAIA 4JI4Q 3PSIA 1KABA 3I4MB 1KC8C 1NR4A 3T1HL 5E1FA 3PF4A 4JI8L 1VQEA 1K83B 3A56A 4R4IA 5IP9H 1T9HA 1IHZA 5ELNA 1IW7D 1U4LA 1F77A 3Q6SA 1JOQA 4DR1L 1HCZA 3S16H 3NWTA 4X66Q 2JA5G 4FYDA 3KBXA 1BDOA 4A3DH 1NAPA 3VR5A 4LF6Q 3HEJA 1RTNA 3TN2A 1C7YA 3R3OA 3PF5A 4JI2L 2GN5A 4OX9Q 3F2DA 3A5ZB 1RDPD 3J7AF 5M5WH 5LMUL 3BVMA 1CT1D 1SNMA 1CHQD 3BYTB 3HOVB 1MKHA 1J9OA 3BYYB 1U4RA 2EY2A 2JQOA 3S2DB 1GUWA 2FINB 4LUZA 3SK4A 5BN4A 4NB3A 1JJ2A 2F0EA 3FDTA 4JI0Q 1JOOA 1XMQL 3CCUA 1JB3A 4DU9A 1Q82C 3HOYB 1QUQA 2JE6I 5M3MH 5IGDA 4CDDC 3K5MA 1PZID 4A3MG 2EPBA 4C2MH 1XXGA 3JC66 2R7ZH 1U5KA 5KIXA 4LF8Q 5JEAG 2HQEA 1A2UA 3SR1A 3GTLB 3SK5A 5EBCA 1PMRA 4K14A 1VQ6A 4A3BB 2Y0SG 4R8IA 1N8RC 3D8GA 2RDHA 5AJ3Q 3F2UA 2DNEA 3HS0C 4OIJA 1N33L 4DV1Q 1G8ZD 3TP6A 3S14H 1WOCA 2BDOA 3I90A 3UDFA 3J81i 4CBVA 2A68D 2BE5D 1D6EC 1HXYD 2YTXA 4BWGB 4YIJA 1G2TA 2VQFL 1WD1A 2E2DC 2EYOA 4OXPA 1VF7A 2KEDA 4HR7B 1TKWB 1ESFA 4A3JB 1W6KA 2UU9L 1Y1VH 3DWPA 4DV0Q 4JI1L 1L0WA 3S15H 2LXKA 1HFGA 3HGBA 3J80i 2K75A 1SJED 2B2UA 4TKOB 5JJZA 1VMPA 3FVQA 1EY9A 4EX5A 2BA1A 2EJMA 3G48A 1Q46A 5M3MG 4DA2A 1TIID 2I5LX 4NXNL 4KV6A 4ZYSA 2B2TC 4O0AA 4JI7Q 2DN8A 1I3QB 1FGUA 2VXWA 2BH2A 2KECA 1OXTA 5JAVA 5IYCH 2SNMA 1H9JA 1PRTC 3OSOA 1PTOD 5JPNC 1Z52A 2KQ3A 1H95A 4FXDA 2QA4A 3BG3A 3KLWA 1BR9A 1T5XD 2QILA 4X66L 1TWCH 4LUOA 2JA7B 1X65A 2FHTA 5D3DA 3RZOH 2ES2A 4A3KB 2NZ1D 1CTMA 4BY1B 1EEID 2IHEA 1YNJC 2WB1E 4KMUC 4BA2I 2AMCB 3TP5A 2A6HD 4ZQ3A 1AW7A 3L9AX 5FKAC 1JCKB 5JEAJ 1G6PA 2Z6KA 1EYCA 1K0SA 2PQAA 2Q2UA 4QCLA 4G7HC 3PIP3 1B2TA 3W5OA 1NE3A 3MZ5A 2IX0A 2FMCA 2VUMH 4N9TA 4XYOA 2C5CA 1QE6A 3G4SA 2Z1CA 3W1GA 4KTAA 3M3YB 2E2IB 3H09A 2F0FA 3ND8A 4RWSC 3H3VC 4NXMQ 1MBYA 5M5XB 4GKKQ 1X32A 4NDXA 1HQMC 3H3VH 3I8ZA 3UE1A 3CPFA 4JVZA 5ELBA 2BOSA 3VA5A 2IT1A 5EJWA 1XNRL 5M5YB 4IJLA 4XXEA 4L5RC 4DV4L 3U4ZA 1TXYA 1DOLA 1HH2P 2R93G 2CQAA 4HCSA 4J1MA 2A19A 4K6LA 1JWSD 1PTOF 1DZ1A 5IGFA 3EROA 3P1HA 1HNZQ 1LUZA 2E76C 3A8IE 1BF4A 3GP7A 1PVOA 1V1PB 2EXDA 2UUAQ 4RGTA 1N32L 4LFAL 1A3VA 2K5HA 5C3EB 4Y7NB 4KHPL 2KCCA 1I6HH 5IGBA 2PYKA 5M3FB 4KD4A 4AYBB 1QZGA 2FXQA 3K8AA 2MFIA 2EYPA 4P72A 4DV6Q 1XPUA 4RFBA 1GHJA 4JI6Q 3MXNB 5JJIA 3GTPH 1RCVD 5FLXE 1DGSA 2D0OA 2VUMG 1VQMA 3CD6A 1UE7A 3Q24A 1IXRA 2A69D 1FNVA 3CCJA 1JR0D 2XRQD 4LUVA 4QB4A 2F0JA 1JORA 4X64L 2YU9H 3S24A 1V9PA 4LF7Q 4DK0A 3GQBA 2JK8A 3J7ZC 3L0OA 1F9RA 4C3HH 1OXXK 4B3TQ 2XRSD 1ML0D 2F03A 2CWPA 4R9WA 1O7YA 1VQGA 3I4NB 2ATWA 4RG1A 4FP5D 1X3EA 2DGYA 4HJ7A 2MO0A 4A3FH 2TMPA 3R8BA 1H9RA 4MZ9A 2HQLA 3L3OC 2ASBA 3GTGH 1B9NA 2QEXA 3H3VI 1F9QA 1LO5D 2B2WA 1QNKA 3I2ZA 3Q23A 4IUVA 1AZQA 1D1IA 1H9SA 3CRLC 5CR3A 2OWOA 3M7GA 2RA4A 2RSNA 5JJLA 1VQPA 4IOCA 1DJRD 3D4WA 2K05A 5C5MA 1HZCA 3HOZB 4YHHL 4OHJA 1MHWC 1LTGD 5ELEA 3BZCA 3Q0AA 1JJCB 1Y1WB 4CJ2C 4GKKL 3D31A 4LW1A 4JBKA 3MA2B 2N8NA 4K5VA 1G291 2E5LQ 2EVBA 1FJGQ 1DOKA 1R9TB 3DEOA 5LMNL 5IP7H 4YCUA 4DV2Q 1XWEA 1PH4A 2Z6BA 2J0TD 1QVGA 1JWUD 1GUGA 4A3IG 3H6MA 4OWWB 4PMWA 2E2HB 3DMUA 5C5LA 5BR8L 4BY7H 2YTYA 3HKZG 2UXBL 4C1NK 4FDBA 1CQVA 1ZYRD 2N49A 2ICEC 1RKNA 4KLKA 3STBD 1V1QA 4JOIC 3P20A 3DWAA 1XPOA 5C4XB 1CZWA 1D1KA 4JYAL 4GKJL 1Q8IA 1SR3A 3S1NH 1KNEA 4ZUIA 1EY6A 3J7A5 2XWJB 3KJPA 4TRDA 1L1OB 3S17B 3QOJA 2CCZA 2P5ZX 1DCZA 1CM9A 3IL8A 5C6AA 2RHSB 1BCPC 3PO3G 4KJOA 2O5JC 1HNXQ 1K3BC 2ALYB 3MWYW 3ER0A 2K7VA 5IGCA 1TS5A 3LNNA 3IAYA 1PA6A 5E7NA 4DR3L 2TSSA 3MEHA 4B3TL 4CKCA 1RD9D 3WOFA 2IX3A 2VNUD 4HJAA 5G3LD 1KLGD 2CW0C 3D6WA 1X56A 1X54A 3OW7A 3NTHA 4BBRG 4X3TA 1A0IA 1SDFA 2B2TA 2JP1A 2NWGA 4F7XA 3GTKB 1N36Q 2YTVA 1XMOQ 4BBSH 3M85A 3NP8A 1G6ZA 1LT6D 4BY7G 2NBFA 3E3XA
chains in the Genus database with same CATH topology
3DM1A 5COYA 2PMZB 2RVLA 2JEBI 3RZDB 2K01A 5C4HA 1B44D 1G2SA 4DK1A 3A8JE 2M00A 1EQVA 2OEOA 1O7LA 3GTMB 1K8MA 2SDFA 4K2LA 1I4GA 2QCPX 3G7LA 2PO4A 2B8FA 2MHVA 2XN9C 1TY2A 1E2ZA 1XTCD 4PNYA 5C4JB 1AFPA 3CQZB 1IKLA 3X3NA 5M9OA 4RKBA 2EXZA 4ME5A 3NBHA 2NVYB 1V8QA 1KDAA 2F0TA 1TS2A 4RCOA 3WOEA 1LT5D 5IGEA 1RF2D 3JAME 1GJXA 4V0BA 5HURA 3BVGA 2PQEA 2D2CC 2MJ8A 1HUMA 1O7ZA 5J39A 2YYZA 3C0MA 2A69C 3A7AB 5FO7B 1D5MC 2RQXA 4IALA 2QKIC 1FYCA 3DXJC 2R92B 4J6HA 2M2LA 2E74C 3RMHA 3PUWA 3K58A 3HOWB 4XQQA 4A3GB 5KYLA 2NYZD 3C2PA 1AN8A 2G9DA 5A2QE 2XIWA 4K8JA 3GV6A 1A6XA 5FLXL 3BS1A 3KLSA 4I7ZC 4B9XA 4IQZA 2D9UA 1SYBA 3BZDB 5I6YA 1KDBA 3S16B 1LTBD 2PZUA 4HTHA 4FF4A 4A3DB 3K0YA 1I4HA 1GUTA 4CKEA 1BNZA 1WTPA 1EQTA 3LX0A 1Y8PB 1OXSC 2XWBB 1WD0A 1U4PA 3NTKA 1SNDA 4FF1A 4H0LC 5K36H 2L5TA 1HQRD 3J81E 3GTJB 4R8NA 4LAAA 5CV9A 4IUNA 2R6GA 1X3PA 2SOBA 2J4XA 5JEAH 3TBIB 1EIHA 2HDLA 1K8OA 2F0QA 3SXHA 1ZYRC 4C2MB 1FNUA 2R7ZB 1LTID 3C1FA 3J80E 2WKCA 3MHBA 4C3IG 3DEPA 1F2YA 1EY4A 2NB0A 3W3AA 2AQ3B 4NKLA 3T56B 4ODGA 1BQQT 3C0OA 3RUZA 3K5NA 4G57A 4O42A 4E6IA 4DN4M 4C3JB 4M8AA 5EGTA 3GV3A 1IKMA 4U68A 4DAVA 1AEXA 4X3UA 5T1IA 3M7NA 2RBMA 4PQXA 2D62A 1SJHD 1IYVA 3TP8A 5CV4A 5K36G 1Y1VB 2I46A 2PZWA 3PUVA 2KEEA 2A6ED 1B53A 2EY5A 5D65A 4Q5VA 1PZJD 1TVXA 2F0VA 3UI2A 1JE4A 1SSOA 4QMGA 1E2WA 1M4VA 1JWMD 3AMUA 3LWUA 1W6JA 3TZUA 2RDGA 4XQNA 1ONLA 1CA5A 3EVQA 2EYMA 4KN7C 1PFMA 3QJYA 5CGKA 3H94A 1J8IA 2WKDA 1ZKOA 1LT3D 1WTXA 1RODA 1GHKA 4KY5A 1SE4A 3GO5A 5T1GA 2HDMA 5I2YA 3QIAA 4JBWA 2O5IC 3ITPA 4XTCS 2LY7A 4LJZC 1Z6HA 5CV8A 1ENAA 2AUJD 3OMCA 5CMDA 1STHA 3NQIA 2F0OA 4XYQA 3SK6A 2LMCB 3TP7A 5DNFA 3I70A 2XNAC 3KLSX 1B1ZA 2PCFB 4P2CB 2PPBC 2WP8J 1DXMA 5KNBA 1GXDC 2AWNA 1SNPA 2K5WA 2ICIA 2K03A 1C8CA 3HP3A 1LTAD 4X3SA 3A54A 4ZUJA 2CVRA 3C3LA 1EL0A 4WJWA 3JAML 1EOTA 1ICWA 2K6AA 3GTPB 1S5CD 2NUCA 2A5HA 2M9VA 3T51B 4OL7A 1GOZA 5CBEE 1SNQA 4LK1C 2VB3X 4O1NA 3KF8A 1SYFA 3H0GB 1XYIA 5CC4A 2YU9B 5DM63 3BVZA 3D4DA 4RAUC 1YNND 2WB1B 2JYOA 2K5DA 1S4ZA 5I9PA 4C3HB 1LTTD 2B8GA 3RLFA 2DY7A 3EQLC 3OIQA 1PLFA 4CJ0B 1UNSA 3AB9A 4A3FB 3QOLA 4QUCA 5BN3A 3GTGB 1IL8A 3E5SA 4XT1B 5A2QL 2SNSA 1R4QB 1I4QA 2L12A 4IUTA 3SK8A 4NP5A 2K33A 5ELCA 2K04A 1LTSD 2Z4HA 3IFTA 4S3SA 4A93B 2LFNA 1MSGA 1TU2B 1B4OA 3X3MA 4RHSA 3V2TA 1TWAB 5JOBA 1IW7C 2F0KA 2EY1A 3J81L 3D6CA 3VR4A 1EY5A 1A2TA 1EU3A 3G4NA 3T16A 3URYA 1A3UA 2EDGA 3HRZC 2F0GA 1FGBD 3PO2B 3J80L 2NVTB 1DOMA 3I73A 4FO2A 5EPKA 4QUFA 4IFDG 2OT2A 1GUSA 1AP0A 2N88A 1PTOB 2H4OA 1UAPA 3E0JA 3G4OA 1SYEA 1SYGA 5TSSA 3CRKC 1CA6A 5C44B 1ENFA 4EVOA 4DFAA 2MP1A 2NTTA 1V43A 4XQJA 3M4YA 4K2KA 1NR2A 2EJFC 2A68C 2EYLA 2BE5C 2L11A 1F2ZA 5IT9E 1M8AA 1SMYD 1HA5A 4WORA 1R4PB 4K6DA 4BA1I 4RGNA 1D5XC 1WVLA 4BBSB 4L63B 1F2MA 5BN5A 2F0IA 2PW7A 1WTVA 4FF3A 1CHPD 4FNFA 5JVH3 1CFMA 3PIO3 3FPPA 1S5ED 1GUNA 1I4PA 5KNDA 2C9OA 4V190 3I72A 1L0XB 2ENBA 2KOLA 4FF2A 1STBA 2F0NA 1D5ZC 