1PRTB

The crystal structure of pertussis toxin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
total genus 44
structure length 196
sequence length 196
chains with identical sequence H
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1prtB01
1LTBD 1PRTB 2XN9C 1ENFA 4RGTA 1DYQA 4TSSA 1BXTA 2O2LD 2XRQD 3G4OA 1SE2A 4K6LA 3BYTB 1CHQD 2AQ3B 3R8BA 1LTID 5ELDA 4C56C 1CT1D 3BVZA 2IJ0A 4RGMA 2IPKD 1LT3D 4DXFA 2RDHA 3EFXD 4L63B 1TY0A 1BCPD 1PRTC 1D6EC 1LTAD 1LLRD 1PZJD 2CHBD 1F77A 1RCVD 1PTOC 5FK9C 3SEBA 3TSSA 1HQRD 3MC0B 1B1ZA 1KTKA 1UUPA 4RCOA 1FNUA 1I4RA 1TY2A 1JWMD 1HXYD 1G8ZD 1KLUD 2ICIA 2AQ1B 3BYYB 2QILA 4UDUC 1I4GA 4Z9CB 1S5FD 1EEID 5ELCA 1LTSD 1LO5D 1SEBD 1JCKB 1RD9D 1S5BD 1CQVA 1D5ZC 1PZID 1TS3A 1S5ED 1L0YB 3BVGA 1FD7D 2QEJC 1T5XD 3C0MA 1CK1A 1HA5A 4O1NA 1SXTA 1LT5D 1JWSD 3W2DA 2J4XA 1CHPD 3OWEB 1BCPC 4RHRA 1I4PA 1TS5A 1AN8A 2WV6D 1SBBB 1L0XB 1D5XC 1XTCD 1D5MC 1FNWA 1PRTF 2NTSA 1LTTD 1PZKD 3C0OA 1HTLD 1UNSA 1LTRD 4OHJA 2AQ2B 1ET6A 5D3IB 1RDPD 4RGOS 1BCPF 2XNAC 1I4XA 2RDGA 1EFID 3C0NA 5D3DA 1EEFD 1DJRD 1PTOD 3BVMA 2G9HD 1S5DD 5ELBA 5ELFA 1ESFA 1V1OA 1B44D 2Z8LA 1XXGA 3G4NA 3EA6A 1TS2A 1EU4A 1PTOH 1LTGD 1TS4A 4RHSA 3GP7A 1PYWD 3R2TA 1JR0D 5TSSA 1FNVA 4DXGA 1LT4D 1V1PA 2XRSD 3BZDB 1JQYD 2R61A 1SE4A 4RH6A 3V05A 1SE3A 4ZYSA 1I4QA 3DWPA 3KLSX 1V1PB 3R2IA 1AW7A 1S5CD 1PTOB 1BCPB 1SJHD 4RGNA 1LT6D 3DWQA 3URYA 3CHBD 3O13A 2SEBD 1EU3A 5FKAC 1I4HA 3MFGA 1JWUD 1KLGD 4BWGB 1Z52A 1EWCA 1SJED 2NTTA 1MD2D 5ELEA 1PRTD 1FGBD 1QILA 1STEA 4L6TB 1RF2D 5I4DA 1M4VA 3DWAA 1PREA 2TSSA 1PTOF 1GOZA 1ET9A 4RFBA
chains in the Genus database with same CATH superfamily
1E2WA 3K7AH 5M3FB 1X55A 1EWHA 5AJ3Q 1L1OC 3C3LA 2CVRA 2P5ZX 4DV2Q 2MUYA 3W3AA 2F4VQ 1N33Q 1EYCA 2MGSA 4C56C 4XDXA 2D62A 3QWNA 2NN6H 1LUZA 3PUYA 3NBHB 4IOCA 4A3MG 4UHVA 1FJGL 4GOPC 1MSGA 1LLRD 2FHTA 4GN5A 4A3EG 3GTOB 1VQOA 2SOBA 3MC0B 1ENCA 2VB3X 3I2ZA 5KGUA 2KQ3A 1KLUD 3G7LA 2A1AA 3I91A 3CCMA 2AUKA 2HIXA 5I2XA 4O0AA 4C3HH 3ULPA 4UP7A 4L5SA 3S1MH 1TKWB 3BDLA 1B2TA 4WORA 3V96A 1Q3LA 3CD6A 5DLQE 5G3LD 1E3PA 2ZM6Q 3UI2A 4XQJA 3S2DB 1NTGA 4A3KG 2KCCA 4QL5A 1LTTD 3FP9A 1IKLA 1HTLD 4HR7B 1UNSA 1LTRD 2EDGA 3AFQA 1VQIA 3MFYA 1CSQA 2KJXA 1D8LA 3JAME 2RKSA 3AFPA 4JI3L 4U673 1N9WA 1VQAA 2EJGC 3FKIH 4NB3A 1SMYC 5C3EG 4DGZA 1VQCA 1EQVA 3R2IA 1VCIA 4GKKQ 5NUCA 3OIPA 2RA4A 1JJCB 1EY7A 5IP7H 3M7GA 3T1YQ 2K5VA 2MFIA 1SNOA 3NE5B 3D6CA 3I70A 4L6TB 1YJNA 4DF7A 1V43A 5BN4A 1SMXA 2CWAA 1JOOA 3GD7A 5CORA 4MHEA 1VQGA 1CKNB 2CQAA 1JT8A 1X3GA 2TMPA 4RWSC 1DYQA 4RKBA 4A76A 4LF5Q 1VF7A 4KKTA 5J22A 3J81i 4AQYL 3C1EA 1QOHA 2KOLA 2NYZD 3PO2B 2ZXPA 1S72A 2PO4A 3D3RA 2CKZB 2XGTA 3FPPA 1RODA 4R4TA 1GUTA 4A3JH 1D7QA 1OTCA 1YNXA 3F2UA 4G7HC 3S15H 2VZAA 1IBKQ 4DNRB 1RCVD 3SEBA 3A8JE 4HMJA 2WKCA 3AB9A 1B1ZA 4JI7L 4BY1B 3KJPA 3KOJA 3S9WA 4KLKA 4DK6C 1S5FD 2B8GA 5ELCA 1M8AA 1K3RA 3S1RH 4J15A 2B8FA 1LO5D 1RD9D 1SNMA 2AHOB 3PIPA 2LSSA 5JEAH 1MBYA 2R6GA 1IW7C 1WVLA 1UAPA 1DOMA 5KNDA 3ND9A 1GUSA 4B3TL 1C7YA 1IYUA 2N8NA 1A2UA 2B2VA 4JI2Q 1GVPA 1XTCD 5G3LF 2E5LQ 3S2HB 4EQ5A 4KMUC 1EY4A 2B2YA 1ASZA 4P74A 1GJXA 2A69D 2ZJRA 4FP5D 3L9AX 3KBXA 4C3JG 4I7AA 4GLAC 1PA6A 1DONA 3T51B 1B53A 3BDOA 1E7ZA 1S5DD 4H7BA 3KJOA 1H95A 2JEBI 2MPMA 1PYWD 1O7LA 3SK8A 2EXZA 3CRKC 4KHZA 4ODGA 2F0NA 4BA2I 3AU7A 2NVYB 5K5PA 1I50B 4X65L 2R61A 4ZQ3A 2DY7A 4IN3A 3HOZG 4LAAA 2V1CC 1RKNA 1Q8IA 3K5NA 4FXDA 1QUQB 3BDCA 5M3MB 4H44C 2EVBA 4IPHA 4TKOB 5C4ZA 2UUAL 1H9RA 4PQXA 4OGQC 3ERSX 1OXVA 3QO2A 5ELEA 5BN3A 3K5LA 4KD4A 3J7AV 2K75A 4XT3B 1PYSB 4XQQA 2UUBQ 3NSWA 2QGQA 2PZTA 2A69C 4X3SA 3I4NB 1RJTA 3D4DA 1TU2B 2PMZE 2R7ZH 1U4MA 4A3CG 4RGTA 2L9HA 3RZOH 5JAVA 1SFOB 2XRQD 1YJ9A 3K7UC 4C3IG 2NZ1D 2EY5A 4AH6A 5IGCA 4HCEA 3QR8A 4LNQA 1EY6A 5FLMH 4RGMA 5LHY1 1VF5C 3U4ZA 2PQAA 4RG1A 4CJ2C 1CKMA 4JYAL 1FL0A 5EAYA 1XMOQ 3GTKB 1L1OA 3CU7A 3K81C 3KF8B 1KAWA 2CH4A 1I3QB 2Z4HA 5CMDA 3DLLA 4IUPA 2OWOA 2PNHA 1UUPA 4RMFA 1QNKA 1BKBA 2EYMA 4CHTB 2QILA 3GTGB 3HOUG 1MHWC 2HDLA 1JJ2A 4B9WA 1B9NA 2OTJA 3NENA 2N88A 1TS3A 1JC7A 3TS0A 1S5ED 4Q0FA 2EPBA 2IWHA 3T53B 3J80c 4NXNL 3CCUA 2K5QA 1EQRA 3KLRA 1JE4A 4A3DH 1PH3A 2E2IB 1HH2P 2F3IA 2A19A 3DEOA 4Y52H 3CXCA 1FYCA 2HQEA 2JN4A 4PMBA 3OPOA 1BR9A 2RQXA 1B9MA 4JVZA 3OOCA 1D5MC 5C0XI 3H6MA 5LL6X 1K73C 1N33L 1BNZA 3RD4A 1V9PA 4A3KB 1Y1WH 3KBGA 5AJ3L 1R9TB 2JP1A 2EYHA 4N9TA 4JV5L 1UE6A 3KF8A 4TVAB 2ZXOA 4HJ8A 4R1JA 1YHBA 3TZUA 2IX0A 1SN8A 2K28A 4JI6Q 1HNWQ 4LFAQ 1NUCA 2MP1A 4RAUC 4JV5Q 2L0CA 2E2DC 5FO9B 3VYRA 2EOTA 4A3MH 1IL8A 4RCNA 1IZ6A 1FNVA 2F4VL 2RF4A 1EYDA 4QF4A 3HOZB 2XRSD 3HEJA 1MJCA 1JQYD 3ITPA 4RH6A 1T5EA 3F2BA 2LXKA 1ML0D 2AWNA 5E1FA 1TWGH 4EQOA 4A3GH 4FF4A 3M4QA 3DUZA 5J1ZA 5IT9L 1KC8C 2I07B 3GTMB 1HR0L 3M4OH 1HRJA 4FVMA 2QF7A 4HEDA 3K7AB 5KRUA 5M3FH 2RCFA 1VS0A 4A3FB 3PIP3 1M4VA 2WP8J 3UDFA 1LM0A 3STBC 4IZ8A 4DU9A 2YU9H 1F9RA 3G4OA 5IYDH 1II3A 4UY8C 3KLWA 5AFWA 5I2YA 1GHJA 3MEFA 5ELOA 1LACA 3DXJC 4RKLA 2SDFA 3EBEA 3K57A 2RDHA 3GTJB 1GHKA 3C46A 2F0FA 5DAUA 2K5DA 1F77A 1WCMH 1PTOC 1LV9A 2EY6A 5IP7G 4OO1H 3CW2C 5EPJA 3VYSA 5IY0A 3CCVA 4GN3B 4CKEA 1P8LA 3NTHA 2Z9HA 3I4OA 3CCSA 1CA6A 1C8CA 2I5LX 3GTOH 1SDFA 1TIID 3EROA 1XNQL 5IT9E 1PZID 2AUJD 4A93G 1KNAA 1L0YB 1FD7D 2QEJC 1HA6A 1X3QA 4KY7A 3S2DH 1CK1A 1CSPA 4F87A 4X3TA 2KHIA 1QVFA 1A3VA 1GXDC 2Y0SE 3WDNA 3P20A 4G57A 1QJOA 3IFTA 4DNTB 1CHPD 4CDDC 4C1NK 2BE5C 1D2BA 1TWCB 3UDXA 5KNBA 3CCJA 1OXSC 1PZKD 1I50H 5F2DA 4B3RL 1WTRA 1Q12A 4O42A 4DAPA 3HS0C 4OWXB 1YIJA 1CM9A 5BR8Q 4JBWA 2K52A 1NY4A 1X3PA 2BDNA 2IW3A 4J1MA 1IBLL 1SFOH 3TN2A 3JC66 1DZ1A 2YTYA 3K58A 4B9XA 2KEEA 1JR0D 5EKIA 2JA5B 3R3OA 1Z9FA 1XTDA 4EX5A 3DWPA 1UEAB 2KBNA 1AW7A 3BS1A 2RSNA 3TMEA 3FKIB 1LT6D 4ID6A 1CA5A 2I0QA 1WJJA 4ZCKA 3I90A 2E75C 2Q2IA 2B2UC 5IWAQ 3B6YA 1IBMQ 4IALA 1G6ZA 2YTXA 2B39A 1HQMC 3K59A 1DD2A 5CV8A 2AMCB 3D31A 3D8GA 3DWAA 4X64L 3WOFA 1SE8A 1WI5A 2KCTA 4A3BG 3K0XA 4K0KQ 5K36H 4QUCA 5JJKA 1E0BA 1C48A 1X6OA 3E3XA 5C0XG 5M5YH 4A3JB 2BCOA 4JI4L 1HCZA 1CHQD 3R8BA 3STBD 1K8OA 4CDFC 1KAAA 1HUMA 2HHHQ 1NBWA 1XWEA 4HJ9A 1R4PB 3FRPB 4CJ0B 5GADC 1TY0A 2R7FA 3NTIA 3F1ZA 4JBMA 1F2ZA 1K83H 4DK0A 2I46A 2F0DA 4KHVA 3HP3A 2RBMA 1HR0W 2MNAA 1CZGA 3CF5A 4P71A 4HN7A 2KA7A 1TWFH 4MN3A 2X69A 4LUVA 2L4NA 2N55A 4MIUA 4CGYB 2NVQB 3MEHA 2NVTB 2NN6G 3PF5A 1HNXQ 4A3LG 4R4OA 1JJGA 2EE1A 3I73A 1BF4A 3S15B 1DGSA 1S40A 1VQFA 2E8GA 2KEDA 3N52A 4A3BB 2F0MA 3WOEA 4A4IA 4A3EB 1YNNC 4A3FH 4XT1B 2AQ2B 2Z4IA 1S4ZA 1WTXA 1EFID 3H91A 2EXDA 2QW7A 4R8IA 1I6HB 1B44D 3EA6A 4RHSA 3R2TA 5TSSA 3TP6A 5M3MH 2E2HB 5M5XH 2YYZA 4DAVA 3V05A 3H0GB 3U9OA 2ATWA 1I94Q 3URYA 5CV5A 4WFN3 1A0IA 4JI4Q 3GTPH 5I6YA 1YBYA 2A6EC 4JI8L 3GTQB 4V190 1EIGA 1SYBA 4QJFA 3A7LA 4X66Q 4PV1C 4HIDA 5GAHC 3MXGA 3X3MA 2K33A 4XQNA 2PZWA 3FKIG 4MTNA 