1EU4A 1HA6A 3MFGA 1PTOC 1HFNA 1KNAA 4KY7A 1WCMB 3VR3A 3IKJA 5IGGA 2RSOA 1QG7A 5F2DA 1EY7A 1JC7A 2K5QA 1STAA 3FPUB 4IFDJ 1SNOA 3I3CA 3FEWX 4RH6A 3E6ZX 5C0XG 2A6HC 1AZPA 3MTSA 1ET9A 1EY8A 1X3QA 3K6OA 3HOUB 1D2BA 1ENCA 5JVG3 1WTQA 3MFYA 2F3WA 4KD3A 1BXTA 2NVQB 1Y8NB 5EKKA 1OXVA 1LT4D 2B63B 2X6LA 2BDNA 4OO1G 4DNRB 2X6GA 3TDQA 1LACA 1SE2A 5I9OA 1L0YB 4DXFA 4F87A 1DONA 5IIFA 3K5LA 1DD2A 3I4LA 2JA5B 3K7AB 4J8QA 2ID0A 2Z8LA 1SXTA 4ILWA 3KUPA 3GTQB 3OHXC 2LKVA 4RKLA 1S5FD 4G7ZC 2F0DA 3ONAB 1PRTD 2E2JB 2IJ0A 2B2VC 1F9PA 5C0XJ 2L4NA 5KGUA 2B2YC 2RDFA 2E75C 5D3IB 3OWFA 1OO9B 4A3EB 1YNJD 1BOSA 3FKIB 1WTOA 4KKSA 1QCBD 3BDCA 1Z47A 2IL8A 4IUQA 1LABA 3WDNA 2NN6H 2Y0SB 1UUPA 3OOCA 4DAPA 1MD2D 1GUOA 3NUCA 5EQ0A 2KVMA 3TMEA 4HSPA 3PV0A 2QDBA 4HSVA 2O2LD 3C46A 5LL6S 3IFDA 3FRPB 1H9SB 5CV7A 2L0CA 4MN3A 1FD7D 3S9WA 5M5WB 5EKLA 4FXKC 3SDZA 4DF7A 3QB3A 1EIGA 1G91A 4MHEA 5CV6A 4EQNA 4L6TB 1EFID 1PRTF 2FMMA 5IOCA 1Q12A 4DGZA 1V1PA 5CYUA 1MGSA 5M3MB 2ZXRA 2QEJC 1TWGB 2L55A 3NHHA 1KDCA 2GA4B 2NTSA 4OGQC 1HUNA 4KI0A 2KCNA 2EYFA 2EOTA 3N6RA 2NN6G 2PNRC 3NBIA 1EZ6A 3VA7A 2MGSA 3S14B 3U9OA 2AUKA 1I4RA 2OF1A 3HZXA 2WACA 5NUCA 2B2WC 2K1BA 4RHRA 1LTRD 4U673 5IT9L 2Q8IB 3OMGA 1O78A 2NN6I 4RA8A 2F0LA 5FOBB 2ZXPA 1EYAA 2DY8A 3S15B 3T4AC 2WIIB 1U9RA 3GTOB 2KJXA 5I6WA 4JK1C 4DXGA 5DM73 3S1MB 4BS9A 1Z7TA 1SBBB 2JXMB 2F0SA 1JICA 3PUXA 1WTRA 5E4XA 5ISRA 1STYA 2KHSA 2R93B 2DNCA 1DM0B 5ELDA 4CJ1B 2RKSA 1PRTB 2R61A 4DNTB 1TWCB 2VB2X 2CHBD 5DEHA 1B9MA 1STGA 3RZOB 1S5DD 1E0BA 1RJTA 5D14A 3KLRA 4EGVA 3L7ZC 3QWNA 1II3A 1Q3LA 1Q1BA 1VF5C 3R93A 2VUMB 2KA7A 1B50A 4IURA 1KAAA 4RGMA 2F0MA 3K59A 3VR6A 5KRUA 3EJIA 4PMCA 1SAPA 1EEFD 3MXUA 3QG1A 4GZYC 3MVVA 2H1EA 4UDUC 3M4OB 3TZDA 1QILA 2F0HA 1BCPD 4ULLA 1FNWA 2F1MA 1PDQA 2PZTA 3NWSA 5CBAE 3BDLA 3VYUA 1BO0A 3PMFA 4B9WA 2A73B 1NCVA 4CHTB 1ZEQX 4EQOA 3SE0A 3D4RA 1I4XA 4C3JG 3MXGA 3VR2A 2CW0D 1ET6A 2JEAI 1QB5D 1I6HB 1TWHB 4PV1C 2Q8RE 1A15A 1QJOA 2JSOA 2AWOA 1ESRA 1V1OA 1B3AA 2B2VA 4ID6A 2FJ2A 1I6VC 4HEDA 1CQFA 1HTLD 2B2YA 3J7YW 4MIUA 1I50B 4XIGS 2AQ2B 3PUZA 3GD7A 1A3TA 5EBDA 2EY6A 4A3IB 3KBGA 3S1RB 3ZYYX 5JPMC 1SE3A 5KNCA 3HKZB 3NPPA 5I2XA 4Z9CB 4CGYB 5HGTA 2EYHA 2ZT9C 1BCPF 3PUYA 1LV9A 2HCIA 1SEBD 5C4ZA 4IFDH 3NXWA 4NMZA 4KY6A 3R2IA 5E3FA 4DAYA 1H9KA 4NW2A 3N52A 3LWEA 3A55A 4G7OC 3PO3B 2B39A 1HTPA 3CKIB 2QF7A 1ZXTA 3QO2A 1C4QA 3SVMA 5EKIA 1PYWD 1CK1A 1Q1EA 2I07B 2MPMA 3VYRA 2EE1A 2L1BA 4M1UB 2HUGA 4BBRB 5J1ZA 1QWYA 3OIPA 1PREA 4BY7B 1E2VA 4K5WA 3C1EA 3AU7A 1HHVA 1PXUA 4F8MA 3NE5B 1MSHA 2EYJA 2R3ZA 3S1NB 2A6EC 3DUZA 2Z4IA 3MC0B 2JA6B 1VCIA 4FXGC 1UEAB 4LMQD 3K5OA 3NSWA 1VMCA 2KUMA 2SEBD 3U9SA 2MUYA 1BCPB 3EA6A 3VYSA 1RTOA 4B08A 2IX1A 4IFDI 1ILPA 1TR5A 2XSCA 5FO9B 4ZK9B 4ZKBB 3NQTA 3H91A 5C0XH 3FMCA 2V4DA 2PW5A 4IZ8A 3SHLA 1STEA 4ZAIA 2F4IA 4XDXA 4ZLTF 3DHQA 1LLRD 4C3HG 1BBXC 4RCNA 4IUUA 3P7JA 1NUCA 4WFN3 1QOHA 1C48A 3V96A 1HRJA 5ELFA 4WRDA 1T5EA 1Q90A 3RD4A 3CHBD 2IW3A 4OO1H 5CV5A 2JA8B 4N9PA 5AFWA 4FVMA 4Q0FA 5J22A 2F0PA 1VDZA 3R2TA 2WINB 5LHY1 2A74C 2F0UA 1EWHA 1EWCA 1PTOH 4HAEA 4ZRZA 3T13A 1O80A 2NVXB 4EQPA 5FO8B 5IODA 4X3KA 3V05A 4CKBA 5LL6X 3KK7A 4IUPA 1BUVT 4QF4A 2EZVA 3ND9A 4KHVA 2WV6D 4HN7A 2BA0A 2F3VA 3S1QB 3HOXB 1F2LA 3NTIA 1U4MA 4L8JA 5EPLA 4OIKA 2BCOA 4RGOS 1MI2A 1OXUA 5C0XI 4KJNA 3OPOA 1SFOB 1IYUA 3MXPA 1TWFB 2EJGC 1ILQA 2IWHA 5K5PA 3EFXD 3J7AV 3A7LA 2L9HA 4TQUS 4ZKCB 1STNA 1CI3M 1XX8A 1EYDA 1SNCA 2B2UC 1YNNC 2XVSA 3D3RA 3TSSA 5DAUA 4XT3B 5KEEA 4HMIA 1TQOA 2HCCA 5KYIA 1TS4A 4KKTA 2LS01 1H9MA 5EPJA 5A35A 3A8KE 4QIWB 1HPCA 1SYCA 2N55A 2G9HD 4C3IB 4OO1I 4G4KA 1S5BD 3ERQA 1RHPA 3P75A 3G6JB 3C0NA 4K5XA 3S2HB 5G3LF 4KN4C 3CU7A 4PMBA 4TSSA 1EZ8A 4KKUA 1JQYD 1WTWA 1TT2A 2FFKB 3DWQA 4KK7A 2AQ1B 2J7ZA 5C3XA 1Y8OB 5I4DA 2IPKD 4A3MB 1FR3A 1PZKD 4H7BA 1SYDA 1CZGA 4HMJA 3K57A 1F9SA 4H44C 1PFNA 3O13A 2F0WA 1KLUD 2ZXOA 3Q22A 3NK9A 4C1NI 3BDOA 2K32A 1Y69U 4ABNA 1TS3A 1TY0A 3MAQA 1NSNS 5C3WA 2K28A 5CORA 4KHZA 2WAQB 1DYQA 3I91A 3VYTA 4HCEA 3T53B 1EY0A 4C56C 4F88A 1KTKA 1SMYC 2O4XA 3OWEB 1QNUA 4I65A 3W2DA 2Q8TA 3HG9A 4K8IA 3MXNA 1PFBA 5E4WC 3SEBA 1JOKA 2D5DA 4H13C 2X69A 5FK9C 4IN3A 2OXPA 4UAIA 1KABA 3I4MB 1NR4A 5E1FA 1K83B 3A56A 1IHZA 1IW7D 1U4LA 1F77A 3Q6SA 1JOQA 1HCZA 3NWTA 4FYDA 3KBXA 1BDOA 1NAPA 3VR5A 3HEJA 1RTNA 3TN2A 3R3OA 1RDPD 3J7AF 3BVMA 1CT1D 1SNMA 1CHQD 3BYTB 3HOVB 1J9OA 3BYYB 1U4RA 2EY2A 1GUWA 3S2DB 2FINB 3SK4A 5BN4A 2F0EA 3FDTA 1JOOA 1JB3A 4DU9A 3HOYB 2JE6I 5IGDA 3K5MA 1PZID 2EPBA 1XXGA 5KIXA 5JEAG 2HQEA 1A2UA 3SR1A 3GTLB 3SK5A 5EBCA 1PMRA 4K14A 4A3BB 4R8IA 3D8GA 2RDHA 3F2UA 2DNEA 3HS0C 4OIJA 1G8ZD 3TP6A 2BDOA 3I90A 4CBVA 2A68D 2BE5D 1D6EC 1HXYD 4BWGB 4YIJA 1G2TA 1WD1A 2E2DC 2EYOA 1VF7A 2KEDA 4HR7B 1TKWB 1ESFA 4A3JB 1W6KA 3DWPA 3HGBA 1HFGA 1SJED 2B2UA 4TKOB 5JJZA 1VMPA 3FVQA 1EY9A 2BA1A 2EJMA 4DA2A 1TIID 4KV6A 4ZYSA 2B2TC 2DN8A 1I3QB 2VXWA 2KECA 1OXTA 5JAVA 2SNMA 1H9JA 1PRTC 3OSOA 1PTOD 5JPNC 1Z52A 2KQ3A 4FXDA 3BG3A 1BR9A 1T5XD 2QILA 2JA7B 2FHTA 5D3DA 4A3KB 2NZ1D 1CTMA 4BY1B 1EEID 1YNJC 4KMUC 4BA2I 3TP5A 2A6HD 4ZQ3A 1AW7A 3L9AX 5FKAC 1JCKB 5JEAJ 1EYCA 4QCLA 4G7HC 3PIP3 1B2TA 3MZ5A 2IX0A 2FMCA 4N9TA 4XYOA 2C5CA 1QE6A 2Z1CA 4KTAA 3M3YB 2E2IB 3H09A 2F0FA 3ND8A 4RWSC 3H3VC 1MBYA 5M5XB 1X32A 4NDXA 1HQMC 3I8ZA 5ELBA 2BOSA 3VA5A 2IT1A 5EJWA 5M5YB 4XXEA 1DOLA 2CQAA 4HCSA 4J1MA 4K6LA 1JWSD 1PTOF 1DZ1A 5IGFA 3EROA 3P1HA 2E76C 3A8IE 1BF4A 3GP7A 1V1PB 4RGTA 1A3VA 4Y7NB 5C3EB 2KCCA 5IGBA 2PYKA 5M3FB 4KD4A 4AYBB 2EYPA 4RFBA 1GHJA 1RCVD 5FLXE 3Q24A 2A69D 1FNVA 1JR0D 2XRQD 4QB4A 2F0JA 1JORA 4DK0A 3GQBA 1F9RA 1OXXK 2XRSD 1ML0D 2F03A 4R9WA 1O7YA 3I4NB 4FP5D 2TMPA 3R8BA 1H9RA 3L3OC 1B9NA 1F9QA 1LO5D 2B2WA 1QNKA 3Q23A 4IUVA 1AZQA 1D1IA 1H9SA 3CRLC 5CR3A 3M7GA 2RA4A 2RSNA 1DJRD 3D4WA 2K05A 5C5MA 3HOZB 4OHJA 1LTGD 5ELEA 3Q0AA 1Y1WB 4CJ2C 3D31A 3MA2B 4K5VA 1G291 2EVBA 1DOKA 1R9TB 3DEOA 1XWEA 2J0TD 1JWUD 1GUGA 3H6MA 4PMWA 2E2HB 3DMUA 5C5LA 4C1NK 1CQVA 1ZYRD 2ICEC 1RKNA 3P20A 3DWAA 5C4XB 1CZWA 1D1KA 1Q8IA 1KNEA 4ZUIA 1EY6A 2XWJB 4TRDA 3S17B 3QOJA 1DCZA 1CM9A 3IL8A 5C6AA 1BCPC 4KJOA 2O5JC 3MWYW 2K7VA 5IGCA 1TS5A 3LNNA 3IAYA 2TSSA 3MEHA 4CKCA 1RD9D 3WOFA 2IX3A 2VNUD 5G3LD 1KLGD 2CW0C 3D6WA 3OW7A 3NTHA 4X3TA 1SDFA 2B2TA 2JP1A 2NWGA 3GTKB 4F7XA 3M85A 3NP8A 1G6ZA 1LT6D 2NBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EU3 A;  1LLR D;  1PTO C;  2RDH A;  1DJR D;  3G4N A;  1S5F D;  4C56 C;  3URY A;  1PRT D;  1AN8 A;  1G8Z D;  2G9H D;  1KTK A;  4OHJ A;  2IJ0 A;  1EEF D;  1LTG D;  1D6E C;  5ELE A;  5ELB A;  1I4R A;  1S5B D;  1HXY D;  3OWE B;  4BWG B;  3W2D A;  