4DR6Q 1Q1EA 4K8IA 4DPGA 2PYKA 4AYBE 5IWAL 2JA7B 2VQFQ 4NKLA 3QG1A 1A3UA 2AQ3B 2B2WC 4WJWA 1FR3A 1LTID 3RN2A 2JJQA 4TQUS 2K05A 1F9QA 4A75A 3G6JB 1V1QA 5HGTA 4JI7Q 4DXFA 2F3WA 3T56B 1X32A 3RR5A 5FO7B 1VQNA 5C5LA 3A5UA 2A74C 2NB0A 2AQ1B 1MI2A 5CV4A 1BBXC 2EYFA 1YNJC 4JC0A 1UWVA 4DV7L 1D1KA 1KNEA 5BN5A 3NQIA 2DNCA 3LGJA 1FVIA 1KHIA 1SNPA 5M3MG 1IYVA 1EY9A 2GVAA 3ER0A 4H13C 1R9TH 3GTKH 3K0YA 4OX9Q 4JOIC 3DEPA 3VR4A 2JK8A 2GN5A 5CBEE 2B63G 3Q22A 2JA6B 2MJ8A 4LF9Q 1AFPA 3C0NA 3DHQA 4LWCA 1DXMA 1EEFD 1PTOD 4IQZA 1Q90A 5ELFA 3SVMA 3J7ZC 4GOPB 2PPBC 3I4LA 4LF8L 4OO1I 5M5YB 2OQKA 4OWWB 4BY1H 2ASBA 4EQPA 3L2PA 3J81L 3GP7A 4HJAA 2ID0A 3PCOB 1X65A 1EYGA 2B2WA 3S1RB 2E2IH 2UU9L 3Q8DA 2OQ0A 3NHHA 3KFUA 1F2MA 4IURA 3J7YW 2UUBL 3PSIA 2B29A 5IYBH 3I4MG 1HTPA 4LF6L 1QE6A 3JAMi 3HOYG 3CAMA 1K28A 3Q0AA 2JQOA 4HSVA 4OX9L 2B2TC 2H4OA 3TP7A 4FO2A 1AP0A 3VDYA 4C3JH 1CTMA 2F3VA 1PH9A 4A3GB 3ERQA 4IFDJ 2KHSA 4IFDI 5E4WC 1Y14B 5FLXc 2BA1A 5KYLA 1IYJB 2UUCQ 5FOBB 4A3MB 4DR1L 3G6EA 4YHHQ 2G5DA 1U5KA 4JCVE 2F0PA 3K6OA 4FF3A 4KV6A 4K14A 2PW7A 3OSOA 1TWGB 4K6LA 3CCRA 2PMZB 1PYBA 3J81c 3PO3H 4BBSH 4JOIA 2UXBQ 3NELA 1PRTC 1H9SB 4NW2A 3C2PA 2WKDA 4DV5L 3W1GA 3UDGA 5D14A 4X6AH 4EQNA 3CQZB 3H3VH 2EIFA 1MGSA 1TY2A 4JG2A 3Q6SA 3LX0A 1K0RA 2ZM6L 3HKZG 1RHPA 1N32L 3MVVA 1VQPA 2HQLA 1WTOA 2F0EA 1A2TA 1RIPA 5C3EB 3M7NA 2ZTEA 1K8MA 1PV4A 4K8JA 3HKSA 1C9OA 2G9DA 4O1NA 4DR5L 4IJLA 3BJUA 4KTAA 2DGYA 3HOVG 3RZOB 1I6HH 1HJPA 4DK1A 2H1EA 3RMHA 2VW9A 3GTPB 3DM3A 5IYCG 3OWEB 2YTVA 1BCPC 1S3OA 3D0FA 5C44B 4A3FG 2WV6D 4DK3C 1L0XB 1AZPA 4JI0L 4Y7NH 4CJ1B 4HIOA 4P2CB 4KJNA 3BU2A 1RDPD 1GD7A 4CBVA 2UUCL 1KRTA 3J7AF 2JA5H 2HCIA 3JAMc 1ZXTA 2G9HD 1NR4A 3QJYA 4QCLA 3KUPA 4PMWA 2EY2A 5EPKA 1HFNA 1B4OA 2M00A 1OXTA 3ZYYX 4LF5L 1WTQA 2IHFA 2Q2HA 1E22A 1LT4D 1V1PA 4JYAQ 4A3JG 4DR4Q 1UE7A 2F0SA 1L2FA 4G7ZC 2F1MA 1V1PB 2NZOA 5HY6A 4PG3A 1SJHD 2ZJPA 1X54A 4DUZL 4OONA 5IP9H 4X62Q 4ZAIA 4A3DB 3ULLA 1I6VC 1G2TA 1A3TA 3HKZE 4BBRH 2XWJB 4WJ3M 2ZJQA 1PH6A 5C4HA 1SYEA 1U4LA 2F0GA 1YEZA 1WD0A 4A93B 4IPGA 5JEAG 1TWHH 3CRLC 3I4MB 4JI1L 1KDAA 3J80E 4BY7H 3HOWH 3L3OC 2RHQB 2NVXH 4YY3L 4LMQD 3F8TA 1O7ZA 1UE1A 5J3BA 1N34L 2R92H 3BYTB 4B3TQ 1C4QA 4K5VA 1HZBA 5ISRA 2Q2TA 3PGZA 2Q8TA 3SK4A 2R3ZA 2IJ0A 1EUJA 5IYCH 2F0VA 4LFBQ 3M85A 1FJGQ 3JAML 5M3FG 1D6EC 1AZQA 1PZJD 3H0GG 4P72A 5FK9C 3TSSA 3AQQA 3P7JA 1HQRD 1IKMA 1JORA 2VQEQ 4KHPL 4GOPA 4DV2L 1STHA 4FXGC 5KIXA 2QDBA 2X6LA 4KJOA 1VMPA 2C5CA 3VYTA 4KHPQ 1LTSD 3DM1A 2E5LL 2EYJA 1XJVA 2JA8B 1VQ4A 4X3KA 4X64Q 4GN4B 3P1HA 1LT5D 1TWAB 1PFSA 2MHVA 1QVGA 1U4PA 5C4XH 3L7ZC 1JICA 4UP8A 1NE3A 4X65Q 2ZXRA 1TS5A 3IRBA 2MO0A 1STYA 1PRTF 2NTSA 1U9RA 1YNJD 2EJMA 1UE5A 2RDFA 1MSHA 5H1SE 5IGBA 1Y8OB 4KKSA 1EIFA 5GQOA 1YHQA 4ZUIA 4LFCL 4A3CH 4FNFA 2B2VC 2E2JH 2Q2UA 2EYLA 3HOVB 2F0KA 5LL6S 1SYFA 1DJRD 1XNQQ 4A3BH 1EL0A 1KL9A 4CKCA 2K7VA 1PDQA 1HPCA 1PXUA 1JB7A 2CH4W 1KRSA 5CBAE 3BZDB 4R4IA 1B8AA 5IIFA 3KLSX 4DR2Q 4RGNA 1PTOB 3DWQA 2RHSB 1EOTA 1ZYRC 3CHBD 1J9OA 2XWBB 5C5MA 3S24A 4HSPA 3MFGA 1W6JA 5FJ8G 4BWGB 1VQBA 2XIWA 3R93A 1EWCA 1MD2D 3CMEA 4CDEC 1DM0B 4FF2A 3I8ZA 1CUKA 4I7ZC 4A3DG 3GTQH 1IBKL 4YWKA 4JI1Q 5CR3A 1Z6HA 1T9HA 4FXKC 3S1QB 3A5ZB 3FVQA 1HHVA 1K0SA 1CI3M 2QDLA 1I5FA 3A0JA 5IT9c 4B3MQ 3I55A 1IL2A 4K0KL 2LY7A 5JOBA 3MTSA 3M9BA 4MTKA 2QA4A 4RCOA 3RLFA 1VQ5A 1HZ9A 1AH9A 3PO2G 1N32Q 3FMCA 2ICIA 5IE8A 3BYYB 4Z9CB 2WAQG 2F0IA 2JA7H 3NP8A 1G51A 4GNXA 1SEBD 3ND8A 1D5ZC 5CGKA 5GAGC 1Z47A 4DV5Q 1EY0A 3OW7A 2VUMH 1ZEQX 4POGA 1STGA 2J4XA 1EYAA 3CC2A 2XSCA 3MXUA 5E4XA 4RHRA 1AN8A 1HR0Q 4QQBX 4DAYB 2K1BA 2VNUD 1P16A 3BZKA 2F4IA 1XX8A 4OHJA 2PW5A 4MNOA 4DR5Q 3L0OA 2O5IC 2XNAC 4PMCA 3TP8A 4YIJA 4HMIA 3BVMA 4NPSA 1J8IA 4X3UA 4H02A 2DY8A 4J6HA 3V2TA 2WB1E 1B7YB 5C0XJ 3GV3A 1KABA 4K6DA 4DN4M 4KN7C 4LFAL 3OW2A 4DR2L 1Y1WG 4X66L 5GROA 1Q7YC 3HFZB 4IUQA 2UXDL 3HKZB 1PH1A 3PV0A 2PCFB 1BCPB 3NPPA 3OIQA 2OXPA 1X9NA 1I4HA 2Q8RE 4QUFA 2GVBA 2CWPA 4YWMA 3EJIA 1VQKA 1Y8PB 4A3EH 1I3QH 3NQTA 1GUOA 2VS1A 1EWIA 1VQMA 2VQFL 1H9KA 5JVG3 3OTOQ 2R92G 3PO3B 1CQFA 4F7XA 4BBSB 3NWTA 3FPUB 1NMGA 4OELB 1XPRA 1W3SA 5ELDA 4AYBB 4B3ML 2E2HH 2OT2A 5M5XB 3GV6A 2I5HA 1RL2A 3RZDH 4GS3A 2Q8IB 2NN6I 1F2YA 3M3YB 3Q23A 1ICWA 4IO9A 1E2ZA 1BCPD 2ZTDA 4M8AA 4EVOA 3NTKA 1GO3E 1ILQA 1FGUA 4DV3Q 2PNRC 4LJZC 3E0EA 3A8IE 3I56A 4XYQA 1FNUA 2HD3A 3GTLB 2SNMA 1JWMD 1HXYD 3FEWX 4F8MA 4BY1G 4TRDA 4F88A 1S5BD 4ILWA 3HOWG 1K9MC 1EIYB 5C44H 4LF9L 1SMYD 1PH2A 1JOKA 1A15A 1N34Q 1BBUA 2A68C 2L11A 2O4XA 3TP5A 3W2DA 4DUYQ 2JYOA 1NAPA 5D65A 4YY3Q 5JVH3 2PQEA 1ONLA 2DN8A 1EY8A 4B3SQ 1A6XA 2WACA 1XYIA 1STBA 4HIMA 1CZWA 3AYHB 5EBCA 1QZHA 1QB5D 5C0XH 5I6WA 5ELBA 1HZCA 4Y7NB 2FINB 3G4NA 1TT2A 3S1NB 1EU4A 2EY1A 2YU9B 1DOKA 4LK1C 5I9OA 1IXRA 1VQ7A 4BBRB 1SE4A 4ZYSA 4NXNQ 3OTOL 1I4QA 3IKJA 3MZ5A 3SHLA 1VQDA 3S17H 2IY5B 4KY6A 2C35B 5IGDA 2A8VA 1R4QB 3G71A 1HNWL 2UXCL 3H15A 5JJZA 4IJHA 4FDBA 1JWUD 3RLNA 3HOXH 1GKHA 4BY7B 1SJED 1E1TA 1B50A 2HHHL 4AQYQ 1SAPA 5IYDG 4ZKCB 1SYGA 2KUMA 1AE3A 1WCMB 5DNFA 3VA5A 3C1FA 4RFBA 5COYA 4DV6L 2VQEL 4LF4Q 1SROA 2XN9C 5HGQA 2JA8G 1PH8A 2ZT9C 1PFMA 4A3GG 4OWTB 2LFNA 3NXWA 4DR1Q 3BVZA 4L5QA 4YHHL 5I9PA 4DV0L 3I4NH 2Y0SG 2KECA 5DM73 4B3SL 3PIOA 4IFDH 3IL8A 4A93H 4ALPA 4LUOA 5C4JB 1VDZA 3A56A 1X3EA 4C3JB 1PH5A 2UXCQ 4ULLA 1IW7D 3HOUB 1RTOA 4O2DA 2NVXB 4CKBA 4EGVA 1CKOA 1SNQA 3D6WA 5CYUA 1EEID 1GUGA 2PI2E 5CV7A 3VR5A 5LMUL 2UXBL 1K8GA 4IPDA 2F0JA 1SSOA 1CQVA 3BZCA 2KCMA 4JI5L 4HJ5A 3BG3A 3TDQA 1SRUA 2SNSA 3GDEA 1XMQQ 2K01A 3TZDA 2I5MX 3E9HA 3HOXG 4DV4Q 2VY3A 2J0TD 5ELNA 1PFBA 5GAEC 1ZYRD 1JOQA 3EN2A 2IX3A 1O7IA 5D3IB 4HCSA 1BCPF 3MWYW 3D4WA 1L1OB 4N9PA 5KEEA 3I72A 2UUAQ 3K5OA 2Z8LA 3H3VC 3M4OB 1CKNA 4DUYL 2K5WA 1KDCA 1PTOH 3KK7A 2R7DA 4H0LC 1IBML 2EZVA 1LTLA 1A63A 2E2JB 4DXGA 3HOVH 1LYLA 1U4RA 2PZUA 2WB1B 1SE3A 3LWUA 3VA7A 3QOJA 2VL6A 4HIKA 1NCVA 1B70B 3MXPA 1QNUA 1EU3A 3OWFA 4IFDG 5EBDA 5FKAC 2JA7G 3PQIA 1BDOA 2N3SA 4JPBW 5C3WA 2C9OA 4R4CA 1V8QA 5IGEA 3GTLH 2JA5G 4QGUA 4LF4L 3A7AB 3T4AC 3D4RA 4YWLA 3TQYA 1G91A 3GO5A 1O80A 4IUTA 4K2KA 3RZDB 2HT1A 1KQSA 2E74C 4GKJL 2H5XA 1VQ8A 1W2BA 4KKUA 3U9SA 2AKWB 2UXDQ 2X6GA 4UPAA 3NEMA 4JI6L 4BXXG 4UAIA 2E76C 1VQ9A 4LFCQ 2NVYH 4DNIA 1STNA 1Y1VB 1F9PA 1PFNA 5A35A 2RVLA 3M4PA 3E6ZX 2F0WA 5E7NA 3PMFA 4FF1A 5LMNL 3VR2A 4QB4A 1PLFA 3EFXD 3A74A 1LTAD 4YCUA 3RLOA 1VQJA 5IGGA 1G2SA 2CHBD 2JA9A 4APVA 4DV6Q 4NXML 2A6HC 3EIVA 1I4RA 1ILPA 1SYCA 3KDFB 4L5TA 4UDUC 4XYOA 1I4GA 3MAQA 3LNNA 3HOYH 1AE2A 1TWHB 4XIGS 2Y0SB 2Z1CA 5IYBG 3I4MH 3NUCA 3S1QH 4IPCA 5C6AA 1HFGA 1T5XD 3PUXA 1QUQA 3S14B 1SXTA 4ZLTF 3I4NG 3N6RA 1M90C 2D9UA 1ICFB 4IUUA 2R92B 4DAMA 1RTNA 4FYDA 3TRZA 4KN4C 1D5XC 1UEBA 3H09A 4A3IB 4B08A 4OEMB 1MJEA 4RGOS 1Y69U 1A8VA 1ESRA 3DMUA 3T1YL 5D3DA 3K5MA 3UE0A 