1B44 D;  4UDU C;  1QIL A;  5ELF A;  1PZJ D;  1FGB D;  4RHR A;  1LTR D;  3CHB D;  1BCP D;  3C0N A;  4K6L A;  1FNW A;  1JWS D;  1PTO F;  3BZD B;  5D3I B;  3SEB A;  1PYW D;  1CK1 A;  1LTB D;  4RH6 A;  1ESF A;  1I4G A;  3DWP A;  1I4H A;  1M4V A;  1JWM D;  4TSS A;  5FK9 C;  1S5C D;  1ET9 A;  3R2T A;  2XN9 C;  3GP7 A;  1JQY D;  1JWU D;  1SJE D;  1GOZ A;  1PTO H;  1EWC A;  2RDG A;  1PTO B;  4O1N A;  1V1P B;  1I4X A;  1TY2 A;  1PRE A;  3G4O A;  1XTC D;  3BVZ A;  3DWQ A;  4DXG A;  5TSS A;  1CQV A;  1ET6 A;  1HQR D;  4RGT A;  1UUP A;  1ENF A;  1MD2 D;  2AQ1 B;  4ZYS A;  1LTT D;  1SBB B;  1BXT A;  1F77 A;  3DWA A;  3V05 A;  2NTT A;  1LT3 D;  5I4D A;  4RFB A;  2IPK D;  1LT4 D;  2O2L D;  1RCV D;  1PZK D;  1SE4 A;  1UNS A;  1PRT C;  1Z52 A;  1PTO D;  2J4X A;  1V1O A;  1FNV A;  1RDP D;  1FD7 D;  1JR0 D;  2WV6 D;  2XRQ D;  5ELD A;  3BVM A;  1CT1 D;  3MC0 B;  1CHQ D;  3BYT B;  1PRT B;  1TS2 A;  1T5X D;  2QIL A;  4RCO A;  1FNU A;  1LT5 D;  2R61 A;  3BYY B;  1RF2 D;  1LTI D;  1HTL D;  1HA5 A;  2CHB D;  1I4Q A;  5D3D A;  1BCP C;  1D5X C;  2AQ2 B;  4RGN A;  3O13 A;  2SEB D;  3BVG A;  1KLU D;  4RGO S;  1SE2 A;  5ELC A;  1S5D D;  2XRS D;  4L63 B;  4L6T B;  1LTS D;  1EEI D;  1EFI D;  1PRT F;  2AQ3 B;  1BCP B;  1L0Y B;  1CHP D;  3C0O A;  4DXF A;  1V1P A;  3EA6 A;  1SE3 A;  1AW7 A;  3C0M A;  1TS5 A;  1TS3 A;  2XNA C;  3KLS X;  5FKA C;  1JCK B;  4Z9C B;  1B1Z A;  1S5E D;  1I4P A;  3EFX D;  2TSS A;  1TY0 A;  1RD9 D;  2QEJ C;  3R8B A;  1PZI D;  1BCP F;  1XXG A;  1KLG D;  1D5M C;  1L0X B;  2NTS A;  1LO5 D;  4RHS A;  1SEB D;  2Z8L A;  3TSS A;  1SXT A;  1SJH D;  1STE A;  1DYQ A;  2ICI A;  1D5Z C;  4RGM A;  1EU4 A;  1LT6 D;  3MFG A;  1LTA D;  1TS4 A;  3R2I A; 
#chains in the Genus database with same CATH topology
 3DM1 A;  5COY A;  1HZB A;  4CDC C;  2PMZ B;  3D0F A;  4ALP A;  2RVL A;  2JEB I;  1NBW A;  3RZD B;  2K01 A;  4PG3 A;  5C4H A;  1B44 D;  1PH7 A;  1G2S A;  4DK1 A;  3A8J E;  2M00 A;  2I5M X;  1EQV A;  2OEO A;  1O7L A;  5IE8 A;  2Q2I A;  3CC4 A;  1PHJ A;  1K8M A;  2JA6 G;  3GTM B;  2SDF A;  4K2L A;  1YI2 A;  3F2B A;  1VQL A;  1I4G A;  2HHH Q;  4GNX B;  2QCP X;  3G7L A;  2PO4 A;  2VQE Q;  1SLJ A;  2B8F A;  2MHV A;  2XN9 C;  1WCM H;  4GLV B;  1TY2 A;  1E2Z A;  3NEL A;  1YZ6 A;  1XTC D;  4PNY A;  5C4J B;  5FLX c;  1AFP A;  3CQZ B;  1IKL A;  3X3N A;  1WTH A;  3SGI A;  1QVC A;  5M9O A;  4RKB A;  3T1H Q;  4IO9 A;  4JV5 L;  2CKZ B;  2EXZ A;  4ME5 A;  3NBH A;  1A62 A;  2NVY B;  1V8Q A;  1KDA A;  3S1Q H;  4DAY B;  2F0T A;  1TS2 A;  4RCO A;  3WOE A;  1LT5 D;  5IGE A;  4DR1 Q;  1RF2 D;  4GOP B;  3JAM E;  1GJX A;  4V0B A;  5HUR A;  3BVG A;  2PQE A;  4JI2 Q;  2D2C C;  2MJ8 A;  3A5U A;  5LMU Q;  1HUM A;  1O7Z A;  5J39 A;  1SFO H;  2YYZ A;  2Y0S E;  4X65 L;  3M4Q A;  1BVS A;  3C0M A;  2A69 C;  1TWF H;  3KF6 B;  3A7A B;  4N8F A;  5FO7 B;  2JA8 G;  1D5M C;  1S72 A;  3F8T A;  2RQX A;  4IAL A;  1XMQ Q;  1Q86 C;  1X55 A;  2VW9 A;  5GAD C;  2QKI C;  2JJQ A;  1FYC A;  1KRS A;  3DXJ C;  2R92 B;  4J6H A;  2M2L A;  2E74 C;  3RMH A;  3PUW A;  3K58 A;  3HOW B;  1YIT A;  3TQY A;  4HJ9 A;  3DM3 A;  4XQQ A;  4A3G B;  5KYL A;  2NYZ D;  3C2P A;  4DR6 L;  4C3I H;  1AN8 A;  2G9D A;  5A2Q E;  2XIW A;  4K8J A;  3GV6 A;  1A6X A;  5FLX L;  3BS1 A;  3PQI A;  3KLS A;  1J5E Q;  1PV4 A;  4I7Z C;  4B9X A;  4IQZ A;  2D9U A;  1SYB A;  1PFS A;  1N33 Q;  3BZD B;  5L37 A;  1O7I A;  1B3Q A;  4DNI A;  1KDB A;  5I6Y A;  3S16 B;  1LTB D;  2PZU A;  3HOX G;  3S2H H;  4HTH A;  4FF4 A;  2K52 A;  1B70 B;  4A3D B;  3K0Y A;  1I4H A;  1GUT A;  2DJG C;  4CKE A;  1BNZ A;  1WTP A;  1EQT A;  2VQF Q;  3LX0 A;  1Y8P B;  1OXS C;  2XWB B;  4ME3 A;  5ELO A;  1WD0 A;  3PGZ A;  4DR5 Q;  1JB7 A;  1U4P A;  3NTK A;  1SND A;  4FF1 A;  4H0L C;  1CKM A;  5K36 H;  2L5T A;  2UU9 Q;  4JI1 Q;  1HQR D;  3J81 E;  2VQE L;  3GTJ B;  4R8N A;  3KYH C;  3RR5 A;  1N34 L;  4LAA A;  4A3M H;  2D0P A;  5CV9 A;  4IUN A;  3CCV A;  3ULP A;  2R6G A;  1X3P A;  2SOB A;  3H15 A;  2J4X A;  5JEA H;  3TBI B;  1EIH A;  2HDL A;  1K8O A;  4NXN Q;  2F0Q A;  1FVI A;  3SXH A;  1ZYR C;  4C2M B;  1FNU A;  2R7Z B;  1LTI D;  3C1F A;  4GLA C;  3J80 E;  2WKC A;  3MHB A;  4C3I G;  1KHI A;  3DEP A;  1F2Y A;  3TRZ A;  1EY4 A;  2NB0 A;  3W3A A;  2AQ3 B;  4NKL A;  3T56 B;  4ODG A;  1BQQ T;  3C0O A;  3RUZ A;  3K5N A;  2K5V A;  4G57 A;  4O42 A;  4E6I A;  4DN4 M;  4C3J B;  4M8A A;  5EGT A;  3GV3 A;  1VQD A;  4U68 A;  1IKM A;  4DAV A;  1AEX A;  4X3U A;  5T1I A;  4JI5 L;  3M7N A;  4GLX A;  2RBM A;  4PQX A;  3G6E A;  5LMN W;  2XGT A;  2D62 A;  4JOI A;  3CW2 C;  1SJH D;  2QGQ A;  1IYV A;  3EN2 A;  3TP8 A;  4I7A A;  4L5S A;  5CV4 A;  4QGU A;  3FHW A;  5K36 G;  1Y1V B;  2I46 A;  1S40 A;  2PZW A;  3PUV A;  3ZJY C;  4P73 A;  2KEE A;  4JCV E;  4WJ4 A;  2A6E D;  1TWG H;  1B53 A;  4B3R L;  3I4O A;  2EY5 A;  5D65 A;  4Q5V A;  1PZJ D;  5J3B A;  1TVX A;  2F0V A;  4YWL A;  4YCV A;  3UI2 A;  1JE4 A;  1SSO A;  4QMG A;  1Q7Y C;  1E2W A;  1XNR Q;  4DK6 C;  4DV4 Q;  1J5E L;  1M4V A;  1JWM D;  2MQH A;  3AMU A;  3LWU A;  1W6J A;  1VQN A;  1D8L A;  3TZU A;  2RDG A;  4XQN A;  1ONL A;  1CA5 A;  4R4O A;  3EVQ A;  2EYM A;  1E7Z A;  4KN7 C;  1PFM A;  3QJY A;  2HIX A;  3UDG A;  5CGK A;  3H94 A;  1J8I A;  2WKD A;  1ZKO A;  1YJ9 A;  4DR5 L;  3AFQ A;  1LT3 D;  1WTX A;  1ROD A;  3T1Y L;  1GHK A;  2WAQ G;  4KY5 A;  3JAM c;  1SE4 A;  2A1A A;  3GO5 A;  5T1G A;  2HDM A;  5I2Y A;  3QIA A;  4JBW A;  4LFA Q;  2KEN A;  3CC7 A;  2O5I C;  4KHP Q;  1N32 Q;  4PZ6 A;  3ITP A;  4XTC S;  2LY7 A;  4LJZ C;  1Z6H A;  5CV8 A;  1ENA A;  1VQ4 A;  2AUJ D;  3OMC A;  3GTO H;  3BZK A;  2LSS A;  5CMD A;  1VQA A;  4L5Q A;  4AIM A;  1STH A;  3S1M H;  3NQI A;  1EQQ A;  4LF5 Q;  2F0O A;  4XYQ A;  4B3S L;  3SK6 A;  2RCN A;  2LMC B;  4OON A;  4UP9 A;  3TP7 A;  3Q8D A;  5DNF A;  3I70 A;  4X64 Q;  2XNA C;  3KLS X;  1B1Z A;  2R93 H;  2PCF B;  4TVA B;  4P2C B;  2PPB C;  3BU2 A;  2WP8 J;  3CPW A;  4MTK A;  1DXM A;  5KNB A;  3NBH B;  4YCW A;  1EFW A;  1GXD C;  2AWN A;  1E1O A;  1SNP A;  2K5W A;  2ICI A;  3I4M G;  4IPC A;  3F1Z A;  2K03 A;  1C8C A;  4A3B H;  3HP3 A;  1LTA D;  4LFB L;  4X3S A;  3A54 A;  4ZUJ A;  3ULL A;  1WI5 A;  2ZTC A;  4HJ5 A;  2CVR A;  4A3L G;  1NNX A;  1YBY A;  3HKZ E;  3C3L A;  1EL0 A;  1PYS B;  4DUY L;  3HOV G;  4WJW A;  3JAM L;  4YHH Q;  1EOT A;  1ICW A;  2K6A A;  3U4V A;  3GTP B;  1S5C D;  3J81 c;  2NUC A;  2A5H A;  2M9V A;  3T51 B;  4OL7 A;  1GOZ A;  5CBE E;  1SNQ A;  4LK1 C;  2VB3 X;  4O1N A;  3KF8 A;  1SYF A;  3H0G B;  1XYI A;  5CC4 A;  1NTG A;  2YU9 B;  4MNO A;  5DM6 3;  1W3S A;  3BVZ A;  3D4D A;  3HOY G;  5LMN Q;  4RAU C;  1YNN D;  2WB1 B;  2JYO A;  1NY4 A;  3M4O H;  2K5D A;  1S4Z A;  5HGQ A;  4C3H B;  5I9P A;  3MEF A;  1LTT D;  2B8G A;  2V1C C;  3RLF A;  2DY7 A;  3EQL C;  1IL2 A;  1GVP A;  3OIQ A;  4JPB W;  5BR8 Q;  4A3C G;  1PLF A;  4CJ0 B;  2UXB Q;  4APV A;  1VQB A;  1UNS A;  3J80 c;  3AB9 A;  2LXJ A;  4A3F B;  3QOL A;  4QUC A;  5BN3 A;  4A3B G;  3GTG B;  1IL8 A;  3E5S A;  4XT1 B;  5A2Q L;  4JYA Q;  2ZTD A;  2SNS A;  1PH3 A;  1R4Q B;  1I4Q A;  4GKJ Q;  2L12 A;  4IUT A;  3SK8 A;  1VQJ A;  4LF9 L;  4NP5 A;  2K33 A;  5ELC A;  2K04 A;  1KD1 C;  4BY1 H;  1LTS D;  1TWH H;  2Z4H A;  3IFT A;  4S3S A;  2K14 A;  1I94 L;  4A93 B;  2LFN A;  1CSQ A;  1J6Q A;  2VS1 A;  1MSG A;  4JC0 A;  1TU2 B;  4LF5 L;  1B4O A;  3X3M A;  4A3J G;  2F3I A;  2A8V A;  1CKN A;  1RIP A;  2OQK A;  4RHS A;  3V2T A;  1I50 H;  1TWA B;  5JOB A;  4AQY L;  1IW7 C;  2OTJ A;  1PH8 A;  3M3Y H;  4R4Q A;  1UEB A;  1BKB A;  2F0K A;  4DR3 Q;  2E2I H;  1KL9 A;  4A3I H;  2EY1 A;  1SE8 A;  3J81 L;  3S1R H;  4QJF A;  3D6C A;  3FP9 A;  1EY5 A;  3VR4 A;  1A2T A;  5M5X H;  1EU3 A;  3G4N A;  3T16 A;  1WFQ A;  3URY A;  1C9O A;  1A3U A;  1RL2 A;  3CMA A;  2EDG A;  3HRZ C;  3E9I A;  4OEM B;  2F0G A;  2H5X A;  1FGB D;  3PO2 B;  3CF5 A;  3J80 L;  2NVT B;  1K8A C;  1DOM A;  4JW0 A;  3I73 A;  2JA7 G;  1JMC A;  4FO2 A;  5EPK A;  2Q2T A;  4K0K Q;  4A3K G;  5GAG C;  2WFW A;  4GN4 B;  4QUF A;  4IFD G;  2OT2 A;  1GUS A;  2VZA A;  4BY1 G;  4YWK A;  1AP0 A;  3M9B A;  2N88 A;  3UDX A;  1PTO B;  2H4O A;  3PO3 H;  1XPR A;  1UAP A;  3E0J A;  3G4O A;  1SYE A;  1SYG A;  1QUQ B;  5TSS A;  1AE3 A;  3CRK C;  1CA6 A;  5C3E H;  5C44 B;  3CME A;  1ENF A;  5FLM H;  5M3F H;  2PNH A;  4EVO A;  4DFA A;  2MP1 A;  1K0R A;  2NTT A;  1V43 A;  2Q2H A;  4XQJ A;  3M4Y A;  4K2K A;  1NR2 A;  2EJF C;  4BBR H;  2A68 C;  2EYL A;  2UUC L;  2BE5 C;  2L11 A;  1IBM L;  4P75 A;  2E8G A;  1F2Z A;  3RN2 A;  5IT9 E;  3QR8 A;  1M8A A;  1SMY D;  1HA5 A;  2PI2 A;  4WOR A;  1R4P B;  4K6D A;  4BA1 I;  4RGN A;  1D5X C;  4JV5 Q;  3WWV A;  3H0G G;  1WVL A;  4BBS B;  4L63 B;  1F2M A;  3ULJ A;  5BN5 A;  2F0I A;  2PW7 A;  1WTV A;  4FF3 A;  1CHP D;  2WB1 G;  3CCE A;  4FNF A;  3I4N H;  5JVH 3;  1CFM A;  3PIO 3;  3VDY A;  5IYD G;  3FPP A;  1S5E D;  1GUN A;  1I4P A;  5KND A;  2C9O A;  2JA6 H;  4V19 0;  4DKA C;  3I72 A;  1L0X B;  4OWX B;  2CH4 A;  3L2P A;  4X65 Q;  1K73 C;  2ENB A;  2KOL A;  4FF2 A;  1STB A;  2F0N A;  4HJ8 A;  1XNQ L;  1D5Z C;  1EU4 A;  1HA6 A;  3MFG A;  1EWI A;  1PTO C;  1HFN A;  1KNA A;  5C3E G;  4KY7 A;  5FLM G;  5M3F G;  1WCM B;  3VR3 A;  4AYB G;  3HOZ H;  3IKJ A;  5IGG A;  2RSO A;  4A93 G;  1QG7 A;  1Y1W H;  5F2D A;  1EY7 A;  1JC7 A;  2K5Q A;  1STA A;  3FPU B;  4DR6 Q;  4JG2 A;  4IFD J;  1SNO A;  3I3C A;  3FEW X;  4RH6 A;  3E6Z X;  4H02 A;  5C0X G;  4OWT B;  2A6H C;  1VQO A;  1AZP A;  1P8L A;  3MTS A;  1ET9 A;  3UE0 A;  1EY8 A;  1X3Q A;  2E2H H;  3K6O A;  1PH6 A;  3HOU B;  1D2B A;  2B3G A;  4K0K L;  1ENC A;  3I4N G;  1JJG A;  1P16 A;  5JVG 3;  1EQR A;  2PQA B;  4QIW E;  1WTQ A;  4A4I A;  1XTD A;  3MFY A;  2F3W A;  1Q81 C;  4KD3 A;  1BXT A;  2NVQ B;  1Y8N B;  5EKK A;  4YY3 L;  3HFZ B;  2OQ0 A;  1OXV A;  1LT4 D;  3OTO L;  2B63 B;  2JA8 H;  1L1O C;  2X6L A;  4QQB X;  4X6A H;  1EIF A;  1HNW L;  2Z0S A;  2BDN A;  3S17 H;  4OO1 G;  2MO1 A;  4DNR B;  1N34 Q;  2X6G A;  3TDQ A;  2C35 B;  2NVX H;  3HOZ G;  1LAC A;  1SE2 A;  1UE1 A;  4UY8 C;  5I9O A;  2UXD L;  1L0Y B;  1Y1W G;  4DPG A;  4DXF A;  5C44 G;  2NZH A;  2F4V L;  4F87 A;  4A76 A;  3AQQ A;  1DON A;  5IIF A;  1Z9F A;  3M4P A;  3K5L A;  1DD2 A;  3I4L A;  1LYL A;  2JA5 B;  3HOX H;  3K7A B;  4J8Q A;  2ID0 A;  5GRO A;  2Z8L A;  3GTK H;  1SXT A;  2Z9H A;  4ILW A;  5HY6 A;  3KUP A;  3GTQ B;  1C0A A;  2AKW B;  3TEH B;  4MTN A;  5H1S E;  3OHX C;  4LFC L;  2LKV A;  4RKL A;  4JI5 Q;  1S5F D;  4G7Z C;  2F0D A;  1A8V A;  3ONA B;  1PRT D;  2E2J B;  5C4X G;  1MJC A;  2IJ0 A;  2B2V C;  1F9P A;  5C0X J;  2L4N A;  5KGU A;  2B2Y C;  3GTM H;  1CKN B;  1VQK A;  2RDF A;  1QZH A;  2E75 C;  5FJ8 G;  1VQF A;  5D3I B;  4GNX C;  3OWF A;  1OO9 B;  4DR7 Q;  4UPA A;  4A3E B;  4B3R Q;  1YNJ D;  1BOS A;  2WAQ E;  3NEM A;  3FKI B;  1WTO A;  4KKS A;  1KXL A;  4DR4 L;  1QCB D;  4JBJ A;  3KJO A;  3BDC A;  1Z47 A;  2IL8 A;  4CDE C;  1KRT A;  4IUQ A;  1LAB A;  2UUB L;  3WDN A;  2NN6 H;  5C4J H;  2Y0S B;  2I0Q A;  3U50 C;  4GN5 A;  1UUP A;  3CQZ H;  3OOC A;  4DAP A;  1MD2 D;  4UP8 A;  1GUO A;  3NUC A;  5EQ0 A;  3CCQ A;  2KVM A;  3TME A;  1VQ8 A;  2HT1 A;  4HSP A;  3PV0 A;  1PH1 A;  2I5H A;  2QDB A;  4HSV A;  4J15 A;  2O2L D;  5IT9 c;  5EAY A;  3C46 A;  5LL6 S;  3IFD A;  3FRP B;  1H9S B;  5CV7 A;  2L0C A;  4MN3 A;  4GOP C;  1FD7 D;  3S9W A;  5M5W B;  2PI2 E;  3ERS X;  5EKL A;  4FXK C;  1SN8 A;  3SDZ A;  4DF7 A;  3QB3 A;  1EIG A;  1G91 A;  3J81 j;  3T1Y Q;  1E3P A;  1MJE A;  5IY0 A;  4MHE A;  1YIJ A;  5CV6 A;  4EQN A;  3HOU G;  4L6T B;  1EFI D;  1PRT F;  2FMM A;  5IOC A;  1Q12 A;  4IPG A;  4DGZ A;  1V1P A;  1YJW A;  4DAM A;  5CYU A;  1MGS A;  4DR2 L;  2K5N A;  5M3M B;  2ZXR A;  2QEJ C;  3RN5 A;  1TWG B;  2L55 A;  2RHQ B;  2B63 G;  3NHH A;  4B3S Q;  1KDC A;  1M90 C;  2GA4 B;  1PYB A;  2NTS A;  1K28 A;  4P74 A;  4OGQ C;  3STB C;  3E9H A;  1HUN A;  4KI0 A;  4EQ5 A;  2ZJR A;  3AEV A;  2KCN A;  1VQC A;  2EYF A;  2EOT A;  1MIU A;  4LF4 L;  1YHB A;  3N6R A;  2NN6 G;  2PNR C;  1CSP A;  3NBI A;  4POG A;  1YVC A;  1I5F A;  3HKS A;  1EZ6 A;  3VA7 A;  1U0L A;  2MGS A;  3S14 B;  3U9O A;  2AUK A;  1I4R A;  2OF1 A;  1EUJ A;  2UXC L;  3HZX A;  2WAC A;  4LFB Q;  5NUC A;  2B2W C;  1BBW A;  2K1B A;  4RHR A;  1HR0 L;  1LTL A;  1LTR D;  2IY5 B;  4U67 3;  1OTC A;  3RLN A;  5IT9 L;  2Q8I B;  3OMG A;  1O78 A;  2NN6 I;  4RA8 A;  4R4C A;  3K80 C;  2F0L A;  5FOB B;  2ZXP A;  4UP7 A;  1K3R A;  1EYA A;  1YHA A;  2DY8 A;  3W1B A;  3S15 B;  4LNQ A;  4DUY Q;  3U58 A;  2ZM6 L;  4DR7 L;  3PCO B;  2B29 A;  3T4A C;  2WII B;  1U9R A;  3GTO B;  2KJX A;  5I6W A;  4JK1 C;  4DXG A;  1IBL L;  3GTJ H;  1XJV A;  5DM7 3;  1X6O A;  3CAM A;  3S1M B;  1E1T A;  4BS9 A;  1Z7T A;  1SBB B;  1VQ5 A;  2JXM B;  2F0S A;  1JIC A;  3PUX A;  1WTR A;  2RF4 A;  1E24 A;  5E4X A;  5ISR A;  1STY A;  1Y14 B;  2KHS A;  3GDE A;  2R93 B;  2R92 G;  2DNC A;  1DM0 B;  5ELD A;  4CJ1 B;  2CFM A;  2RKS A;  4DV5 L;  2EQS A;  4A3E G;  1PRT B;  1PH9 A;  3HOW G;  2R61 A;  3FKI G;  3I4M H;  4DNT B;  1TWC