5FO8B 2LKVA 3HOXB 2V4DA 1TS2A 4DV3L 1B3AA 1LABA 2B63H 3NBHA 1Q82C 5CV9A 4Q5VA 1J5EL 1EQQA 4AYBG 1VQLA 4KY5A 3VYUA 2PI2A 1AEXA 4WRDA 3OMCA 3O13A 4GKJQ 2F0UA 2FMCA 2FFKB 3H3VI 1NJIC 4XTCS 5LMNW 1PMRA 4PZ8A 2NZHA 1MIUA 1STEA 5I4DA 3MA2B 1QCBD 1KXLA 2TSSA 5FLMG 1PTOF 3EQLC 3UDIA 1EZ8A 2K04A 2D0OA 3PIO3 1NNXA 2IL8A 4ME5A 3TBIB 1LTBD 1B3QA 1TR5A 1ENFA 1QWYA 3G4SA 2WAQE 1K83B 1HNXL 4M1UB 5M5WH 1K3BC 2M9VA 2FJ2A 1YITA 2OTLA 1G291 2A5HA 5EPLA 2HDMA 1EQTA 3T16A 1CT1D 2Z6KA 5EKLA 2K50A 4JBKA 3J81j 2R93B 2D2CC 3J7A5 5JJIA 1EOVA 2OCEA 2BE5D 4N8X1 2NVTH 2K5HA 1N36L 2BH2A 4IUNA 2KHJA 1VMCA 3CCLA 3F2DA 4JI0Q 1KTKA 2F0OA 2D0PA 5FLXL 4P73A 2F03A 4YCWA 1H9MA 3I7FA 2EJFC 1K8AC 5C3XA 1WCMG 3BVGA 1WYDA 5JPNC 4BBRG 1YJWA 2CCZA 4RA8A 1EFWA 4N8FA 4QY7A 4JBJA 2MQHA 1I4PA 2RSOA 1SBBB 5CC4A 4G7OC 1TWFB 4R4QA 3C0OA 1J6QA 5BR8L 1BVSA 1Q81C 4DR7L 1H9JA 3CPFA 3SDZA 1Q1BA 3A54A 1I4XA 4OL7A 4ZK9B 2EYPA 4ME3A 3U4VA 4E6IA 3LWEA 1VQEA 2HCCA 3SK5A 1XXGA 1LTGD 4DFAA 3FHWA 4WJ4A 2DNEA 3SXHA 3PF4A 1Y8NB 2HIVA 1VQHA 1J5EQ 3S1NH 4LF7L 1TWCH 2VUMB 1IHZA 2WFWA 5T1GA 4DKAC 2NUCA 2IT1A 3AEVA 1I94L 1Y1VH 1Z52A 1PVOA 1XPOA 1EIHA 1OO9B 3S16H 5T1IA 4I65A 4X62L 3CPWA 2XVSA 1QVCA 4DV1Q 4LF6Q 2CQOA 3NWSA 1F9SA 1SR3A 1BOSA 1E2VA 4MZ9A 1KDBA 1YHAA 2A73B 3K80C 2L5TA 2O2LD 2QKIC 1F2LA 4DR3Q 1C0AA 3TREA 2R93G 2AWOA 4OO1G 2L12A 2BA0A 1O78A 1W6KA 3SK6A 1SYDA 1STAA 2XTIA 4GNXB 3HOYB 3IFDA 2Z0SA 3S2HH 2FXQA 3KLSA 4L63B 1SLJA 2WB1G 3ONAB 4LW1A 1X56A 4QIWE 2K5NA 4DV4L 1WTPA 4LF7Q 2K6AA 1M1KC 3TS2A 4V0BA 4DV7Q 1PHJA 2IX1A 1A62A 3S1MB 5A2QE 4A3IH 1JB3A 1HNZL 1EY5A 2WINB 3OHXC 5EJWA 3W1BA 3C0MA 3HOUH 1HA5A 2N49A 1GM5A 1BBWA 3MXNB 1X3FA 2A6HD 2O5JC 1OXUA 4BA1I 1DOLA 2B63B 2VB2X 4BXXH 3M3YH 1JE5A 2RCNA 2JXMB 5KYIA 1YI2A 2ES2A 1ESFA 1V1OA 3NBIA 1GUNA 5C44G 1SNDA 2ICEC 4NXMQ 5IGFA 2NVQH 3HOWB 4GLXA 5JEAJ 4B3RQ 4JI8Q 4HTHA 2R93H 4C3IB 2L1BA 4PZ6A 3NK9A 4S3SA 3RN5A 5CV6A 4DA2A 2EQSA 2F0QA 3PO2H 2SEBD 3TEHB 4OXPA 4GKKL 1SNCA 1KLGD 5M5WB 4OIJA 2NTTA 1E24A 5A2QL 3CCEA 1FGBD 4G4KA 4DR3L 4C2MH 3QB3A 1PREA 2F52A 3J80L 1ZKOA 4NMZA 2VUMG 3W5OA 1HNZQ 1IBLQ 1PRTB 1Q8KA 3AMUA 3CC4A 3CC7A 1BXTA 2NWGA 3H0GH 1SE2A 2F0TA 2K03A 3P75A 3ICEA 2PQAB 4LFBL 1OXXK 5DM63 2WAQB 2IPKD 1LT3D 4JI5Q 3S17B 4GZYC 4NDXA 5C3EH 2CW0D 5EGTA 3X3NA 1WD1A 5JJLA 1N36Q 3J80i 1BO0A 2WIIB 3OYYA 5DEHA 3VR6A 1TQOA 3KF6A 5IP9G 3MHBA 4NP5A 1Q46A 4ZKBB 1ASYA 2JA6G 3KF6B 4GLVB 2BDOA 2QCPX 5C4XG 1XMOL 2K14A 2ENBA 3IAYA 3CMAA 2R7ZG 4JI3Q 1G6PA 2UU9Q 3PUZA 3RNUA 4U68A 2JE6I 4YCVA 1JWSD 4DR7Q 2MO1A 1XMQL 1N8RC 3GTMH 4K5WA 1KIXA 3CQZH 1WFQA 4JK1C 4DAYA 4K2LA 2KCNA 3FDTA 4HJ7A 4P75A 1BQQT 3KDFA 3HRZC 2FMMA 2L55A 2N78A 5KNCA 4K5XA 5LMUQ 4C3HB 3RUZA 3WWVA 3HGBA 2BH8A 1CFMA 1YZ6A 2K32A 4CDCC 5C4JH 3M4YA 3CP0A 1TVXA 1WOCA 2KENA 3HZXA 3SR1A 1EZ6A 3S14H 3ZJYC 3E5SA 1GUWA 4DV0Q 2A68D 1D1IA 4UP9A 3H94A 1S5CD 1NMFA 2LXJA 4R8NA 1HZAA 2HUGA 3G48A 3SE0A 3PO3G 4BBSG 4KK7A 4A3LH 1QG7A 2ZTCA 1DCZA 4ABNA 2JA6H 1PRTD 1WTVA 2R7ZB 1VQ6A 2M2LA 4ZUJA 1YNND 4QIWB 1YVCA 2ALYB 3T1HQ 2BOSA 1GOZA 1H9SA 3T13A 4OIKA 5HURA 1NSNS 4JI2L 1Q86C 2DJFC 4TSSA 2JEAI 3CKIB 3OMGA 2CW0C 2A6ED 2JSOA 1XNRQ 2LMCB 3J81E 1MKHA 4C3HG 3E0JA 3KYHC 5EQ0A 5EKKA 4QMGA 2IHEA 4DV1L 1E1OA 2Z6KC 3GTGH 2J7ZA 4XXEA 4C1NI 5IODA 4JW0A 1Y1VG 1O7YA 4J8QA 5C4XB 1PH7A 2B2UA 4IUVA 2B3GA 4KD3A 3VR3A 4A3KH 1Y1WB 3EVQA 5J39A 2YV5A 5LMNQ 5FJ8H 1G8ZD 3A55A 4PZ7A 5FLXE 2VXWA 3E9IA 3UE1A 2L15A 1JCKB 4AIMA 1U0LA 3PUVA 2LS01 3U58A 3K8AA 4L8JA 1HUNA 1TXYA 3U50C 2B2YC 4HAEA 4GNXC 1NR2A 1ENAA 2K4KA 1FNWA 4KI0A 4C2MB 5JPMC 4BY7G 4C3IH 2Z6BA 2JA8H 1ET6A 3CCQA 4ZRZA 1PH4A 4LF8Q 2RDGA 2F0HA 3A8KE 2QEXA 1KD1C 5E3FA 2D5DA 2EYOA 3Q24A 4DUZQ 3T1HL 1TWAH 4R9WA 2NBFA 2DJGC 4DR4L 1TS4A 1QZGA 5K36G 2OF1A 4A3IG 4PNYA 2B2TA 4L5RC 1WTHA 3MXNA 3F2CA 4LUZA 1JMCA 2CFMA 3I3CA 3QIAA 2F0LA 3HG9A 4POFA 5IOCA 1XPUA 3HOZH 3PUWA 3SGIA 3GQBA 4BS9A 3GTJH 1WTWA 1QILA 1XNRL 4IOAA 1Z7TA 1RF2D 5L37A 5M9OA 4DR6L 2DUDA 3ULJA 2GA4B 2OEOA 1BUVT 1L0WA 2KVMA 3QOLA 1ET9A 3S16B
chains in the Genus database with same CATH topology
1E2WA 5M3FB 1EWHA 3C3LA 2CVRA 2MUYA 3W3AA 1EYCA 2MGSA 4C56C 4XDXA 2D62A 3QWNA 2NN6H 3PUYA 1MSGA 1LLRD 2FHTA 3GTOB 2SOBA 3MC0B 1ENCA 2VB3X 5KGUA 2KQ3A 1KLUD 3G7LA 3I91A 2AUKA 5I2XA 1TKWB 3BDLA 1B2TA 4WORA 3V96A 1Q3LA 5G3LD 3UI2A 4XQJA 3S2DB 2KCCA 1LTTD 1IKLA 1HTLD 4HR7B 1UNSA 1LTRD 2EDGA 3MFYA 2KJXA 3JAME 2RKSA 4U673 2EJGC 1SMYC 4DGZA 1EQVA 3R2IA 1VCIA 5NUCA 3OIPA 2RA4A 1EY7A 3M7GA 1SNOA 3NE5B 3D6CA 3I70A 4L6TB 4DF7A 1V43A 5BN4A 1JOOA 3GD7A 5CORA 4MHEA 2CQAA 2TMPA 4RWSC 1DYQA 4RKBA 1VF7A 4KKTA 5J22A 3C1EA 1QOHA 2KOLA 2NYZD 3PO2B 2ZXPA 2PO4A 3D3RA 3FPPA 1RODA 1GUTA 3F2UA 4G7HC 4DNRB 1RCVD 3SEBA 3A8JE 4HMJA 2WKCA 3AB9A 1B1ZA 4BY1B 3S9WA 1S5FD 2B8GA 5ELCA 1M8AA 2B8FA 1LO5D 1RD9D 1SNMA 5JEAH 1MBYA 2R6GA 1IW7C 1WVLA 1UAPA 1DOMA 5KNDA 3ND9A 1GUSA 1IYUA 1A2UA 2B2VA 1XTCD 5G3LF 3S2HB 4KMUC 1EY4A 2B2YA 1GJXA 2A69D 4FP5D 3L9AX 3KBXA 4C3JG 1DONA 3T51B 1B53A 3BDOA 4H7BA 1S5DD 2JEBI 2MPMA 1PYWD 1O7LA 3SK8A 2EXZA 3CRKC 4KHZA 4ODGA 2F0NA 4BA2I 3AU7A 2NVYB 5K5PA 1I50B 2R61A 4ZQ3A 2DY7A 4IN3A 4LAAA 1RKNA 1Q8IA 3K5NA 4FXDA 3BDCA 5M3MB 4H44C 2EVBA 5C4ZA 4TKOB 1H9RA 4PQXA 4OGQC 1OXVA 3QO2A 5ELEA 5BN3A 3K5LA 4KD4A 3J7AV 4XT3B 4XQQA 3NSWA 2PZTA 2A69C 4X3SA 3I4NB 1RJTA 3D4DA 1TU2B 1U4MA 4RGTA 2L9HA 5JAVA 1SFOB 2XRQD 4C3IG 2NZ1D 2EY5A 5IGCA 4HCEA 1EY6A 4RGMA 5LHY1 1VF5C 4CJ2C 3GTKB 3CU7A 1I3QB 2Z4HA 5CMDA 4IUPA 1UUPA 1QNKA 2EYMA 4CHTB 2QILA 3GTGB 2HDLA 4B9WA 1B9NA 2N88A 1TS3A 1JC7A 1S5ED 4Q0FA 2EPBA 2IWHA 3T53B 2K5QA 3KLRA 1JE4A 2E2IB 3DEOA 1FYCA 2HQEA 4PMBA 3OPOA 1BR9A 2RQXA 1B9MA 3OOCA 1D5MC 5C0XI 3H6MA 5LL6X 1BNZA 3RD4A 4A3KB 3KBGA 1R9TB 2JP1A 2EYHA 4N9TA 3KF8A 2ZXOA 3TZUA 2IX0A 2K28A 1NUCA 2MP1A 4RAUC 2L0CA 5FO9B 2E2DC 3VYRA 2EOTA 1IL8A 4RCNA 1FNVA 3HOZB 1EYDA 4QF4A 2XRSD 3HEJA 1JQYD 3ITPA 4RH6A 1T5EA 1ML0D 2AWNA 5E1FA 4EQOA 4FF4A 5IT9L 3DUZA 5J1ZA 2I07B 3GTMB 1HRJA 4FVMA 2QF7A 4HEDA 3K7AB 5KRUA 4A3FB 3PIP3 1M4VA 2WP8J 4IZ8A 4DU9A 1F9RA 3G4OA 1II3A 5AFWA 5I2YA 1GHJA 1LACA 3DXJC 4RKLA 2SDFA 3K57A 2RDHA 3GTJB 1GHKA 3C46A 2F0FA 5DAUA 2K5DA 1F77A 1PTOC 1LV9A 2EY6A 4OO1H 5EPJA 3VYSA 4CKEA 3NTHA 1CA6A 1C8CA 1SDFA 1TIID 3EROA 5IT9E 1PZID 2AUJD 1KNAA 1L0YB 1FD7D 2QEJC 1HA6A 1X3QA 4KY7A 1CK1A 4F87A 4X3TA 1A3VA 3WDNA 1GXDC 3P20A 4G57A 1QJOA 3IFTA 4DNTB 1CHPD 4C1NK 2BE5C 1D2BA 1TWCB 5KNBA 1OXSC 1PZKD 5F2DA 1WTRA 1Q12A 4O42A 4DAPA 3HS0C 1CM9A 4JBWA 1X3PA 2BDNA 2IW3A 4J1MA 1DZ1A 3TN2A 3K58A 4B9XA 2KEEA 1JR0D 5EKIA 2JA5B 3R3OA 3DWPA 1UEAB 1AW7A 3BS1A 2RSNA 3TMEA 3FKIB 1LT6D 4ID6A 1CA5A 3I90A 2E75C 2B2UC 4IALA 1G6ZA 2B39A 1HQMC 3K59A 1DD2A 5CV8A 3DWAA 3D31A 3D8GA 3WOFA 5K36H 4QUCA 1E0BA 1C48A 5C0XG 4A3JB 2BCOA 1HCZA 1CHQD 3R8BA 1K8OA 1KAAA 1HUMA 1XWEA 1R4PB 3FRPB 4CJ0B 1TY0A 3NTIA 1F2ZA 4DK0A 2I46A 2F0DA 4KHVA 3HP3A 2RBMA 1CZGA 4HN7A 2KA7A 4MN3A 2X69A 2L4NA 2N55A 4MIUA 4CGYB 2NVQB 3MEHA 2NVTB 2NN6G 2EE1A 3I73A 1BF4A 3S15B 2KEDA 3N52A 4A3BB 2F0MA 3WOEA 4A3EB 1YNNC 4XT1B 2AQ2B 2Z4IA 1S4ZA 1WTXA 1EFID 3H91A 4R8IA 1I6HB 1B44D 3EA6A 4RHSA 3R2TA 5TSSA 3TP6A 2E2HB 2YYZA 4DAVA 3V05A 3H0GB 3U9OA 3URYA 5CV5A 4WFN3 5I6YA 2A6EC 3GTQB 4V190 1EIGA 1SYBA 3A7LA 4PV1C 3MXGA 3X3MA 2K33A 4XQNA 2PZWA 1Q1EA 4K8IA 2PYKA 2JA7B 4NKLA 3QG1A 1A3UA 2AQ3B 2B2WC 4WJWA 1FR3A 1LTID 4TQUS 2K05A 1F9QA 3G6JB 5HGTA 4DXFA 2F3WA 3T56B 1X32A 5FO7B 5C5LA 2A74C 2NB0A 2AQ1B 1MI2A 5CV4A 1BBXC 2EYFA 1YNJC 1D1KA 1KNEA 5BN5A 3NQIA 2DNCA 1SNPA 1IYVA 1EY9A 4H13C 3K0YA 3DEPA 3VR4A 5CBEE 3Q22A 2JA6B 2MJ8A 1AFPA 3C0NA 3DHQA 2PPBC 5ELFA 1DXMA 1EEFD 1PTOD 1Q90A 4IQZA 3SVMA 4OO1I 3I4LA 5M5YB 4EQPA 3J81L 3GP7A 2ID0A 2B2WA 3S1RB 3NHHA 1F2MA 4IURA 3J7YW 1HTPA 1QE6A 3Q0AA 4HSVA 2B2TC 2H4OA 3TP7A 4FO2A 1AP0A 1CTMA 2F3VA 4A3GB 4IFDJ 3ERQA 2KHSA 4IFDI 5E4WC 2BA1A 5KYLA 5FOBB 4A3MB 2F0PA 3K6OA 4FF3A 4KV6A 4K14A 2PW7A 3OSOA 1TWGB 4K6LA 2PMZB 1PRTC 1H9SB 4NW2A 3C2PA 2WKDA 5D14A 4EQNA 3CQZB 1MGSA 1TY2A 3Q6SA 3LX0A 1RHPA 3MVVA 1WTOA 2F0EA 1A2TA 5C3EB 3M7NA 1K8MA 4K8JA 2G9DA 4O1NA 4KTAA 3RZOB 4DK1A 2H1EA 3RMHA 3GTPB 3OWEB 5C44B 1BCPC 2WV6D 1L0XB 1AZPA 4CJ1B 4P2CB 4KJNA 1RDPD 4CBVA 3J7AF 2HCIA 1ZXTA 2G9HD 1NR4A 3QJYA 4QCLA 3KUPA 4PMWA 2EY2A 5EPKA 1HFNA 1B4OA 2M00A 1OXTA 3ZYYX 1WTQA 1LT4D 1V1PA 2F0SA 4G7ZC 2F1MA 1V1PB 1SJHD 4ZAIA 4A3DB 1I6VC 1G2TA 1A3TA 2XWJB 5C4HA 1SYEA 1U4LA 2F0GA 1WD0A 4A93B 5JEAG 3CRLC 3I4MB 1KDAA 3J80E 3L3OC 4LMQD 1O7ZA 3BYTB 1C4QA 4K5VA 5ISRA 2Q8TA 3SK4A 2R3ZA 2IJ0A 2F0VA 3M85A 3JAML 1D6EC 1AZQA 1PZJD 5FK9C 3TSSA 3P7JA 1HQRD 1IKMA 1JORA 1STHA 4FXGC 5KIXA 2QDBA 2X6LA 4KJOA 1VMPA 2C5CA 3VYTA 1LTSD 3DM1A 2EYJA 2JA8B 4X3KA 3P1HA 1LT5D 1TWAB 2MHVA 1U4PA 3L7ZC 1JICA 2ZXRA 1TS5A 1STYA 1PRTF 2NTSA 1U9RA 1YNJD 2EJMA 2RDFA 1MSHA 5IGBA 1Y8OB 4KKSA 4ZUIA 4FNFA 2B2VC 3HOVB 2EYLA 2F0KA 5LL6S 1SYFA 1DJRD 1EL0A 4CKCA 2K7VA 1PDQA 1HPCA 1PXUA 5CBAE 3BZDB 5IIFA 3KLSX 4RGNA 1PTOB 3DWQA 1EOTA 1ZYRC 3CHBD 1J9OA 2XWBB 5C5MA 4HSPA 3MFGA 1W6JA 4BWGB 2XIWA 3R93A 1EWCA 1MD2D 1DM0B 4FF2A 3I8ZA 4I7ZC 5CR3A 1Z6HA 4FXKC 3S1QB 3FVQA 1HHVA 1CI3M 2LY7A 5JOBA 3MTSA 4RCOA 3RLFA 3FMCA 2ICIA 3BYYB 4Z9CB 2F0IA 3NP8A 1SEBD 3ND8A 1D5ZC 5CGKA 1Z47A 1EY0A 3OW7A 1ZEQX 1STGA 2J4XA 1EYAA 2XSCA 3MXUA 5E4XA 4RHRA 1AN8A 2K1BA 2VNUD 2F4IA 1XX8A 4OHJA 2PW5A 2O5IC 2XNAC 4PMCA 3TP8A 4YIJA 4HMIA 3BVMA 1J8IA 4X3UA 2DY8A 4J6HA 3V2TA 5C0XJ 3GV3A 1KABA 4K6DA 4DN4M 4KN7C 4IUQA 3HKZB 3PV0A 2PCFB 1BCPB 3NPPA 3OIQA 2OXPA 1I4HA 2Q8RE 4QUFA 3EJIA 1Y8PB 3NQTA 1GUOA 1H9KA 5JVG3 3PO3B 1CQFA 4F7XA 4BBSB 3NWTA 3FPUB 5ELDA 4AYBB 2OT2A 5M5XB 3GV6A 2Q8IB 2NN6I 1F2YA 3M3YB 3Q23A 1ICWA 1E2ZA 1BCPD 4M8AA 4EVOA 3NTKA 1ILQA 2PNRC 4LJZC 3A8IE 3GTLB 4XYQA 1FNUA 2SNMA 1JWMD 1HXYD 3FEWX 4F8MA 4TRDA 4F88A 1S5BD 4ILWA 1SMYD 1JOKA 1A15A 2A68C 2L11A 2O4XA 3TP5A 3W2DA 2JYOA 1NAPA 5D65A 5JVH3 2PQEA 1ONLA 2DN8A 1EY8A 1A6XA 2WACA 1XYIA 1STBA 1CZWA 5EBCA 1QB5D 5C0XH 5I6WA 5ELBA 4Y7NB 2FINB 3G4NA 1TT2A 3S1NB 1EU4A 2EY1A 2YU9B 1DOKA 4LK1C 5I9OA 4BBRB 1SE4A 4ZYSA 1I4QA 3IKJA 3MZ5A 3SHLA 4KY6A 5IGDA 1R4QB 5JJZA 1JWUD 4BY7B 1SJED 1B50A 1SAPA 4ZKCB 1SYGA 2KUMA 1WCMB 5DNFA 3VA5A 3C1FA 4RFBA 5COYA 2XN9C 2ZT9C 1PFMA 2LFNA 3NXWA 3BVZA 5I9PA 2KECA 5DM73 4IFDH 3IL8A 5C4JB 1VDZA 3A56A 4C3JB 4ULLA 1IW7D 3HOUB 1RTOA 2NVXB 4CKBA 4EGVA 3D6WA 1SNQA 5CYUA 1EEID 1GUGA 5CV7A 3VR5A 2F0JA 1SSOA 1CQVA 3BG3A 3TDQA 2SNSA 2K01A 3TZDA 2J0TD 1PFBA 1ZYRD 1JOQA 2IX3A 5D3IB 4HCSA 1BCPF 3MWYW 3D4WA 5KEEA 4N9PA 3I72A 3K5OA 3H3VC 2Z8LA 3M4OB 2K5WA 1KDCA 1PTOH 3KK7A 4H0LC 2EZVA 2E2JB 4DXGA 1U4RA 2PZUA 2WB1B 1SE3A 3LWUA 3VA7A 3QOJA 1NCVA 3MXPA 1QNUA 1EU3A 3OWFA 4IFDG 5EBDA 5FKAC 5C3WA 1BDOA 2C9OA 1V8QA 5IGEA 3A7AB 3T4AC 3D4RA 1G91A 3RZDB 3GO5A 1O80A 4IUTA 4K2KA 2E74C 4KKUA 3U9SA 2X6GA 4UAIA 2E76C 1STNA 1Y1VB 1F9PA 1PFNA 5A35A 2RVLA 3E6ZX 2F0WA 3PMFA 4FF1A 3VR2A 4QB4A 1PLFA 3EFXD 1LTAD 5IGGA 1G2SA 2CHBD 2A6HC 1I4RA 1ILPA 1SYCA 4UDUC 4XYOA 1I4GA 3MAQA 3LNNA 1TWHB 4XIGS 2Y0SB 2Z1CA 3NUCA 5C6AA 1HFGA 1T5XD 3PUXA 3S14B 1SXTA 4ZLTF 3N6RA 2D9UA 4IUUA 2R92B 1RTNA 4FYDA 4KN4C 1D5XC 3H09A 4A3IB 4B08A 4RGOS 1Y69U 1ESRA 3DMUA 5D3DA 3K5MA 5FO8B 2LKVA 3HOXB 2V4DA 1TS2A 1B3AA 1LABA 3NBHA 5CV9A 4Q5VA 4KY5A 3VYUA 1AEXA 4WRDA 3OMCA 3O13A 2F0UA 2FMCA 2FFKB 4XTCS 1PMRA 1STEA 5I4DA 3MA2B 1QCBD 2TSSA 1PTOF 3EQLC 1EZ8A 2K04A 3PIO3 3TBIB 4ME5A 2IL8A 1LTBD 1TR5A 1ENFA 1QWYA 1K83B 4M1UB 2M9VA 2FJ2A 1G291 2A5HA 5EPLA 2HDMA 1EQTA 3T16A 1CT1D 5EKLA 2R93B 2D2CC 2BE5D 4IUNA 1VMCA 1KTKA 2F0OA 5FLXL 2F03A 1H9MA 2EJFC 5C3XA 3BVGA 5JPNC 4RA8A 1I4PA 2RSOA 1SBBB 5CC4A 4G7OC 1TWFB 3C0OA 1H9JA 3SDZA 1Q1BA 3A54A 1I4XA 4OL7A 4ZK9B 2EYPA 4E6IA 3LWEA 2HCCA 3SK5A 1XXGA 1LTGD 4DFAA 2DNEA 3SXHA 1Y8NB 2VUMB 1IHZA 5T1GA 2NUCA 2IT1A 1Z52A 1EIHA 1OO9B 5T1IA 4I65A 2XVSA 3NWSA 1F9SA 1BOSA 1E2VA 1KDBA 2A73B 2L5TA 2O2LD 2QKIC 1F2LA 2AWOA 4OO1G 2L12A 2BA0A 1O78A 1W6KA 3SK6A 1SYDA 1STAA 3HOYB 3IFDA 3KLSA 4L63B 3ONAB 1WTPA 2K6AA 4V0BA 2IX1A 3S1MB 5A2QE 1JB3A 1EY5A 2WINB 3OHXC 5EJWA 3C0MA 1HA5A 2A6HD 2O5JC 1OXUA 4BA1I 1DOLA 2B63B 2VB2X 2JXMB 5KYIA 1ESFA 1V1OA 3NBIA 1GUNA 1SNDA 2ICEC 5IGFA 3HOWB 5JEAJ 4HTHA 4C3IB 2L1BA 3NK9A 4S3SA 5CV6A 4DA2A 2F0QA 2SEBD 1SNCA 1KLGD 5M5WB 4OIJA 2NTTA 5A2QL 1FGBD 4G4KA 3QB3A 1PREA 3J80L 1ZKOA 4NMZA 1PRTB 3AMUA 1BXTA 2NWGA 1SE2A 2F0TA 2K03A 3P75A 1OXXK 5DM63 2WAQB 2IPKD 1LT3D 3S17B 4GZYC 4NDXA 2CW0D 5EGTA 3X3NA 1WD1A 1BO0A 2WIIB 5DEHA 3VR6A 1TQOA 3MHBA 4NP5A 4ZKBB 2BDOA 2QCPX 2ENBA 3IAYA 3PUZA 4U68A 2JE6I 1JWSD 4K5WA 4JK1C 4DAYA 4K2LA 2KCNA 3FDTA 1BQQT 3HRZC 2FMMA 2L55A 5KNCA 4K5XA 4C3HB 3RUZA 3HGBA 1CFMA 2K32A 3M4YA 1TVXA 3HZXA 3SR1A 1EZ6A 1GUWA 3E5SA 2A68D 1D1IA 3H94A 1S5CD 4R8NA 2HUGA 3SE0A 4KK7A 1QG7A 1DCZA 4ABNA 1PRTD 1WTVA 2R7ZB 2M2LA 4ZUJA 1YNND 4QIWB 2BOSA 1GOZA 1H9SA 3T13A 4OIKA 5HURA 1NSNS 4TSSA 2JEAI 3CKIB 3OMGA 2CW0C 2A6ED 2JSOA 2LMCB 3J81E 4C3HG 3E0JA 5EQ0A 5EKKA 4QMGA 2J7ZA 4C1NI 4XXEA 5IODA 1O7YA 4J8QA 5C4XB 2B2UA 4IUVA 4KD3A 3VR3A 1Y1WB 3EVQA 5J39A 1G8ZD 3A55A 5FLXE 2VXWA 1JCKB 3PUVA 2LS01 4L8JA 1HUNA 2B2YC 4HAEA 1NR2A 1ENAA 1FNWA 4KI0A 4C2MB 5JPMC 1ET6A 4ZRZA 2RDGA 2F0HA 3A8KE 5E3FA 2D5DA 2EYOA 3Q24A 4R9WA 2NBFA 1TS4A 5K36G 2OF1A 4PNYA 2B2TA 3MXNA 3I3CA 3QIAA 2F0LA 3HG9A 5IOCA 3PUWA 3GQBA 4BS9A 1WTWA 1QILA 1Z7TA 1RF2D 5M9OA 2GA4B 2OEOA 1BUVT 2KVMA 3QOLA 1ET9A 3S16B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB D;  1PRT B;  2XN9 C;  1ENF A;  4RGT A;  1DYQ A;  4TSS A;  1BXT A;  2O2L D;  2XRQ D;  3G4O A;  1SE2 A;  4K6L A;  3BYT B;  1CHQ D;  2AQ3 B;  3R8B A;  1LTI D;  5ELD A;  4C56 C;  1CT1 