B;  2VB2 X;  4A3G G;  2KHJ A;  2CHB D;  5DEH A;  1B9M A;  4HIK A;  2VY3 A;  1K83 H;  1STG A;  3RZO B;  1S5D D;  1B8A A;  1JT8 A;  3OYY A;  1E0B A;  1UWV A;  4A3L H;  2K50 A;  1RJT A;  5D14 A;  3F2C A;  3KLR A;  4C3J H;  5IP9 G;  1N9W A;  1VQI A;  1JE5 A;  4EGV A;  3L7Z C;  4LF9 Q;  4IPH A;  2K4K A;  5IYB H;  4IPD A;  3HOV H;  4A3D G;  3QWN A;  1II3 A;  1PH5 A;  1Q3L A;  1I94 Q;  1Q1B A;  3S2D H;  4JI3 L;  1VF5 C;  3R93 A;  2VUM B;  2KA7 A;  1B50 A;  4LWC A;  4IUR A;  5GAE C;  1KAA A;  4RGM A;  2F0M A;  1LM0 A;  3K59 A;  1L1O A;  4X62 L;  3VR6 A;  5KRU A;  1AH9 A;  3EJI A;  2N78 A;  1NMG A;  4PMC A;  3HOY H;  1SAP A;  4AQY Q;  1EEF D;  3MXU A;  3QG1 A;  4YWM A;  4DUZ Q;  4GZY C;  3MVV A;  2H1E A;  2AHO B;  1GO3 E;  4UDU C;  3M4O B;  3TZD A;  1QIL A;  2F0H A;  4A3C H;  4JI4 L;  1BCP D;  4ULL A;  3GTL H;  1FNW A;  2F1M A;  1HJP A;  1PDQ A;  2R7Z G;  2PZT A;  3NWS A;  5CBA E;  3BDL A;  2ZJQ A;  4ZCK A;  1GD7 A;  4N8X 1;  3VYU A;  1BO0 A;  3PMF A;  5DLQ E;  4B9W A;  2A73 B;  4A75 A;  1NCV A;  4CHT B;  3BJU A;  1ZEQ X;  4EQO A;  3SE0 A;  3D4R A;  1I4X A;  4LF6 L;  4C3J G;  3MXG A;  4QL5 A;  3VR2 A;  2CW0 D;  3CXC A;  1ET6 A;  3CCM A;  2JEA I;  4OX9 L;  3ICE A;  1WYD A;  1QB5 D;  1I6H B;  5IYB G;  3TRE A;  3CCL A;  1TWH B;  2OCE A;  4PV1 C;  2Q8R E;  1A15 A;  4A3J H;  1QJO A;  2JSO A;  2AWO A;  1GKH A;  1ESR A;  4AH6 A;  1V1O A;  1B3A A;  2B2V A;  4ID6 A;  2FJ2 A;  1I6V C;  1Y1V G;  4JI0 L;  4HED A;  3E0E A;  1CQF A;  1HTL D;  3I55 A;  2B2Y A;  3AFP A;  3J7Y W;  4MIU A;  1I50 B;  4XIG S;  2AQ2 B;  4GNX A;  3PUZ A;  3GD7 A;  3CC2 A;  4BXX H;  1A3T A;  2CWA A;  5EBD A;  2UUC Q;  2EY6 A;  4A3I B;  1I3Q H;  1NJI C;  1IBM Q;  3KBG A;  4IOA A;  3S1R B;  3ZYY X;  5JPM C;  4LF8 L;  1SRU A;  2KCT A;  1SE3 A;  1UE6 A;  1VS0 A;  5KNC A;  3HKZ B;  3NPP A;  5I2X A;  1VQH A;  4Z9C B;  3I7F A;  4CGY B;  4AYB E;  5HGT A;  2GVB A;  4PZ7 A;  3K0X A;  5IYC G;  2EYH A;  2ZT9 C;  1BCP F;  4UHV A;  3PUY A;  5AJ3 L;  2JA7 H;  1LV9 A;  2HCI A;  3IRB A;  1SEB D;  3CP0 A;  4GN3 B;  4DV1 L;  4A3K H;  4L5T A;  5C4Z A;  4IFD H;  3NXW A;  1IBK Q;  3RLO A;  4NMZ A;  4KY6 A;  3R2I A;  5E3F A;  4DAY A;  1H9K A;  4NW2 A;  1EOV A;  3N52 A;  3LGJ A;  4GOP A;  3LWE A;  3A55 A;  4G7O C;  3PO3 B;  2B39 A;  1XNQ Q;  1HTP A;  3CKI B;  2QF7 A;  4DV0 L;  1ZXT A;  3QO2 A;  1C4Q A;  3SVM A;  3G71 A;  1UE5 A;  5EKI A;  1W2B A;  2XTI A;  3KF6 A;  1PYW D;  1CK1 A;  1Q1E A;  2I07 B;  2EIF A;  3A0J A;  4DUZ L;  2MPM A;  2JN4 A;  3VYR A;  2EE1 A;  2L1B A;  4M1U B;  1IYJ B;  2HUG A;  3NEN A;  4BXX G;  3KDF A;  2F52 A;  4BBR B;  2ZJP A;  4JI7 L;  5J1Z A;  4R4T A;  2RCF A;  3H0G H;  4B3M Q;  5IWA Q;  1QWY A;  5M5Y H;  3OIP A;  3KOJ A;  4BY7 B;  1PRE A;  1E2V A;  4K5W A;  4WJ3 M;  3C1E A;  3AU7 A;  3KFU A;  1HHV A;  1HZA A;  5IYD H;  1PXU A;  2L15 A;  4F8M A;  3NE5 B;  2ZTE A;  4DK3 C;  1MSH A;  2EYJ A;  2R3Z A;  3S1N B;  2A6E C;  3DUZ A;  2Z4I A;  3MC0 B;  2JA6 B;  1VCI A;  2YV5 A;  4FXG C;  1UEA B;  4YY3 Q;  4DV7 Q;  3CCS A;  4LMQ D;  3OTO Q;  3K5O A;  3NSW A;  1VMC A;  1L2F A;  2KUM A;  2SEB D;  1CKO A;  4Y7N H;  1KAW A;  2KHI A;  3U9S A;  2MUY A;  4GS3 A;  1HNW Q;  1BCP B;  2CQO A;  2KBN A;  1CUK A;  4A93 H;  3EA6 A;  3VYS A;  1RTO A;  4B08 A;  3RNU A;  2IX1 A;  4IFD I;  1EYG A;  1ILP A;  1TR5 A;  2XSC A;  1HR0 W;  1Q8K A;  4ZK9 B;  5FO9 B;  4NXM L;  2UXD Q;  4ZKB B;  2DUD A;  3NQT A;  3H91 A;  5C0X H;  4OEL B;  3FMC A;  2V4D A;  2PW5 A;  4IZ8 A;  3SHL A;  1TWA H;  1STE A;  4ZAI A;  2F4V Q;  5JJK A;  2F4I A;  4XDX A;  4ZLT F;  3DHQ A;  3PIP A;  1FL0 A;  1LLR D;  3I56 A;  4C3H G;  4PZ8 A;  1BBX C;  4RCN A;  4IUU A;  1K8G A;  3P7J A;  1NUC A;  4WFN 3;  1IBK L;  1QOH A;  4LFC Q;  1X3G A;  1C48 A;  3V96 A;  1HRJ A;  1HNZ L;  5ELF A;  4WRD A;  1T5E A;  3K81 C;  3PO2 H;  4A3F G;  1Q90 A;  3RD4 A;  3CHB D;  2NVT H;  2IW3 A;  4OO1 H;  1YJN A;  4DV3 Q;  2UUA L;  5CV5 A;  2JA8 B;  4N9P A;  4Y52 H;  5AFW A;  4FVM A;  4Q0F A;  5J22 A;  2F0P A;  1VDZ A;  3R2T A;  2WIN B;  5LHY 1;  2A74 C;  2F0U A;  1EWH A;  1EWC A;  1PTO H;  4HAE A;  4DV6 L;  4HIO A;  4JI6 L;  1ASZ A;  1A63 A;  4ZRZ A;  5GQO A;  3T13 A;  2PMZ E;  1O80 A;  2NVX B;  4EQP A;  5C44 H;  1KIX A;  5FO8 B;  4DR4 Q;  5IOD A;  1VQ9 A;  4X3K A;  1X3F A;  3V05 A;  4CKB A;  4POF A;  5IWA L;  1R9T H;  1M1K C;  4B3M L;  5LL6 X;  3KK7 A;  2QDL A;  4LF7 L;  2UUB Q;  4IUP A;  1BUV T;  4QF4 A;  3DLL A;  1K9M C;  2EZV A;  1PH2 A;  2QW7 A;  3EBE A;  3ND9 A;  4KHV A;  2WV6 D;  4HN7 A;  2BA0 A;  2F3V A;  5IP7 G;  3S1Q B;  3HOX B;  1F2L A;  3NTI A;  1U4M A;  4L8J A;  5EPL A;  4OIK A;  2BCO A;  1HZ9 A;  4RGO S;  1MI2 A;  1OXU A;  5C4X H;  5C0X I;  4KJN A;  3OPO A;  4DV7 L;  1SFO B;  1IYU A;  3TS2 A;  3MXP A;  3PO2 G;  1S3O A;  1TWF B;  2EJG C;  1ILQ A;  2IWH A;  5K5P A;  3EFX D;  3J7A V;  3A7L A;  2L9H A;  2HIV A;  4TQU S;  1X9N A;  4ZKC B;  1STN A;  1CI3 M;  1XX8 A;  5FJ8 H;  1EYD A;  2GVA A;  1SNC A;  2B2U C;  1YNN C;  3CCR A;  2XVS A;  3D3R A;  2NZO A;  3TSS A;  5DAU A;  4HIM A;  4XT3 B;  3KF8 B;  5KEE A;  1YHQ A;  1BBU A;  4DR2 Q;  4HMI A;  1TQO A;  2HCC A;  5KYI A;  2MNA A;  1TS4 A;  4KKT A;  2LS0 1;  1H9M A;  2KCM A;  5EPJ A;  5A35 A;  3A8K E;  2HD3 A;  4QIW B;  2E5L L;  1HPC A;  1SYC A;  2N55 A;  2G9H D;  4C3I B;  1FJG L;  4OO1 I;  4G4K A;  2OTL A;  1IZ6 A;  1SMX A;  1S5B D;  3ERQ A;  4DV2 L;  4LF4 Q;  1RHP A;  2G5D A;  4QY7 A;  3P75 A;  1NMF A;  3G6J B;  3C0N A;  4CDF C;  1D7Q A;  4K5X A;  3S2H B;  5G3L F;  2UXC Q;  4KN4 C;  3CU7 A;  4PMB A;  2R7D A;  4JI8 Q;  4TSS A;  1EZ8 A;  3OW2 A;  4BBS G;  4KKU A;  1HR0 Q;  1JQY D;  1WTW A;  2Z6K C;  1TT2 A;  2FFK B;  3HOU H;  3RZD H;  4DV3 L;  3DWQ A;  1YNX A;  4KK7 A;  2AQ1 B;  4RMF A;  2NVQ H;  2J7Z A;  5C3X A;  2ZM6 Q;  1Y8O B;  5I4D A;  2IPK D;  4A3M B;  2B63 H;  1FR3 A;  1PZK D;  1IBL Q;  4H7B A;  4R1J A;  3AYH B;  1SYD A;  1HNX L;  1CZG A;  3TS0 A;  4HMJ A;  2N3S A;  3K57 A;  4HID A;  3KDF B;  1F9S A;  3A74 A;  1WCM G;  1EIY B;  4H44 C;  1GM5 A;  1PFN A;  3PIO A;  3O13 A;  3B6Y A;  2F0W A;  1KLU D;  2VL6 A;  2ZXO A;  3Q22 A;  4DV5 Q;  3NK9 A;  4C1N I;  3BDO A;  2K32 A;  1Y69 U;  4ABN A;  1TS3 A;  2JA9 A;  1N36 L;  4NPS A;  1XMO L;  1TY0 A;  2BH8 A;  1NSN S;  3MAQ A;  2IHF A;  2NVY H;  5GAH C;  4P71 A;  5C3W A;  2K28 A;  2JA5 H;  1ASY A;  3K7A H;  5COR A;  4KHZ A;  2WAQ B;  3GTQ H;  1DYQ A;  3I91 A;  3VYT A;  4JBM A;  4HCE A;  1QVF A;  1WJJ A;  3T53 B;  1EY0 A;  3K7U C;  4C56 C;  2E2J H;  4JI3 Q;  4F88 