D;  3BVZ A;  2IJ0 A;  4RGM A;  2IPK D;  1LT3 D;  4DXF A;  2RDH A;  3EFX D;  4L63 B;  1TY0 A;  1BCP D;  1PRT C;  1D6E C;  1LTA D;  1LLR D;  1PZJ D;  2CHB D;  1F77 A;  1RCV D;  1PTO C;  5FK9 C;  3SEB A;  3TSS A;  1HQR D;  3MC0 B;  1B1Z A;  1KTK A;  1UUP A;  4RCO A;  1FNU A;  1I4R A;  1TY2 A;  1JWM D;  1HXY D;  1G8Z D;  1KLU D;  2ICI A;  2AQ1 B;  3BYY B;  2QIL A;  4UDU C;  1I4G A;  4Z9C B;  1S5F D;  1EEI D;  5ELC A;  1LTS D;  1LO5 D;  1SEB D;  1JCK B;  1RD9 D;  1S5B D;  1CQV A;  1D5Z C;  1PZI D;  1TS3 A;  1S5E D;  1L0Y B;  3BVG A;  1FD7 D;  2QEJ C;  1T5X D;  3C0M A;  1CK1 A;  1HA5 A;  4O1N A;  1SXT A;  1LT5 D;  1JWS D;  3W2D A;  2J4X A;  1CHP D;  3OWE B;  1BCP C;  4RHR A;  1I4P A;  1TS5 A;  1AN8 A;  2WV6 D;  1SBB B;  1L0X B;  1D5X C;  1XTC D;  1D5M C;  1FNW A;  1PRT F;  2NTS A;  1LTT D;  1PZK D;  3C0O A;  1HTL D;  1UNS A;  1LTR D;  4OHJ A;  2AQ2 B;  1ET6 A;  5D3I B;  1RDP D;  4RGO S;  1BCP F;  2XNA C;  1I4X A;  2RDG A;  1EFI D;  3C0N A;  5D3D A;  1EEF D;  1DJR D;  1PTO D;  3BVM A;  2G9H D;  1S5D D;  5ELB A;  5ELF A;  1ESF A;  1V1O A;  1B44 D;  2Z8L A;  1XXG A;  3G4N A;  3EA6 A;  1TS2 A;  1EU4 A;  1PTO H;  1LTG D;  1TS4 A;  4RHS A;  3GP7 A;  1PYW D;  3R2T A;  1JR0 D;  5TSS A;  1FNV A;  4DXG A;  1LT4 D;  1V1P A;  2XRS D;  3BZD B;  1JQY D;  2R61 A;  1SE4 A;  4RH6 A;  3V05 A;  1SE3 A;  4ZYS A;  1I4Q A;  3DWP A;  3KLS X;  1V1P B;  3R2I A;  1AW7 A;  1S5C D;  1PTO B;  1BCP B;  1SJH D;  4RGN A;  1LT6 D;  3DWQ A;  3URY A;  3CHB D;  3O13 A;  2SEB D;  1EU3 A;  5FKA C;  1I4H A;  3MFG A;  1JWU D;  1KLG D;  4BWG B;  1Z52 A;  1EWC A;  1SJE D;  2NTT A;  1MD2 D;  5ELE A;  1PRT D;  1FGB D;  1QIL A;  1STE A;  4L6T B;  1RF2 D;  5I4D A;  1M4V A;  3DWA A;  1PRE A;  2TSS A;  1PTO F;  1GOZ A;  1ET9 A;  4RFB A; 
#chains in the Genus database with same CATH topology
 1E2W A;  3K7A H;  5M3F B;  1X55 A;  1EWH A;  5AJ3 Q;  1L1O C;  3C3L A;  2CVR A;  2P5Z X;  4DV2 Q;  2MUY A;  3W3A A;  2F4V Q;  1N33 Q;  1EYC A;  2MGS A;  4C56 C;  4XDX A;  2D62 A;  3QWN A;  2NN6 H;  1LUZ A;  3PUY A;  3NBH B;  4IOC A;  4A3M G;  4UHV A;  1FJG L;  4GOP C;  1MSG A;  1LLR D;  2FHT A;  4GN5 A;  4A3E G;  3GTO B;  1VQO A;  2SOB A;  3MC0 B;  1ENC A;  2VB3 X;  3I2Z A;  5KGU A;  2KQ3 A;  1KLU D;  3G7L A;  2A1A A;  3I91 A;  3CCM A;  2AUK A;  2HIX A;  5I2X A;  4O0A A;  4C3H H;  3ULP A;  4UP7 A;  4L5S A;  3S1M H;  1TKW B;  3BDL A;  1B2T A;  4WOR A;  3V96 A;  1Q3L A;  3CD6 A;  5DLQ E;  5G3L D;  1E3P A;  2ZM6 Q;  3UI2 A;  4XQJ A;  3S2D B;  1NTG A;  4A3K G;  2KCC A;  4QL5 A;  1LTT D;  3FP9 A;  1IKL A;  1HTL D;  4HR7 B;  1UNS A;  1LTR D;  2EDG A;  3AFQ A;  1VQI A;  3MFY A;  1CSQ A;  2KJX A;  1D8L A;  3JAM E;  2RKS A;  3AFP A;  4JI3 L;  4U67 3;  1N9W A;  1VQA A;  2EJG C;  3FKI H;  4NB3 A;  1SMY C;  5C3E G;  4DGZ A;  1VQC A;  1EQV A;  3R2I A;  1VCI A;  4GKK Q;  5NUC A;  3OIP A;  2RA4 A;  1JJC B;  1EY7 A;  5IP7 H;  3M7G A;  3T1Y Q;  2K5V A;  2MFI A;  1SNO A;  3NE5 B;  3D6C A;  3I70 A;  4L6T B;  1YJN A;  4DF7 A;  1V43 A;  5BN4 A;  1SMX A;  2CWA A;  1JOO A;  3GD7 A;  5COR A;  4MHE A;  1VQG A;  1CKN B;  2CQA A;  1JT8 A;  1X3G A;  2TMP A;  4RWS C;  1DYQ A;  4RKB A;  4A76 A;  4LF5 Q;  1VF7 A;  4KKT A;  5J22 A;  3J81 i;  4AQY L;  3C1E A;  1QOH A;  2KOL A;  2NYZ D;  3PO2 B;  2ZXP A;  1S72 A;  2PO4 A;  3D3R A;  2CKZ B;  2XGT A;  3FPP A;  1ROD A;  4R4T A;  1GUT A;  4A3J H;  1D7Q A;  1OTC A;  1YNX A;  3F2U A;  4G7H C;  3S15 H;  2VZA A;  1IBK Q;  4DNR B;  1RCV D;  3SEB A;  3A8J E;  4HMJ A;  2WKC A;  3AB9 A;  1B1Z A;  4JI7 L;  4BY1 B;  3KJP A;  3KOJ A;  3S9W A;  4KLK A;  4DK6 C;  1S5F D;  2B8G A;  5ELC A;  1M8A A;  1K3R A;  3S1R H;  4J15 A;  2B8F A;  1LO5 D;  1RD9 D;  1SNM A;  2AHO B;  3PIP A;  2LSS A;  5JEA H;  1MBY A;  2R6G A;  1IW7 C;  1WVL A;  1UAP A;  1DOM A;  5KND A;  3ND9 A;  1GUS A;  4B3T L;  1C7Y A;  1IYU A;  2N8N A;  1A2U A;  2B2V A;  4JI2 Q;  1GVP A;  1XTC D;  5G3L F;  2E5L Q;  3S2H B;  4EQ5 A;  4KMU C;  1EY4 A;  2B2Y A;  1ASZ A;  4P74 A;  1GJX A;  2A69 D;  2ZJR A;  4FP5 D;  3L9A X;  3KBX A;  4C3J G;  4I7A A;  4GLA C;  1PA6 A;  1DON A;  3T51 B;  1B53 A;  3BDO A;  1E7Z A;  1S5D D;  4H7B A;  3KJO A;  1H95 A;  2JEB I;  2MPM A;  1PYW D;  1O7L A;  3SK8 A;  2EXZ A;  3CRK C;  4KHZ A;  4ODG A;  2F0N A;  4BA2 I;  3AU7 A;  2NVY B;  5K5P A;  1I50 B;  4X65 L;  2R61 A;  4ZQ3 A;  2DY7 A;  4IN3 A;  3HOZ G;  4LAA A;  2V1C C;  1RKN A;  1Q8I A;  3K5N A;  4FXD A;  1QUQ B;  3BDC A;  5M3M B;  4H44 C;  2EVB A;  4IPH A;  4TKO B;  5C4Z A;  2UUA L;  1H9R A;  4PQX A;  4OGQ C;  3ERS X;  1OXV A;  3QO2 A;  5ELE A;  5BN3 A;  3K5L A;  4KD4 A;  3J7A V;  2K75 A;  4XT3 B;  1PYS B;  4XQQ A;  2UUB Q;  3NSW A;  2QGQ A;  2PZT A;  2A69 C;  4X3S A;  3I4N B;  1RJT A;  3D4D A;  1TU2 B;  2PMZ E;  2R7Z H;  1U4M A;  4A3C G;  4RGT A;  2L9H A;  3RZO H;  5JAV A;  1SFO B;  2XRQ D;  1YJ9 A;  3K7U C;  4C3I G;  2NZ1 D;  2EY5 A;  4AH6 A;  5IGC A;  4HCE A;  3QR8 A;  4LNQ A;  1EY6 A;  5FLM H;  4RGM A;  5LHY 1;  1VF5 C;  3U4Z A;  2PQA A;  4RG1 A;  4CJ2 C;  1CKM A;  4JYA L;  1FL0 A;  5EAY A;  1XMO Q;  3GTK B;  1L1O A;  3CU7 A;  3K81 C;  3KF8 B;  1KAW A;  2CH4 A;  1I3Q B;  2Z4H A;  5CMD A;  3DLL A;  4IUP A;  2OWO A;  2PNH A;  1UUP A;  4RMF A;  1QNK A;  1BKB A;  2EYM A;  4CHT B;  2QIL A;  3GTG B;  3HOU G;  1MHW C;  2HDL A;  1JJ2 A;  4B9W A;  1B9N A;  2OTJ A;  3NEN A;  2N88 A;  1TS3 A;  1JC7 A;  3TS0 A;  1S5E D;  4Q0F A;  2EPB A;  2IWH A;  3T53 B;  3J80 c;  4NXN L;  3CCU A;  2K5Q A;  1EQR A;  3KLR A;  1JE4 A;  4A3D H;  1PH3 A;  2E2I B;  1HH2 P;  2F3I A;  2A19 A;  3DEO A;  4Y52 H;  3CXC A;  1FYC A;  2HQE A;  2JN4 A;  4PMB A;  3OPO A;  1BR9 A;  2RQX A;  1B9M A;  4JVZ A;  3OOC A;  1D5M C;  5C0X I;  3H6M A;  5LL6 X;  1K73 C;  1N33 L;  1BNZ A;  3RD4 A;  1V9P A;  4A3K B;  1Y1W H;  3KBG A;  5AJ3 L;  1R9T B;  2JP1 A;  2EYH A;  4N9T A;  4JV5 L;  1UE6 A;  3KF8 A;  4TVA B;  2ZXO A;  4HJ8 A;  4R1J A;  1YHB A;  3TZU A;  2IX0 A;  1SN8 A;  2K28 A;  4JI6 Q;  1HNW Q;  4LFA Q;  1NUC A;  2MP1 A;  4RAU C;  4JV5 Q;  2L0C A;  2E2D C;  5FO9 B;  3VYR A;  2EOT A;  4A3M H;  1IL8 A;  4RCN A;  1IZ6 A;  1FNV A;  2F4V L;  2RF4 A;  1EYD A;  4QF4 A;  3HOZ B;  2XRS D;  3HEJ A;  1MJC A;  1JQY D;  3ITP A;  4RH6 A;  1T5E A;  3F2B A;  2LXK A;  1ML0 D;  2AWN A;  5E1F A;  1TWG H;  4EQO A;  4A3G H;  4FF4 A;  3M4Q A;  3DUZ A;  5J1Z A;  5IT9 L;  1KC8 C;  2I07 B;  3GTM B;  1HR0 L;  3M4O H;  1HRJ A;  4FVM A;  2QF7 A;  4HED A;  3K7A B;  5KRU A;  5M3F H;  2RCF A;  1VS0 A;  4A3F B;  3PIP 3;  1M4V A;  2WP8 J;  3UDF A;  1LM0 A;  3STB C;  4IZ8 A;  4DU9 A;  2YU9 H;  1F9R A;  3G4O A;  5IYD H;  1II3 A;  4UY8 C;  3KLW A;  5AFW A;  5I2Y A;  1GHJ A;  3MEF A;  5ELO A;  