A;  2CH4 W;  1KTK A;  2HHH L;  1SMY C;  2O4X A;  3OWE B;  1QNU A;  4I65 A;  3W2D A;  2R7F A;  2Q8T A;  4X62 Q;  3HG9 A;  4K8I A;  1SRO A;  4O2D A;  3MXN A;  1AE2 A;  1E22 A;  1PFB A;  1VQ7 A;  5E4W C;  3SEB A;  3EIV A;  2DJF C;  1JOK A;  2R92 H;  1B7Y B;  2D5D A;  4H13 C;  4A3E H;  3HOW H;  2X69 A;  3FKI H;  4IJH A;  5FK9 C;  1ICF B;  4IN3 A;  4A3G H;  1G51 A;  2OXP A;  1YEZ A;  3JAM i;  3UDI A;  1KQS A;  4UAI A;  4JI4 Q;  3PSI A;  1KAB A;  3I4M B;  1KC8 C;  1NR4 A;  3T1H L;  5E1F A;  3PF4 A;  4JI8 L;  1VQE A;  1K83 B;  3A56 A;  4R4I A;  5IP9 H;  1T9H A;  1IHZ A;  5ELN A;  1IW7 D;  1U4L A;  1F77 A;  3Q6S A;  1JOQ A;  4DR1 L;  1HCZ A;  3S16 H;  3NWT A;  4X66 Q;  2JA5 G;  4FYD A;  3KBX A;  1BDO A;  4A3D H;  1NAP A;  3VR5 A;  4LF6 Q;  3HEJ A;  1RTN A;  3TN2 A;  1C7Y A;  3R3O A;  3PF5 A;  4JI2 L;  2GN5 A;  4OX9 Q;  3F2D A;  3A5Z B;  1RDP D;  3J7A F;  5M5W H;  5LMU L;  3BVM A;  1CT1 D;  1SNM A;  1CHQ D;  3BYT B;  3HOV B;  1MKH A;  1J9O A;  3BYY B;  1U4R A;  2EY2 A;  2JQO A;  3S2D B;  1GUW A;  2FIN B;  4LUZ A;  3SK4 A;  5BN4 A;  4NB3 A;  1JJ2 A;  2F0E A;  3FDT A;  4JI0 Q;  1JOO A;  1XMQ L;  3CCU A;  1JB3 A;  4DU9 A;  1Q82 C;  3HOY B;  1QUQ A;  2JE6 I;  5M3M H;  5IGD A;  4CDD C;  3K5M A;  1PZI D;  4A3M G;  2EPB A;  4C2M H;  1XXG A;  3JC6 6;  2R7Z H;  1U5K A;  5KIX A;  4LF8 Q;  5JEA G;  2HQE A;  1A2U A;  3SR1 A;  3GTL B;  3SK5 A;  5EBC A;  1PMR A;  4K14 A;  1VQ6 A;  4A3B B;  2Y0S G;  4R8I A;  1N8R C;  3D8G A;  2RDH A;  5AJ3 Q;  3F2U A;  2DNE A;  3HS0 C;  4OIJ A;  1N33 L;  4DV1 Q;  1G8Z D;  3TP6 A;  3S14 H;  1WOC A;  2BDO A;  3I90 A;  3UDF A;  3J81 i;  4CBV A;  2A68 D;  2BE5 D;  1D6E C;  1HXY D;  2YTX A;  4BWG B;  4YIJ A;  1G2T A;  2VQF L;  1WD1 A;  2E2D C;  2EYO A;  4OXP A;  1VF7 A;  2KED A;  4HR7 B;  1TKW B;  1ESF A;  4A3J B;  1W6K A;  2UU9 L;  1Y1V H;  3DWP A;  4DV0 Q;  4JI1 L;  1L0W A;  3S15 H;  2LXK A;  1HFG A;  3HGB A;  3J80 i;  2K75 A;  1SJE D;  2B2U A;  4TKO B;  5JJZ A;  1VMP A;  3FVQ A;  1EY9 A;  4EX5 A;  2BA1 A;  2EJM A;  3G48 A;  1Q46 A;  5M3M G;  4DA2 A;  1TII D;  2I5L X;  4NXN L;  4KV6 A;  4ZYS A;  2B2T C;  4O0A A;  4JI7 Q;  2DN8 A;  1I3Q B;  1FGU A;  2VXW A;  2BH2 A;  2KEC A;  1OXT A;  5JAV A;  5IYC H;  2SNM A;  1H9J A;  1PRT C;  3OSO A;  1PTO D;  5JPN C;  1Z52 A;  2KQ3 A;  1H95 A;  4FXD A;  2QA4 A;  3BG3 A;  3KLW A;  1BR9 A;  1T5X D;  2QIL A;  4X66 L;  1TWC H;  4LUO A;  2JA7 B;  1X65 A;  2FHT A;  5D3D A;  3RZO H;  2ES2 A;  4A3K B;  2NZ1 D;  1CTM A;  4BY1 B;  1EEI D;  2IHE A;  1YNJ C;  2WB1 E;  4KMU C;  4BA2 I;  2AMC B;  3TP5 A;  2A6H D;  4ZQ3 A;  1AW7 A;  3L9A X;  5FKA C;  1JCK B;  5JEA J;  1G6P A;  2Z6K A;  1EYC A;  1K0S A;  2PQA A;  2Q2U A;  4QCL A;  4G7H C;  3PIP 3;  1B2T A;  3W5O A;  1NE3 A;  3MZ5 A;  2IX0 A;  2FMC A;  2VUM H;  4N9T A;  4XYO A;  2C5C A;  1QE6 A;  3G4S A;  2Z1C A;  3W1G A;  4KTA A;  3M3Y B;  2E2I B;  3H09 A;  2F0F A;  3ND8 A;  4RWS C;  3H3V C;  4NXM Q;  1MBY A;  5M5X B;  4GKK Q;  1X32 A;  4NDX A;  1HQM C;  3H3V H;  3I8Z A;  3UE1 A;  3CPF A;  4JVZ A;  5ELB A;  2BOS A;  3VA5 A;  2IT1 A;  5EJW A;  1XNR L;  5M5Y B;  4IJL A;  4XXE A;  4L5R C;  4DV4 L;  3U4Z A;  1TXY A;  1DOL A;  1HH2 P;  2R93 G;  2CQA A;  4HCS A;  4J1M A;  2A19 A;  4K6L A;  1JWS D;  1PTO F;  1DZ1 A;  5IGF A;  3ERO A;  3P1H A;  1HNZ Q;  1LUZ A;  2E76 C;  3A8I E;  1BF4 A;  3GP7 A;  1PVO A;  1V1P B;  2EXD A;  2UUA Q;  4RGT A;  1N32 L;  4LFA L;  1A3V A;  2K5H A;  5C3E B;  4Y7N B;  4KHP L;  2KCC A;  1I6H H;  5IGB A;  2PYK A;  5M3F B;  4KD4 A;  4AYB B;  1QZG A;  2FXQ A;  3K8A A;  2MFI A;  2EYP A;  4P72 A;  4DV6 Q;  1XPU A;  4RFB A;  1GHJ A;  4JI6 Q;  3MXN B;  5JJI A;  3GTP H;  1RCV D;  5FLX E;  1DGS A;  2D0O A;  2VUM G;  1VQM A;  3CD6 A;  1UE7 A;  3Q24 A;  1IXR A;  2A69 D;  1FNV A;  3CCJ A;  1JR0 D;  2XRQ D;  4LUV A;  4QB4 A;  2F0J A;  1JOR A;  4X64 L;  2YU9 H;  3S24 A;  1V9P A;  4LF7 Q;  4DK0 A;  3GQB A;  2JK8 A;  3J7Z C;  3L0O A;  1F9R A;  4C3H H;  1OXX K;  4B3T Q;  2XRS D;  1ML0 D;  2F03 A;  2CWP A;  4R9W A;  1O7Y A;  1VQG A;  3I4N B;  2ATW A;  4RG1 A;  4FP5 D;  1X3E A;  2DGY A;  4HJ7 A;  2MO0 A;  4A3F H;  2TMP A;  3R8B A;  1H9R A;  4MZ9 A;  2HQL A;  3L3O C;  2ASB A;  3GTG H;  1B9N A;  2QEX A;  3H3V I;  1F9Q A;  1LO5 D;  2B2W A;  1QNK A;  3I2Z A;  3Q23 A;  4IUV A;  1AZQ A;  1D1I A;  1H9S A;  3CRL C;  5CR3 A;  2OWO A;  3M7G A;  2RA4 A;  2RSN A;  5JJL A;  1VQP A;  4IOC A;  1DJR D;  3D4W A;  2K05 A;  5C5M A;  1HZC A;  3HOZ B;  4YHH L;  4OHJ A;  1MHW C;  1LTG D;  5ELE A;  3BZC A;  3Q0A A;  1JJC B;  1Y1W B;  4CJ2 C;  4GKK L;  3D31 A;  4LW1 A;  4JBK A;  3MA2 B;  2N8N A;  4K5V A;  1G29 1;  2E5L Q;  2EVB A;  1FJG Q;  1DOK A;  1R9T B;  3DEO A;  5LMN L;  5IP7 H;  4YCU A;  4DV2 Q;  1XWE A;  1PH4 A;  2Z6B A;  2J0T D;  1QVG A;  1JWU D;  1GUG A;  4A3I G;  3H6M A;  4OWW B;  4PMW A;  2E2H B;  3DMU A;  5C5L A;  5BR8 L;  4BY7 H;  2YTY A;  3HKZ G;  2UXB L;  4C1N K;  4FDB A;  1CQV A;  1ZYR D;  2N49 A;  2ICE C;  1RKN A;  4KLK A;  3STB D;  1V1Q A;  4JOI C;  3P20 A;  3DWA A;  1XPO A;  5C4X B;  1CZW A;  1D1K A;  4JYA L;  4GKJ L;  1Q8I A;  1SR3 A;  3S1N H;  1KNE A;  4ZUI A;  1EY6 A;  3J7A 5;  2XWJ B;  3KJP A;  4TRD A;  1L1O B;  3S17 B;  3QOJ A;  2CCZ A;  2P5Z X;  1DCZ A;  1CM9 A;  3IL8 A;  5C6A A;  2RHS B;  1BCP C;  3PO3 G;  4KJO A;  2O5J C;  1HNX Q;  1K3B C;  2ALY B;  3MWY W;  3ER0 A;  2K7V A;  5IGC A;  1TS5 A;  3LNN A;  3IAY A;  1PA6 A;  5E7N A;  4DR3 L;  2TSS A;  3MEH A;  4B3T L;  4CKC A;  1RD9 D;  3WOF A;  2IX3 A;  2VNU D;  4HJA A;  5G3L D;  1KLG D;  2CW0 C;  3D6W A;  1X56 A;  1X54 A;  3OW7 A;  3NTH A;  4BBR G;  4X3T A;  1A0I A;  1SDF A;  2B2T A;  2JP1 A;  2NWG A;  4F7X A;  3GTK B;  1N36 Q;  2YTV A;  1XMO Q;  4BBS H;  3M85 A;  3NP8 A;  1G6Z A;  1LT6 D;  4BY7 G;  2NBF A;  3E3X A; 
#chains in the Genus database with same CATH homology
 3DM1 A;  5COY A;  2PMZ B;  2RVL A;  2JEB I;  3RZD B;  2K01 A;  5C4H A;  1B44 D;  1G2S A;  4DK1 A;  3A8J E;  2M00 A;  1EQV A;  2OEO A;  1O7L A;  3GTM B;  1K8M A;  2SDF A;  4K2L A;  1I4G A;  2QCP X;  3G7L A;  2PO4 A;  2B8F A;  2MHV A;  2XN9 C;  1TY2 A;  1E2Z A;  1XTC D;  4PNY A;  5C4J B;  1AFP A;  3CQZ B;  1IKL A;  3X3N A;  5M9O A;  4RKB A;  2EXZ A;  4ME5 A;  3NBH A;  2NVY B;  1V8Q A;  1KDA A;  2F0T A;  1TS2 A;  4RCO A;  3WOE A;  1LT5 D;  5IGE A;  1RF2 D;  3JAM E;  1GJX A;  4V0B A;  5HUR A;  3BVG A;  2PQE A;  2D2C C;  2MJ8 A;  1HUM A;  1O7Z A;  5J39 A;  2YYZ A;  3C0M A;  2A69 C;  3A7A B;  5FO7 B;  1D5M C;  2RQX A;  4IAL A;  2QKI C;  1FYC A;  3DXJ C;  2R92 B;  4J6H A;  2M2L A;  2E74 C;  3RMH A;  3PUW A;  3K58 A;  3HOW B;  4XQQ A;  4A3G B;  5KYL A;  2NYZ D;  3C2P A;  1AN8 A;  2G9D A;  5A2Q E;  2XIW A;  4K8J A;  3GV6 A;  1A6X A;  5FLX L;  3BS1 A;  3KLS A;  4I7Z C;  4B9X A;  4IQZ A;  2D9U A;  1SYB A;  3BZD B;  5I6Y A;  1KDB A;  3S16 B;  1LTB D;  2PZU A;  4HTH A;  4FF4 A;  4A3D B;  3K0Y A;  1I4H A;  1GUT A;  4CKE A;  1BNZ A;  1WTP A;  1EQT A;  3LX0 A;  1Y8P B;  1OXS C;  2XWB B;  1WD0 A;  1U4P A;  3NTK A;  1SND A;  4FF1 A;  4H0L C;  5K36 H;  2L5T A;  1HQR D;  3J81 E;  3GTJ B;  4R8N A;  4LAA A;  5CV9 A;  4IUN A;  2R6G A;  1X3P A;  2SOB A;  2J4X A;  5JEA H;  3TBI B;  1EIH A;  2HDL A;  1K8O A;  2F0Q A;  3SXH A;  1ZYR C;  4C2M B;  1FNU A;  2R7Z B;  1LTI D;  3C1F A;  3J80 E;  2WKC A;  3MHB A;  4C3I G;  3DEP A;  1F2Y A;  1EY4 A;  2NB0 A;  3W3A A;  2AQ3 B;  4NKL A;  3T56 B;  4ODG A;  1BQQ T;  3C0O A;  3RUZ A;  3K5N A;  4G57 A;  4O42 A;  4E6I A;  4DN4 M;  4C3J B;  4M8A A;  5EGT A;  3GV3 A;  1IKM A;  4U68 A;  4DAV A;  1AEX A;  4X3U A;  5T1I A;  3M7N A;  2RBM A;  4PQX A;  2D62 A;  1SJH D;  1IYV A;  3TP8 A;  5CV4 A;  5K36 G;  1Y1V B;  2I46 A;  2PZW A;  3PUV A;  2KEE A;  2A6E D;  1B53 A;  2EY5 A;  5D65 A;  4Q5V A;  1PZJ D;  1TVX A;  2F0V A;  3UI2 A;  1JE4 A;  1SSO A;  4QMG A;  1E2W A;  1M4V A;  1JWM D;  3AMU A;  3LWU A;  1W6J A;  3TZU A;  2RDG A;  4XQN A;  1ONL A;  1CA5 A;  3EVQ A;  2EYM A;  4KN7 C;  1PFM A;  3QJY A;  5CGK A;  3H94 A;  1J8I A;  2WKD A;  1ZKO A;  1LT3 D;  1WTX A;  1ROD A;  1GHK A;  4KY5 A;  1SE4 A;  3GO5 A;  5T1G A;  2HDM A;  5I2Y A;  3QIA A;  4JBW A;  2O5I C;  3ITP A;  4XTC S;  2LY7 A;  4LJZ C;  1Z6H A;  5CV8 A;  1ENA A;  2AUJ D;  3OMC A;  5CMD A;  1STH A;  3NQI A;  2F0O A;  4XYQ A;  3SK6 A;  2LMC B;  3TP7 A;  5DNF A;  3I70 A;  2XNA C;  3KLS X;  1B1Z A;  2PCF B;  4P2C B;  2PPB C;  2WP8 J;  1DXM A;  5KNB A;  1GXD C;  2AWN A;  1SNP A;  2K5W A;  2ICI A;  2K03 A;  1C8C A;  3HP3 A;  1LTA D;  4X3S A;  3A54 A;  4ZUJ A;  2CVR A;  3C3L A;  1EL0 A;  4WJW A;  3JAM L;  1EOT A;  1ICW A;  2K6A A;  3GTP B;  1S5C D;  2NUC A;  2A5H A;  2M9V A;  3T51 B;  4OL7 A;  1GOZ A;  5CBE E;  1SNQ A;  4LK1 C;  2VB3 X;  4O1N A;  3KF8 A;  1SYF A;  3H0G B;  1XYI A;  5CC4 A;  2YU9 B;  5DM6 3;  3BVZ A;  3D4D A;  4RAU C;  1YNN D;  2WB1 B;  2JYO A;  2K5D A;  1S4Z A;  5I9P A;  4C3H B;  1LTT D;  2B8G A;  3RLF A;  2DY7 A;  3EQL C;  3OIQ A;  1PLF A;  4CJ0 B;  1UNS A;  3AB9 A;  4A3F B;  3QOL A;  4QUC A;  5BN3 A;  3GTG B;  1IL8 A;  3E5S A;  4XT1 B;  5A2Q L;  2SNS A;  1R4Q B;  1I4Q A;  2L12 A;  4IUT A;  3SK8 A;  4NP5 A;  2K33 A;  5ELC A;  2K04 A;  1LTS D;  2Z4H A;  3IFT A;  4S3S A;  4A93 B;  2LFN A;  1MSG A;  1TU2 B;  1B4O A;  3X3M A;  4RHS A;  3V2T A;  1TWA B;  5JOB A;  1IW7 C;  2F0K A;  2EY1 A;  3J81 L;  3D6C A;  3VR4 A;  1EY5 A;  1A2T A;  1EU3 A;  3G4N A;  3T16 A;  3URY A;  1A3U A;  2EDG A;  3HRZ C;  2F0G A;  1FGB D;  3PO2 B;  3J80 L;  2NVT B;  1DOM A;  3I73 A;  4FO2 A;  5EPK A;  4QUF A;  4IFD G;  2OT2 A;  1GUS A;  1AP0 A;  2N88 A;  1PTO B;  2H4O A;  1UAP A;  3E0J A;  3G4O A;  1SYE A;  1SYG A;  5TSS A;  3CRK C;  1CA6 A;  5C44 B;  1ENF A;  4EVO A;  4DFA A;  2MP1 A;  2NTT A;  1V43 A;  4XQJ A;  3M4Y A;  4K2K A;  1NR2 A;  2EJF C;  2A68 C;  2EYL A;  2BE5 C;  2L11 A;  1F2Z A;  5IT9 E;  1M8A A;  1SMY D;  1HA5 A;  4WOR A;  1R4P B;  4K6D A;  4BA1 I;  4RGN A;  1D5X C;  1WVL A;  4BBS B;  4L63 B;  1F2M A;  5BN5 A;  2F0I A;  2PW7 A;  1WTV A;  4FF3 A;  1CHP D;  4FNF A;  5JVH 3;  1CFM A;  3PIO 3;  3FPP A;  1S5E D;  1GUN A;  1I4P A;  5KND A;  2C9O A;  4V19 0;  3I72 A;  1L0X B;  2ENB A;  2KOL A;  4FF2 A;  1STB A;  2F0N A;  1D5Z C;  1EU4 A;  1HA6 A;  3MFG A;  1PTO C;  1HFN A;  1KNA A;  4KY7 A;  1WCM B;  3VR3 A;  3IKJ A;  5IGG A;  2RSO A;  1QG7 A;  5F2D A;  1EY7 A;  1JC7 A;  2K5Q A;  1STA A;  3FPU B;  4IFD J;  1SNO A;  3I3C A;  3FEW X;  4RH6 A;  3E6Z X;  5C0X G;  2A6H C;  1AZP A;  3MTS A;  1ET9 A;  1EY8 A;  1X3Q A;  3K6O A;  3HOU B;  1D2B A;  1ENC A;  5JVG 3;  1WTQ A;  3MFY A;  2F3W A;  4KD3 A;  1BXT A;  2NVQ B;  1Y8N B;  5EKK A;  1OXV A;  1LT4 D;  2B63 B;  2X6L A;  2BDN A;  4OO1 G;  4DNR B;  2X6G A;  3TDQ A;  1LAC A;  1SE2 A;  5I9O A;  1L0Y B;  4DXF A;  4F87 A;  1DON A;  5IIF A;  3K5L A;  1DD2 A;  3I4L A;  2JA5 B;  3K7A B;  4J8Q A;  2ID0 A;  2Z8L A;  1SXT A;  4ILW A;  3KUP A;  3GTQ B;  3OHX C;  2LKV A;  4RKL A;  1S5F D;  4G7Z C;  2F0D A;  3ONA B;  1PRT D;  2E2J B;  2IJ0 A;  2B2V C;  1F9P A;  5C0X J;  2L4N A;  5KGU A;  2B2Y C;  2RDF A;  2E75 C;  5D3I B;  3OWF A;  1OO9 B;  4A3E B;  1YNJ D;  1BOS A;  3FKI B;  1WTO A;  4KKS A;  1QCB D;  3BDC A;  1Z47 A;  2IL8 A;  4IUQ A;  1LAB A;  3WDN A;  2NN6 H;  2Y0S B;  1UUP A;  3OOC A;  4DAP A;  1MD2 D;  1GUO A;  3NUC A;  5EQ0 A;  2KVM A;  3TME A;  4HSP A;  3PV0 A;  2QDB A;  4HSV A;  2O2L D;  3C46 A;  5LL6 S;  3IFD A;  3FRP B;  1H9S B;  5CV7 A;  2L0C A;  4MN3 A;  1FD7 D;  3S9W A;  5M5W B;  5EKL A;  4FXK C;  3SDZ A;  4DF7 A;  3QB3 A;  1EIG A;  1G91 A;  4MHE A;  5CV6 A;  4EQN A;  4L6T B;  1EFI D;  1PRT F;  2FMM A;  5IOC A;  1Q12 A;  4DGZ A;  1V1P A;  5CYU A;  1MGS A;  5M3M B;  2ZXR A;  2QEJ C;  1TWG B;  2L55 A;  3NHH A;  1KDC A;  2GA4 B;  2NTS A;  4OGQ C;  1HUN A;  4KI0 A;  2KCN A;  2EYF A;  2EOT A;  3N6R A;  2NN6 G;  2PNR C;  3NBI A;  1EZ6 A;  3VA7 A;  2MGS A;  3S14 B;  3U9O A;  2AUK A;  1I4R A;  2OF1 A;  3HZX A;  2WAC A;  5NUC A;  2B2W C;  2K1B A;  4RHR A;  1LTR D;  4U67 3;  5IT9 L;  2Q8I B;  3OMG A;  1O78 A;  2NN6 I;  4RA8 A;  2F0L A;  5FOB B;  2ZXP A;  1EYA A;  2DY8 A;  3S15 B;  3T4A C;  2WII B;  1U9R A;  3GTO B;  2KJX A;  5I6W A;  4JK1 C;  4DXG A;  5DM7 3;  3S1M B;  4BS9 A;  1Z7T A;  1SBB B;  2JXM B;  2F0S A;  1JIC A;  3PUX A;  1WTR A;  5E4X A;  5ISR A;  1STY A;  2KHS A;  2R93 B;  2DNC A;  1DM0 B;  5ELD A;  4CJ1 B;  2RKS A;  1PRT B;  2R61 A;  4DNT B;  1TWC B;  2VB2 X;  2CHB D;  5DEH A;  1B9M A;  1STG A;  3RZO B;  1S5D D;  1E0B A;  1RJT A;  5D14 A;  3KLR A;  4EGV A;  3L7Z C;  3QWN A;  1II3 A;  1Q3L A;  1Q1B A;  1VF5 C;  3R93 A;  2VUM B;  2KA7 A;  1B50 A;  4IUR A;  1KAA A;  4RGM A;  2F0M A;  3K59 A;  3VR6 A;  5KRU A;  3EJI A;  4PMC A;  1SAP A;  1EEF D;  3MXU A;  3QG1 A;  4GZY C;  3MVV A;  2H1E A;  4UDU C;  3M4O B;  3TZD A;  1QIL A;  2F0H A;  1BCP D;  4ULL A;  1FNW A;  2F1M A;  1PDQ A;  2PZT A;  3NWS A;  5CBA E;  3BDL A;  3VYU A;  1BO0 A;  3PMF A;  4B9W A;  2A73 B;  1NCV A;  4CHT B;  1ZEQ X;  4EQO A;  3SE0 A;  3D4R A;  1I4X A;  4C3J G;  3MXG A;  3VR2 A;  2CW0 D;  1ET6 A;  2JEA