1LAC A;  3DXJ C;  4RKL A;  2SDF A;  3EBE A;  3K57 A;  2RDH A;  3GTJ B;  1GHK A;  3C46 A;  2F0F A;  5DAU A;  2K5D A;  1F77 A;  1WCM H;  1PTO C;  1LV9 A;  2EY6 A;  5IP7 G;  4OO1 H;  3CW2 C;  5EPJ A;  3VYS A;  5IY0 A;  3CCV A;  4GN3 B;  4CKE A;  1P8L A;  3NTH A;  2Z9H A;  3I4O A;  3CCS A;  1CA6 A;  1C8C A;  2I5L X;  3GTO H;  1SDF A;  1TII D;  3ERO A;  1XNQ L;  5IT9 E;  1PZI D;  2AUJ D;  4A93 G;  1KNA A;  1L0Y B;  1FD7 D;  2QEJ C;  1HA6 A;  1X3Q A;  4KY7 A;  3S2D H;  1CK1 A;  1CSP A;  4F87 A;  4X3T A;  2KHI A;  1QVF A;  1A3V A;  1GXD C;  2Y0S E;  3WDN A;  3P20 A;  4G57 A;  1QJO A;  3IFT A;  4DNT B;  1CHP D;  4CDD C;  4C1N K;  2BE5 C;  1D2B A;  1TWC B;  3UDX A;  5KNB A;  3CCJ A;  1OXS C;  1PZK D;  1I50 H;  5F2D A;  4B3R L;  1WTR A;  1Q12 A;  4O42 A;  4DAP A;  3HS0 C;  4OWX B;  1YIJ A;  1CM9 A;  5BR8 Q;  4JBW A;  2K52 A;  1NY4 A;  1X3P A;  2BDN A;  2IW3 A;  4J1M A;  1IBL L;  1SFO H;  3TN2 A;  3JC6 6;  1DZ1 A;  2YTY A;  3K58 A;  4B9X A;  2KEE A;  1JR0 D;  5EKI A;  2JA5 B;  3R3O A;  1Z9F A;  1XTD A;  4EX5 A;  3DWP A;  1UEA B;  2KBN A;  1AW7 A;  3BS1 A;  2RSN A;  3TME A;  3FKI B;  1LT6 D;  4ID6 A;  1CA5 A;  2I0Q A;  1WJJ A;  4ZCK A;  3I90 A;  2E75 C;  2Q2I A;  2B2U C;  5IWA Q;  3B6Y A;  1IBM Q;  4IAL A;  1G6Z A;  2YTX A;  2B39 A;  1HQM C;  3K59 A;  1DD2 A;  5CV8 A;  2AMC B;  3D31 A;  3D8G A;  3DWA A;  4X64 L;  3WOF A;  1SE8 A;  1WI5 A;  2KCT A;  4A3B G;  3K0X A;  4K0K Q;  5K36 H;  4QUC A;  5JJK A;  1E0B A;  1C48 A;  1X6O A;  3E3X A;  5C0X G;  5M5Y H;  4A3J B;  2BCO A;  4JI4 L;  1HCZ A;  1CHQ D;  3R8B A;  3STB D;  1K8O A;  4CDF C;  1KAA A;  1HUM A;  2HHH Q;  1NBW A;  1XWE A;  4HJ9 A;  1R4P B;  3FRP B;  4CJ0 B;  5GAD C;  1TY0 A;  2R7F A;  3NTI A;  3F1Z A;  4JBM A;  1F2Z A;  1K83 H;  4DK0 A;  2I46 A;  2F0D A;  4KHV A;  3HP3 A;  2RBM A;  1HR0 W;  2MNA A;  1CZG A;  3CF5 A;  4P71 A;  4HN7 A;  2KA7 A;  1TWF H;  4MN3 A;  2X69 A;  4LUV A;  2L4N A;  2N55 A;  4MIU A;  4CGY B;  2NVQ B;  3MEH A;  2NVT B;  2NN6 G;  3PF5 A;  1HNX Q;  4A3L G;  4R4O A;  1JJG A;  2EE1 A;  3I73 A;  1BF4 A;  3S15 B;  1DGS A;  1S40 A;  1VQF A;  2E8G A;  2KED A;  3N52 A;  4A3B B;  2F0M A;  3WOE A;  4A4I A;  4A3E B;  1YNN C;  4A3F H;  4XT1 B;  2AQ2 B;  2Z4I A;  1S4Z A;  1WTX A;  1EFI D;  3H91 A;  2EXD A;  2QW7 A;  4R8I A;  1I6H B;  1B44 D;  3EA6 A;  4RHS A;  3R2T A;  5TSS A;  3TP6 A;  5M3M H;  2E2H B;  5M5X H;  2YYZ A;  4DAV A;  3V05 A;  3H0G B;  3U9O A;  2ATW A;  1I94 Q;  3URY A;  5CV5 A;  4WFN 3;  1A0I A;  4JI4 Q;  3GTP H;  5I6Y A;  1YBY A;  2A6E C;  4JI8 L;  3GTQ B;  4V19 0;  1EIG A;  1SYB A;  4QJF A;  3A7L A;  4X66 Q;  4PV1 C;  4HID A;  5GAH C;  3MXG A;  3X3M A;  2K33 A;  4XQN A;  2PZW A;  3FKI G;  4MTN A;  4DR6 Q;  1Q1E A;  4K8I A;  4DPG A;  2PYK A;  4AYB E;  5IWA L;  2JA7 B;  2VQF Q;  4NKL A;  3QG1 A;  1A3U A;  2AQ3 B;  2B2W C;  4WJW A;  1FR3 A;  1LTI D;  3RN2 A;  2JJQ A;  4TQU S;  2K05 A;  1F9Q A;  4A75 A;  3G6J B;  1V1Q A;  5HGT A;  4JI7 Q;  4DXF A;  2F3W A;  3T56 B;  1X32 A;  3RR5 A;  5FO7 B;  1VQN A;  5C5L A;  3A5U A;  2A74 C;  2NB0 A;  2AQ1 B;  1MI2 A;  5CV4 A;  1BBX C;  2EYF A;  1YNJ C;  4JC0 A;  1UWV A;  4DV7 L;  1D1K A;  1KNE A;  5BN5 A;  3NQI A;  2DNC A;  3LGJ A;  1FVI A;  1KHI A;  1SNP A;  5M3M G;  1IYV A;  1EY9 A;  2GVA A;  3ER0 A;  4H13 C;  1R9T H;  3GTK H;  3K0Y A;  4OX9 Q;  4JOI C;  3DEP A;  3VR4 A;  2JK8 A;  2GN5 A;  5CBE E;  2B63 G;  3Q22 A;  2JA6 B;  2MJ8 A;  4LF9 Q;  1AFP A;  3C0N A;  3DHQ A;  4LWC A;  1DXM A;  1EEF D;  1PTO D;  4IQZ A;  1Q90 A;  5ELF A;  3SVM A;  3J7Z C;  4GOP B;  2PPB C;  3I4L A;  4LF8 L;  4OO1 I;  5M5Y B;  2OQK A;  4OWW B;  4BY1 H;  2ASB A;  4EQP A;  3L2P A;  3J81 L;  3GP7 A;  4HJA A;  2ID0 A;  3PCO B;  1X65 A;  1EYG A;  2B2W A;  3S1R B;  2E2I H;  2UU9 L;  3Q8D A;  2OQ0 A;  3NHH A;  3KFU A;  1F2M A;  4IUR A;  3J7Y W;  2UUB L;  3PSI A;  2B29 A;  5IYB H;  3I4M G;  1HTP A;  4LF6 L;  1QE6 A;  3JAM i;  3HOY G;  3CAM A;  1K28 A;  3Q0A A;  2JQO A;  4HSV A;  4OX9 L;  2B2T C;  2H4O A;  3TP7 A;  4FO2 A;  1AP0 A;  3VDY A;  4C3J H;  1CTM A;  2F3V A;  1PH9 A;  4A3G B;  3ERQ A;  4IFD J;  2KHS A;  4IFD I;  5E4W C;  1Y14 B;  5FLX c;  2BA1 A;  5KYL A;  1IYJ B;  2UUC Q;  5FOB B;  4A3M B;  4DR1 L;  3G6E A;  4YHH Q;  2G5D A;  1U5K A;  4JCV E;  2F0P A;  3K6O A;  4FF3 A;  4KV6 A;  4K14 A;  2PW7 A;  3OSO A;  1TWG B;  4K6L A;  3CCR A;  2PMZ B;  1PYB A;  3J81 c;  3PO3 H;  4BBS H;  4JOI A;  2UXB Q;  3NEL A;  1PRT C;  1H9S B;  4NW2 A;  3C2P A;  2WKD A;  4DV5 L;  3W1G A;  3UDG A;  5D14 A;  4X6A H;  4EQN A;  3CQZ B;  3H3V H;  2EIF A;  1MGS A;  1TY2 A;  4JG2 A;  3Q6S A;  3LX0 A;  1K0R A;  2ZM6 L;  3HKZ G;  1RHP A;  1N32 L;  3MVV A;  1VQP A;  2HQL A;  1WTO A;  2F0E A;  1A2T A;  1RIP A;  5C3E B;  3M7N A;  2ZTE A;  1K8M A;  1PV4 A;  4K8J A;  3HKS A;  1C9O A;  2G9D A;  4O1N A;  4DR5 L;  4IJL A;  3BJU A;  4KTA A;  2DGY A;  3HOV G;  3RZO B;  1I6H H;  1HJP A;  4DK1 A;  2H1E A;  3RMH A;  2VW9 A;  3GTP B;  3DM3 A;  5IYC G;  3OWE B;  2YTV A;  1BCP C;  1S3O A;  3D0F A;  5C44 B;  4A3F G;  2WV6 D;  4DK3 C;  1L0X B;  1AZP A;  4JI0 L;  4Y7N H;  4CJ1 B;  4HIO A;  4P2C B;  4KJN A;  3BU2 A;  1RDP D;  1GD7 A;  4CBV A;  2UUC L;  1KRT A;  3J7A F;  2JA5 H;  2HCI A;  3JAM c;  1ZXT A;  2G9H D;  1NR4 A;  3QJY A;  4QCL A;  3KUP A;  4PMW A;  2EY2 A;  5EPK A;  1HFN A;  1B4O A;  2M00 A;  1OXT A;  3ZYY X;  4LF5 L;  1WTQ A;  2IHF A;  2Q2H A;  1E22 A;  1LT4 D;  1V1P A;  4JYA Q;  4A3J G;  4DR4 Q;  1UE7 A;  2F0S A;  1L2F A;  4G7Z C;  2F1M A;  1V1P B;  2NZO A;  5HY6 A;  4PG3 A;  1SJH D;  2ZJP A;  1X54 A;  4DUZ L;  4OON A;  5IP9 H;  4X62 Q;  4ZAI A;  4A3D B;  3ULL A;  1I6V C;  1G2T A;  1A3T A;  3HKZ E;  4BBR H;  2XWJ B;  4WJ3 M;  2ZJQ A;  1PH6 A;  5C4H A;  1SYE A;  1U4L A;  2F0G A;  1YEZ A;  1WD0 A;  4A93 B;  4IPG A;  5JEA G;  1TWH H;  3CRL C;  3I4M B;  4JI1 L;  1KDA A;  3J80 E;  4BY7 H;  3HOW H;  3L3O C;  2RHQ B;  2NVX H;  4YY3 L;  4LMQ D;  3F8T A;  1O7Z A;  1UE1 A;  5J3B A;  1N34 L;  2R92 H;  3BYT B;  4B3T Q;  1C4Q A;  4K5V A;  1HZB A;  5ISR A;  2Q2T A;  3PGZ A;  2Q8T A;  3SK4 A;  2R3Z A;  2IJ0 A;  1EUJ A;  5IYC H;  2F0V A;  4LFB Q;  3M85 A;  1FJG Q;  3JAM L;  5M3F G;  1D6E C;  1AZQ A;  1PZJ D;  3H0G G;  4P72 A;  5FK9 C;  3TSS A;  3AQQ A;  3P7J A;  1HQR D;  1IKM A;  1JOR A;  2VQE Q;  4KHP L;  4GOP A;  4DV2 L;  1STH A;  4FXG C;  5KIX A;  2QDB A;  2X6L A;  4KJO A;  1VMP A;  2C5C A;  3VYT A;  4KHP Q;  1LTS D;  3DM1 A;  2E5L L;  2EYJ A;  1XJV A;  2JA8 B;  1VQ4 A;  4X3K A;  4X64 Q;  4GN4 B;  3P1H A;  1LT5 D;  1TWA B;  1PFS A;  2MHV A;  1QVG A;  1U4P A;  5C4X H;  3L7Z C;  1JIC A;  4UP8 A;  1NE3 A;  4X65 Q;  2ZXR A;  1TS5 A;  3IRB A;  2MO0 A;  1STY A;  1PRT F;  2NTS A;  1U9R A;  1YNJ D;  2EJM A;  1UE5 A;  2RDF A;  1MSH A;  5H1S E;  5IGB A;  1Y8O B;  4KKS A;  1EIF A;  5GQO A;  1YHQ A;  4ZUI A;  4LFC L;  4A3C H;  4FNF A;  2B2V C;  2E2J H;  2Q2U A;  2EYL A;  3HOV B;  2F0K A;  5LL6 S;  1SYF A;  1DJR D;  1XNQ Q;  4A3B H;  1EL0 A;  1KL9 A;  4CKC A;  2K7V A;  1PDQ A;  1HPC A;  1PXU A;  1JB7 A;  2CH4 W;  1KRS A;  5CBA E;  3BZD B;  4R4I A;  1B8A A;  5IIF A;  3KLS X;  4DR2 Q;  4RGN A;  1PTO B;  3DWQ A;  2RHS B;  1EOT A;  1ZYR C;  3CHB D;  1J9O A;  2XWB B;  5C5M A;  3S24 A;  4HSP A;  3MFG A;  1W6J A;  5FJ8 G;  4BWG B;  1VQB A;  2XIW A;  3R93 A;  1EWC A;  1MD2 D;  3CME A;  4CDE C;  1DM0 B;  4FF2 A;  3I8Z A;  1CUK A;  4I7Z C;  4A3D G;  3GTQ H;  1IBK L;  4YWK A;  4JI1 Q;  5CR3 A;  1Z6H A;  1T9H A;  4FXK C;  3S1Q B;  3A5Z B;  3FVQ A;  1HHV A;  1K0S A;  1CI3 M;  2QDL A;  1I5F A;  3A0J A;  5IT9 c;  4B3M Q;  3I55 A;  1IL2 A;  4K0K L;  2LY7 A;  5JOB A;  3MTS A;  3M9B A;  4MTK A;  2QA4 A;  4RCO A;  3RLF A;  1VQ5 A;  1HZ9 A;  1AH9 A;  3PO2 G;  1N32 Q;  3FMC A;  2ICI A;  5IE8 A;  3BYY B;  4Z9C B;  2WAQ G;  2F0I A;  2JA7 H;  3NP8 A;  1G51 A;  4GNX A;  1SEB D;  3ND8 A;  1D5Z C;  5CGK A;  5GAG C;  1Z47 A;  4DV5 Q;  1EY0 A;  3OW7 A;  2VUM H;  1ZEQ X;  4POG A;  1STG A;  2J4X A;  1EYA A;  3CC2 A;  2XSC A;  3MXU A;  5E4X A;  4RHR A;  1AN8 A;  1HR0 Q;  4QQB X;  4DAY B;  2K1B A;  2VNU D;  1P16 A;  3BZK A;  2F4I A;  1XX8 A;  4OHJ A;  2PW5 A;  4MNO A;  4DR5 Q;  3L0O A;  2O5I C;  2XNA C;  4PMC A;  3TP8 A;  4YIJ A;  4HMI A;  3BVM A;  4NPS A;  1J8I A;  4X3U A;  4H02 A;  2DY8 A;  4J6H A;  3V2T A;  2WB1 E;  1B7Y B;  5C0X J;  3GV3 A;  1KAB A;  4K6D A;  4DN4 M;  4KN7 C;  4LFA L;  3OW2 A;  4DR2 L;  1Y1W G;  4X66 L;  5GRO A;  1Q7Y C;  3HFZ B;  4IUQ A;  2UXD L;  3HKZ B;  1PH1 A;  3PV0 A;  2PCF B;  1BCP B;  3NPP A;  3OIQ A;  2OXP A;  1X9N A;  1I4H A;  2Q8R E;  4QUF A;  2GVB A;  2CWP A;  4YWM A;  3EJI A;  1VQK A;  1Y8P B;  4A3E H;  1I3Q H;  3NQT A;  1GUO A;  2VS1 A;  1EWI A;  1VQM A;  2VQF L;  1H9K A;  5JVG 3;  3OTO Q;  2R92 G;  3PO3 B;  1CQF A;  4F7X A;  4BBS B;  3NWT A;  3FPU B;  1NMG A;  4OEL B;  1XPR A;  1W3S A;  5ELD A;  4AYB B;  4B3M L;  2E2H H;  2OT2 A;  5M5X B;  3GV6 A;  2I5H A;  1RL2 A;  3RZD H;  4GS3 A;  2Q8I B;  2NN6 I;  1F2Y A;  3M3Y B;  3Q23 A;  1ICW A;  4IO9 A;  1E2Z A;  1BCP D;  2ZTD A;  4M8A A;  4EVO A;  3NTK A;  1GO3 E;  1ILQ A;  1FGU A;  4DV3 Q;  2PNR C;  4LJZ C;  3E0E A;  3A8I E;  3I56 A;  4XYQ A;  1FNU A;  2HD3 A;  3GTL B;  2SNM A;  1JWM D;  1HXY D;  3FEW X;  4F8M A;  4BY1 G;  4TRD A;  4F88 A;  1S5B D;  4ILW A;  3HOW G;  1K9M C;  1EIY B;  5C44 H;  4LF9 L;  1SMY D;  1PH2 A;  1JOK A;  1A15 A;  1N34 Q;  1BBU A;  2A68 C;  2L11 A;  2O4X A;  3TP5 A;  3W2D A;  4DUY Q;  2JYO A;  1NAP A;  5D65 A;  4YY3 Q;  5JVH 3;  2PQE A;  1ONL A;  2DN8 A;  1EY8 A;  4B3S Q;  1A6X A;  2WAC A;  1XYI A;  1STB A;  4HIM A;  1CZW A;  3AYH B;  5EBC A;  1QZH A;  1QB5 D;  5C0X H;  5I6W A;  5ELB A;  1HZC A;  4Y7N B;  2FIN B;  3G4N A;  1TT2 A;  3S1N B;  1EU4 A;  2EY1 A;  2YU9 B;  1DOK A;  4LK1 C;  5I9O A;  1IXR A;  1VQ7 A;  4BBR B;  1SE4 A;  4ZYS A;  4NXN Q;  3OTO L;  1I4Q A;  3IKJ A;  3MZ5 A;  3SHL A;  1VQD A;  3S17 H;  2IY5 B;  4KY6 A;  2C35 B;  5IGD A;  2A8V A;  1R4Q B;  3G71 A;  1HNW L;  2UXC L;  3H15 A;  5JJZ A;  4IJH A;  4FDB A;  1JWU D;  3RLN A;  3HOX H;  1GKH A;  4BY7 B;  1SJE D;  1E1T A;  1B50 A;  2HHH L;  4AQY Q;  1SAP A;  5IYD G;  4ZKC B;  1SYG A;  2KUM A;  1AE3 A;  1WCM B;  5DNF A;  3VA5 A;  3C1F A;  4RFB A;  5COY A;  4DV6 L;  2VQE L;  4LF4 Q;  1SRO A;  2XN9 C;  5HGQ A;  2JA8 G;  1PH8 A;  2ZT9 C;  1PFM A;  4A3G G;  4OWT B;  2LFN A;  3NXW A;  4DR1 Q;  3BVZ A;  4L5Q A;  4YHH L;  5I9P A;  4DV0 L;  3I4N H;  2Y0S G;  2KEC A;  5DM7 3;  4B3S L;  3PIO A;  4IFD H;  3IL8 A;  4A93 H;  4ALP A;  4LUO A;  5C4J B;  1VDZ A;  3A56 A;  1X3E A;  4C3J B;  1PH5 A;  2UXC Q;  4ULL A;  1IW7 D;  3HOU B;  1RTO A;  4O2D A;  2NVX B;  4CKB A;  4EGV A;  1CKO A;  1SNQ A;  3D6W A;  5CYU A;  1EEI D;  1GUG A;  2PI2 E;  5CV7 A;  3VR5 A;  5LMU L;  2UXB L;  1K8G A;  4IPD A;  2F0J A;  1SSO A;  1CQV A;  3BZC A;  2KCM A;  4JI5 L;  4HJ5 A;  3BG3 A;  3TDQ A;  1SRU A;  2SNS A;  3GDE A;  1XMQ Q;  2K01 A;  3TZD A;  2I5M X;  3E9H A;  3HOX G;  4DV4 Q;  2VY3 A;  2J0T D;  5ELN A;  1PFB A;  5GAE C;  1ZYR D;  1JOQ A;  3EN2 A;  2IX3 A;  1O7I A;  5D3I B;  4HCS A;  1BCP F;  3MWY W;  3D4W A;  1L1O B;  4N9P A;  5KEE A;  3I72 A;  2UUA Q;  3K5O A;  2Z8L A;  3H3V C;  3M4O B;  1CKN A;  4DUY L;  2K5W A;  1KDC A;  1PTO H;  3KK7 A;  2R7D A;  4H0L C;  1IBM L;  2EZV A;  1LTL A;  1A63 A;  2E2J B;  4DXG A;  3HOV H;  1LYL A;  1U4R A;  2PZU A;  2WB1 B;  1SE3 A;  3LWU A;  3VA7 A;  3QOJ A;  2VL6 A;  4HIK A;  1NCV A;  1B70 B;  3MXP A;  1QNU A;  1EU3 A;  3OWF A;  4IFD G;  5EBD A;  5FKA C;  2JA7 G;  3PQI A;  1BDO A;  2N3S A;  4JPB W;  5C3W A;  2C9O A;  4R4C A;  1V8Q A;  5IGE A;  3GTL H;  2JA5 G;  4QGU A;  4LF4 L;  3A7A B;  3T4A C;  3D4R A;  4YWL A;  3TQY A;  1G91 A;  3GO5 A;  1O80 A;  4IUT A;  4K2K A;  3RZD B;  2HT1 A;  1KQS A;  2E74 C;  4GKJ L;  2H5X A;  1VQ8 A;  1W2B A;  4KKU A;  3U9S A;  2AKW B;  2UXD Q;  2X6G A;  4UPA A;  3NEM A;  4JI6 L;  4BXX G;  4UAI A;  2E76 C;  1VQ9 A;  4LFC Q;  2NVY H;  4DNI A;  1STN A;  1Y1V B;  1F9P A;  1PFN A;  5A35 A;  2RVL A;  3M4P A;  3E6Z X;  2F0W A;  5E7N A;  3PMF A;  4FF1 A;  5LMN L;  3VR2 A;  4QB4 A;  1PLF A;  3EFX D;  3A74 A;  1LTA D;  4YCU A;  3RLO A;  1VQJ A;  5IGG A;  1G2S A;  2CHB D;  2JA9 A;  4APV A;  4DV6 Q;  4NXM L;  2A6H C;  3EIV A;  1I4R A;  1ILP A;  1SYC A;  3KDF B;  4L5T A;  4UDU C;  4XYO A;  1I4G A;  3MAQ A;  3LNN A;  3HOY H;  1AE2 A;  1TWH B;  4XIG S;  2Y0S B;  2Z1C A;  5IYB G;  3I4M H;  3NUC A;  3S1Q H;  4IPC A;  5C6A A;  1HFG A;  1T5X D;  3PUX A;  1QUQ A;  3S14 B;  1SXT A;  4ZLT F;  3I4N G;  3N6R A;  1M90 C;  2D9U A;  1ICF B;  4IUU A;  2R92 B;  4DAM A;  1RTN A;  4FYD A;  3TRZ A;  4KN4 C;  1D5X C;  1UEB A;  3H09 A;  4A3I B;  4B08 A;  4OEM B;  1MJE A;  4RGO S;  1Y69 U;  1A8V A;  1ESR A;  3DMU A;  3T1Y L;  5D3D A;  3K5M A;  3UE0 A;  5FO8 B;  2LKV A;  3HOX B;  2V4D A;  1TS2 A;  4DV3 L;  1B3A A;  1LAB A;  2B63 H;  3NBH A;  1Q82 C;  5CV9 A;  4Q5V A;  1J5E L;  1EQQ A;  4AYB G;  1VQL A;  4KY5 A;  3VYU A;  2PI2 A;  1AEX A;  4WRD A;  3OMC A;  3O13 A;  4GKJ Q;  2F0U A;  2FMC A;  2FFK B;  3H3V I;  1NJI C;  4XTC S;  5LMN W;  1PMR A;  4PZ8 A;  2NZH A;  1MIU A;  1STE A;  5I4D A;  3MA2 B;  1QCB D;  1KXL A;  2TSS A;  5FLM G;  1PTO F;  3EQL C;  3UDI A;  1EZ8 A;  2K04 A;  2D0O A;  3PIO 3;  1NNX A;  2IL8 A;  4ME5 A;  3TBI B;  1LTB D;  1B3Q A;  1TR5 A;  1ENF A;  1QWY A;  3G4S A;  2WAQ E;  1K83 B;  1HNX L;  4M1U B;  5M5W H;  1K3B