I;  1QB5 D;  1I6H B;  1TWH B;  4PV1 C;  2Q8R E;  1A15 A;  1QJO A;  2JSO A;  2AWO A;  1ESR A;  1V1O A;  1B3A A;  2B2V A;  4ID6 A;  2FJ2 A;  1I6V C;  4HED A;  1CQF A;  1HTL D;  2B2Y A;  3J7Y W;  4MIU A;  1I50 B;  4XIG S;  2AQ2 B;  3PUZ A;  3GD7 A;  1A3T A;  5EBD A;  2EY6 A;  4A3I B;  3KBG A;  3S1R B;  3ZYY X;  5JPM C;  1SE3 A;  5KNC A;  3HKZ B;  3NPP A;  5I2X A;  4Z9C B;  4CGY B;  5HGT A;  2EYH A;  2ZT9 C;  1BCP F;  3PUY A;  1LV9 A;  2HCI A;  1SEB D;  5C4Z A;  4IFD H;  3NXW A;  4NMZ A;  4KY6 A;  3R2I A;  5E3F A;  4DAY A;  1H9K A;  4NW2 A;  3N52 A;  3LWE A;  3A55 A;  4G7O C;  3PO3 B;  2B39 A;  1HTP A;  3CKI B;  2QF7 A;  1ZXT A;  3QO2 A;  1C4Q A;  3SVM A;  5EKI A;  1PYW D;  1CK1 A;  1Q1E A;  2I07 B;  2MPM A;  3VYR A;  2EE1 A;  2L1B A;  4M1U B;  2HUG A;  4BBR B;  5J1Z A;  1QWY A;  3OIP A;  1PRE A;  4BY7 B;  1E2V A;  4K5W A;  3C1E A;  3AU7 A;  1HHV A;  1PXU A;  4F8M A;  3NE5 B;  1MSH A;  2EYJ A;  2R3Z A;  3S1N B;  2A6E C;  3DUZ A;  2Z4I A;  3MC0 B;  2JA6 B;  1VCI A;  4FXG C;  1UEA B;  4LMQ D;  3K5O A;  3NSW A;  1VMC A;  2KUM A;  2SEB D;  3U9S A;  2MUY A;  1BCP B;  3EA6 A;  3VYS A;  1RTO A;  4B08 A;  2IX1 A;  4IFD I;  1ILP A;  1TR5 A;  2XSC A;  5FO9 B;  4ZK9 B;  4ZKB B;  3NQT A;  3H91 A;  5C0X H;  3FMC A;  2V4D A;  2PW5 A;  4IZ8 A;  3SHL A;  1STE A;  4ZAI A;  2F4I A;  4XDX A;  4ZLT F;  3DHQ A;  1LLR D;  4C3H G;  1BBX C;  4RCN A;  4IUU A;  3P7J A;  1NUC A;  4WFN 3;  1QOH A;  1C48 A;  3V96 A;  1HRJ A;  5ELF A;  4WRD A;  1T5E A;  1Q90 A;  3RD4 A;  3CHB D;  2IW3 A;  4OO1 H;  5CV5 A;  2JA8 B;  4N9P A;  5AFW A;  4FVM A;  4Q0F A;  5J22 A;  2F0P A;  1VDZ A;  3R2T A;  2WIN B;  5LHY 1;  2A74 C;  2F0U A;  1EWH A;  1EWC A;  1PTO H;  4HAE A;  4ZRZ A;  3T13 A;  1O80 A;  2NVX B;  4EQP A;  5FO8 B;  5IOD A;  4X3K A;  3V05 A;  4CKB A;  5LL6 X;  3KK7 A;  4IUP A;  1BUV T;  4QF4 A;  2EZV A;  3ND9 A;  4KHV A;  2WV6 D;  4HN7 A;  2BA0 A;  2F3V A;  3S1Q B;  3HOX B;  1F2L A;  3NTI A;  1U4M A;  4L8J A;  5EPL A;  4OIK A;  2BCO A;  4RGO S;  1MI2 A;  1OXU A;  5C0X I;  4KJN A;  3OPO A;  1SFO B;  1IYU A;  3MXP A;  1TWF B;  2EJG C;  1ILQ A;  2IWH A;  5K5P A;  3EFX D;  3J7A V;  3A7L A;  2L9H A;  4TQU S;  4ZKC B;  1STN A;  1CI3 M;  1XX8 A;  1EYD A;  1SNC A;  2B2U C;  1YNN C;  2XVS A;  3D3R A;  3TSS A;  5DAU A;  4XT3 B;  5KEE A;  4HMI A;  1TQO A;  2HCC A;  5KYI A;  1TS4 A;  4KKT A;  2LS0 1;  1H9M A;  5EPJ A;  5A35 A;  3A8K E;  4QIW B;  1HPC A;  1SYC A;  2N55 A;  2G9H D;  4C3I B;  4OO1 I;  4G4K A;  1S5B D;  3ERQ A;  1RHP A;  3P75 A;  3G6J B;  3C0N A;  4K5X A;  3S2H B;  5G3L F;  4KN4 C;  3CU7 A;  4PMB A;  4TSS A;  1EZ8 A;  4KKU A;  1JQY D;  1WTW A;  1TT2 A;  2FFK B;  3DWQ A;  4KK7 A;  2AQ1 B;  2J7Z A;  5C3X A;  1Y8O B;  5I4D A;  2IPK D;  4A3M B;  1FR3 A;  1PZK D;  4H7B A;  1SYD A;  1CZG A;  4HMJ A;  3K57 A;  1F9S A;  4H44 C;  1PFN A;  3O13 A;  2F0W A;  1KLU D;  2ZXO A;  3Q22 A;  3NK9 A;  4C1N I;  3BDO A;  2K32 A;  1Y69 U;  4ABN A;  1TS3 A;  1TY0 A;  3MAQ A;  1NSN S;  5C3W A;  2K28 A;  5COR A;  4KHZ A;  2WAQ B;  1DYQ A;  3I91 A;  3VYT A;  4HCE A;  3T53 B;  1EY0 A;  4C56 C;  4F88 A;  1KTK A;  1SMY C;  2O4X A;  3OWE B;  1QNU A;  4I65 A;  3W2D A;  2Q8T A;  3HG9 A;  4K8I A;  3MXN A;  1PFB A;  5E4W C;  3SEB A;  1JOK A;  2D5D A;  4H13 C;  2X69 A;  5FK9 C;  4IN3 A;  2OXP A;  4UAI A;  1KAB A;  3I4M B;  1NR4 A;  5E1F A;  1K83 B;  3A56 A;  1IHZ A;  1IW7 D;  1U4L A;  1F77 A;  3Q6S A;  1JOQ A;  1HCZ A;  3NWT A;  4FYD A;  3KBX A;  1BDO A;  1NAP A;  3VR5 A;  3HEJ A;  1RTN A;  3TN2 A;  3R3O A;  1RDP D;  3J7A F;  3BVM A;  1CT1 D;  1SNM A;  1CHQ D;  3BYT B;  3HOV B;  1J9O A;  3BYY B;  1U4R A;  2EY2 A;  1GUW A;  3S2D B;  2FIN B;  3SK4 A;  5BN4 A;  2F0E A;  3FDT A;  1JOO A;  1JB3 A;  4DU9 A;  3HOY B;  2JE6 I;  5IGD A;  3K5M A;  1PZI D;  2EPB A;  1XXG A;  5KIX A;  5JEA G;  2HQE A;  1A2U A;  3SR1 A;  3GTL B;  3SK5 A;  5EBC A;  1PMR A;  4K14 A;  4A3B B;  4R8I A;  3D8G A;  2RDH A;  3F2U A;  2DNE A;  3HS0 C;  4OIJ A;  1G8Z D;  3TP6 A;  2BDO A;  3I90 A;  4CBV A;  2A68 D;  2BE5 D;  1D6E C;  1HXY D;  4BWG B;  4YIJ A;  1G2T A;  1WD1 A;  2E2D C;  2EYO A;  1VF7 A;  2KED A;  4HR7 B;  1TKW B;  1ESF A;  4A3J B;  1W6K A;  3DWP A;  3HGB A;  1HFG A;  1SJE D;  2B2U A;  4TKO B;  5JJZ A;  1VMP A;  3FVQ A;  1EY9 A;  2BA1 A;  2EJM A;  4DA2 A;  1TII D;  4KV6 A;  4ZYS A;  2B2T C;  2DN8 A;  1I3Q B;  2VXW A;  2KEC A;  1OXT A;  5JAV A;  2SNM A;  1H9J A;  1PRT C;  3OSO A;  1PTO D;  5JPN C;  1Z52 A;  2KQ3 A;  4FXD A;  3BG3 A;  1BR9 A;  1T5X D;  2QIL A;  2JA7 B;  2FHT A;  5D3D A;  4A3K B;  2NZ1 D;  1CTM A;  4BY1 B;  1EEI D;  1YNJ C;  4KMU C;  4BA2 I;  3TP5 A;  2A6H D;  4ZQ3 A;  1AW7 A;  3L9A X;  5FKA C;  1JCK B;  5JEA J;  1EYC A;  4QCL A;  4G7H C;  3PIP 3;  1B2T A;  3MZ5 A;  2IX0 A;  2FMC A;  4N9T A;  4XYO A;  2C5C A;  1QE6 A;  2Z1C A;  4KTA A;  3M3Y B;  2E2I B;  3H09 A;  2F0F A;  3ND8 A;  4RWS C;  3H3V C;  1MBY A;  5M5X B;  1X32 A;  4NDX A;  1HQM C;  3I8Z A;  5ELB A;  2BOS A;  3VA5 A;  2IT1 A;  5EJW A;  5M5Y B;  4XXE A;  1DOL A;  2CQA A;  4HCS A;  4J1M A;  4K6L A;  1JWS D;  1PTO F;  1DZ1 A;  5IGF A;  3ERO A;  3P1H A;  2E76 C;  3A8I E;  1BF4 A;  3GP7 A;  1V1P B;  4RGT A;  1A3V A;  4Y7N B;  5C3E B;  2KCC A;  5IGB A;  2PYK A;  5M3F B;  4KD4 A;  4AYB B;  2EYP A;  4RFB A;  1GHJ A;  1RCV D;  5FLX E;  3Q24 A;  2A69 D;  1FNV A;  1JR0 D;  2XRQ D;  4QB4 A;  2F0J A;  1JOR A;  4DK0 A;  3GQB A;  1F9R A;  1OXX K;  2XRS D;  1ML0 D;  2F03 A;  4R9W A;  1O7Y A;  3I4N B;  4FP5 D;  2TMP A;  3R8B A;  1H9R A;  3L3O C;  1B9N A;  1F9Q A;  1LO5 D;  2B2W A;  1QNK A;  3Q23 A;  4IUV A;  1AZQ A;  1D1I A;  1H9S A;  3CRL C;  5CR3 A;  3M7G A;  2RA4 A;  2RSN A;  1DJR D;  3D4W A;  2K05 A;  5C5M A;  3HOZ B;  4OHJ A;  1LTG D;  5ELE A;  3Q0A A;  1Y1W B;  4CJ2 C;  3D31 A;  3MA2 B;  4K5V A;  1G29 1;  2EVB A;  1DOK A;  1R9T B;  3DEO A;  1XWE A;  2J0T D;  1JWU D;  1GUG A;  3H6M A;  4PMW A;  2E2H B;  3DMU A;  5C5L A;  4C1N K;  1CQV A;  1ZYR D;  2ICE C;  1RKN A;  3P20 A;  3DWA A;  5C4X B;  1CZW A;  1D1K A;  1Q8I A;  1KNE A;  4ZUI A;  1EY6 A;  2XWJ B;  4TRD A;  3S17 B;  3QOJ A;  1DCZ A;  1CM9 A;  3IL8 A;  5C6A A;  1BCP C;  4KJO A;  2O5J C;  3MWY W;  2K7V A;  5IGC A;  1TS5 A;  3LNN A;  3IAY A;  2TSS A;  3MEH A;  4CKC A;  1RD9 D;  3WOF A;  2IX3 A;  2VNU D;  5G3L D;  1KLG D;  2CW0 C;  3D6W A;  3OW7 A;  3NTH A;  4X3T A;  1SDF A;  2B2T A;  2JP1 A;  2NWG A;  3GTK B;  4F7X A;  3M85 A;  3NP8 A;  1G6Z A;  1LT6 D;  2NBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...