C;  2M9V A;  2FJ2 A;  1YIT A;  2OTL A;  1G29 1;  2A5H A;  5EPL A;  2HDM A;  1EQT A;  3T16 A;  1CT1 D;  2Z6K A;  5EKL A;  2K50 A;  4JBK A;  3J81 j;  2R93 B;  2D2C C;  3J7A 5;  5JJI A;  1EOV A;  2OCE A;  2BE5 D;  4N8X 1;  2NVT H;  2K5H A;  1N36 L;  2BH2 A;  4IUN A;  2KHJ A;  1VMC A;  3CCL A;  3F2D A;  4JI0 Q;  1KTK A;  2F0O A;  2D0P A;  5FLX L;  4P73 A;  2F03 A;  4YCW A;  1H9M A;  3I7F A;  2EJF C;  1K8A C;  5C3X A;  1WCM G;  3BVG A;  1WYD A;  5JPN C;  4BBR G;  1YJW A;  2CCZ A;  4RA8 A;  1EFW A;  4N8F A;  4QY7 A;  4JBJ A;  2MQH A;  1I4P A;  2RSO A;  1SBB B;  5CC4 A;  4G7O C;  1TWF B;  4R4Q A;  3C0O A;  1J6Q A;  5BR8 L;  1BVS A;  1Q81 C;  4DR7 L;  1H9J A;  3CPF A;  3SDZ A;  1Q1B A;  3A54 A;  1I4X A;  4OL7 A;  4ZK9 B;  2EYP A;  4ME3 A;  3U4V A;  4E6I A;  3LWE A;  1VQE A;  2HCC A;  3SK5 A;  1XXG A;  1LTG D;  4DFA A;  3FHW A;  4WJ4 A;  2DNE A;  3SXH A;  3PF4 A;  1Y8N B;  2HIV A;  1VQH A;  1J5E Q;  3S1N H;  4LF7 L;  1TWC H;  2VUM B;  1IHZ A;  2WFW A;  5T1G A;  4DKA C;  2NUC A;  2IT1 A;  3AEV A;  1I94 L;  1Y1V H;  1Z52 A;  1PVO A;  1XPO A;  1EIH A;  1OO9 B;  3S16 H;  5T1I A;  4I65 A;  4X62 L;  3CPW A;  2XVS A;  1QVC A;  4DV1 Q;  4LF6 Q;  2CQO A;  3NWS A;  1F9S A;  1SR3 A;  1BOS A;  1E2V A;  4MZ9 A;  1KDB A;  1YHA A;  2A73 B;  3K80 C;  2L5T A;  2O2L D;  2QKI C;  1F2L A;  4DR3 Q;  1C0A A;  3TRE A;  2R93 G;  2AWO A;  4OO1 G;  2L12 A;  2BA0 A;  1O78 A;  1W6K A;  3SK6 A;  1SYD A;  1STA A;  2XTI A;  4GNX B;  3HOY B;  3IFD A;  2Z0S A;  3S2H H;  2FXQ A;  3KLS A;  4L63 B;  1SLJ A;  2WB1 G;  3ONA B;  4LW1 A;  1X56 A;  4QIW E;  2K5N A;  4DV4 L;  1WTP A;  4LF7 Q;  2K6A A;  1M1K C;  3TS2 A;  4V0B A;  4DV7 Q;  1PHJ A;  2IX1 A;  1A62 A;  3S1M B;  5A2Q E;  4A3I H;  1JB3 A;  1HNZ L;  1EY5 A;  2WIN B;  3OHX C;  5EJW A;  3W1B A;  3C0M A;  3HOU H;  1HA5 A;  2N49 A;  1GM5 A;  1BBW A;  3MXN B;  1X3F A;  2A6H D;  2O5J C;  1OXU A;  4BA1 I;  1DOL A;  2B63 B;  2VB2 X;  4BXX H;  3M3Y H;  1JE5 A;  2RCN A;  2JXM B;  5KYI A;  1YI2 A;  2ES2 A;  1ESF A;  1V1O A;  3NBI A;  1GUN A;  5C44 G;  1SND A;  2ICE C;  4NXM Q;  5IGF A;  2NVQ H;  3HOW B;  4GLX A;  5JEA J;  4B3R Q;  4JI8 Q;  4HTH A;  2R93 H;  4C3I B;  2L1B A;  4PZ6 A;  3NK9 A;  4S3S A;  3RN5 A;  5CV6 A;  4DA2 A;  2EQS A;  2F0Q A;  3PO2 H;  2SEB D;  3TEH B;  4OXP A;  4GKK L;  1SNC A;  1KLG D;  5M5W B;  4OIJ A;  2NTT A;  1E24 A;  5A2Q L;  3CCE A;  1FGB D;  4G4K A;  4DR3 L;  4C2M H;  3QB3 A;  1PRE A;  2F52 A;  3J80 L;  1ZKO A;  4NMZ A;  2VUM G;  3W5O A;  1HNZ Q;  1IBL Q;  1PRT B;  1Q8K A;  3AMU A;  3CC4 A;  3CC7 A;  1BXT A;  2NWG A;  3H0G H;  1SE2 A;  2F0T A;  2K03 A;  3P75 A;  3ICE A;  2PQA B;  4LFB L;  1OXX K;  5DM6 3;  2WAQ B;  2IPK D;  1LT3 D;  4JI5 Q;  3S17 B;  4GZY C;  4NDX A;  5C3E H;  2CW0 D;  5EGT A;  3X3N A;  1WD1 A;  5JJL A;  1N36 Q;  3J80 i;  1BO0 A;  2WII B;  3OYY A;  5DEH A;  3VR6 A;  1TQO A;  3KF6 A;  5IP9 G;  3MHB A;  4NP5 A;  1Q46 A;  4ZKB B;  1ASY A;  2JA6 G;  3KF6 B;  4GLV B;  2BDO A;  2QCP X;  5C4X G;  1XMO L;  2K14 A;  2ENB A;  3IAY A;  3CMA A;  2R7Z G;  4JI3 Q;  1G6P A;  2UU9 Q;  3PUZ A;  3RNU A;  4U68 A;  2JE6 I;  4YCV A;  1JWS D;  4DR7 Q;  2MO1 A;  1XMQ L;  1N8R C;  3GTM H;  4K5W A;  1KIX A;  3CQZ H;  1WFQ A;  4JK1 C;  4DAY A;  4K2L A;  2KCN A;  3FDT A;  4HJ7 A;  4P75 A;  1BQQ T;  3KDF A;  3HRZ C;  2FMM A;  2L55 A;  2N78 A;  5KNC A;  4K5X A;  5LMU Q;  4C3H B;  3RUZ A;  3WWV A;  3HGB A;  2BH8 A;  1CFM A;  1YZ6 A;  2K32 A;  4CDC C;  5C4J H;  3M4Y A;  3CP0 A;  1TVX A;  1WOC A;  2KEN A;  3HZX A;  3SR1 A;  1EZ6 A;  3S14 H;  3ZJY C;  3E5S A;  1GUW A;  4DV0 Q;  2A68 D;  1D1I A;  4UP9 A;  3H94 A;  1S5C D;  1NMF A;  2LXJ A;  4R8N A;  1HZA A;  2HUG A;  3G48 A;  3SE0 A;  3PO3 G;  4BBS G;  4KK7 A;  4A3L H;  1QG7 A;  2ZTC A;  1DCZ A;  4ABN A;  2JA6 H;  1PRT D;  1WTV A;  2R7Z B;  1VQ6 A;  2M2L A;  4ZUJ A;  1YNN D;  4QIW B;  1YVC A;  2ALY B;  3T1H Q;  2BOS A;  1GOZ A;  1H9S A;  3T13 A;  4OIK A;  5HUR A;  1NSN S;  4JI2 L;  1Q86 C;  2DJF C;  4TSS A;  2JEA I;  3CKI B;  3OMG A;  2CW0 C;  2A6E D;  2JSO A;  1XNR Q;  2LMC B;  3J81 E;  1MKH A;  4C3H G;  3E0J A;  3KYH C;  5EQ0 A;  5EKK A;  4QMG A;  2IHE A;  4DV1 L;  1E1O A;  2Z6K C;  3GTG H;  2J7Z A;  4XXE A;  4C1N I;  5IOD A;  4JW0 A;  1Y1V G;  1O7Y A;  4J8Q A;  5C4X B;  1PH7 A;  2B2U A;  4IUV A;  2B3G A;  4KD3 A;  3VR3 A;  4A3K H;  1Y1W B;  3EVQ A;  5J39 A;  2YV5 A;  5LMN Q;  5FJ8 H;  1G8Z D;  3A55 A;  4PZ7 A;  5FLX E;  2VXW A;  3E9I A;  3UE1 A;  2L15 A;  1JCK B;  4AIM A;  1U0L A;  3PUV A;  2LS0 1;  3U58 A;  3K8A A;  4L8J A;  1HUN A;  1TXY A;  3U50 C;  2B2Y C;  4HAE A;  4GNX C;  1NR2 A;  1ENA A;  2K4K A;  1FNW A;  4KI0 A;  4C2M B;  5JPM C;  4BY7 G;  4C3I H;  2Z6B A;  2JA8 H;  1ET6 A;  3CCQ A;  4ZRZ A;  1PH4 A;  4LF8 Q;  2RDG A;  2F0H A;  3A8K E;  2QEX A;  1KD1 C;  5E3F A;  2D5D A;  2EYO A;  3Q24 A;  4DUZ Q;  3T1H L;  1TWA H;  4R9W A;  2NBF A;  2DJG C;  4DR4 L;  1TS4 A;  1QZG A;  5K36 G;  2OF1 A;  4A3I G;  4PNY A;  2B2T A;  4L5R C;  1WTH A;  3MXN A;  3F2C A;  4LUZ A;  1JMC A;  2CFM A;  3I3C A;  3QIA A;  2F0L A;  3HG9 A;  4POF A;  5IOC A;  1XPU A;  3HOZ H;  3PUW A;  3SGI A;  3GQB A;  4BS9 A;  3GTJ H;  1WTW A;  1QIL A;  1XNR L;  4IOA A;  1Z7T A;  1RF2 D;  5L37 A;  5M9O A;  4DR6 L;  2DUD A;  3ULJ A;  2GA4 B;  2OEO A;  1BUV T;  1L0W A;  2KVM A;  3QOL A;  1ET9 A;  3S16 B; 
#chains in the Genus database with same CATH homology
 1E2W A;  5M3F B;  1EWH A;  3C3L A;  2CVR A;  2MUY A;  3W3A A;  1EYC A;  2MGS A;  4C56 C;  4XDX A;  2D62 A;  3QWN A;  2NN6 H;  3PUY A;  1MSG A;  1LLR D;  2FHT A;  3GTO B;  2SOB A;  3MC0 B;  1ENC A;  2VB3 X;  5KGU A;  2KQ3 A;  1KLU D;  3G7L A;  3I91 A;  2AUK A;  5I2X A;  1TKW B;  3BDL A;  1B2T A;  4WOR A;  3V96 A;  1Q3L A;  5G3L D;  3UI2 A;  4XQJ A;  3S2D B;  2KCC A;  1LTT D;  1IKL A;  1HTL D;  4HR7 B;  1UNS A;  1LTR D;  2EDG A;  3MFY A;  2KJX A;  3JAM E;  2RKS A;  4U67 3;  2EJG C;  1SMY C;  4DGZ A;  1EQV A;  3R2I A;  1VCI A;  5NUC A;  3OIP A;  2RA4 A;  1EY7 A;  3M7G A;  1SNO A;  3NE5 B;  3D6C A;  3I70 A;  4L6T B;  4DF7 A;  1V43 A;  5BN4 A;  1JOO A;  3GD7 A;  5COR A;  4MHE A;  2CQA A;  2TMP A;  4RWS C;  1DYQ A;  4RKB A;  1VF7 A;  4KKT A;  5J22 A;  3C1E A;  1QOH A;  2KOL A;  2NYZ D;  3PO2 B;  2ZXP A;  2PO4 A;  3D3R A;  3FPP A;  1ROD A;  1GUT A;  3F2U A;  4G7H C;  4DNR B;  1RCV D;  3SEB A;  3A8J E;  4HMJ A;  2WKC A;  3AB9 A;  1B1Z A;  4BY1 B;  3S9W A;  1S5F D;  2B8G A;  5ELC A;  1M8A A;  2B8F A;  1LO5 D;  1RD9 D;  1SNM A;  5JEA H;  1MBY A;  2R6G A;  1IW7 C;  1WVL A;  1UAP A;  1DOM A;  5KND A;  3ND9 A;  1GUS A;  1IYU A;  1A2U A;  2B2V A;  1XTC D;  5G3L F;  3S2H B;  4KMU C;  1EY4 A;  2B2Y A;  1GJX A;  2A69 D;  4FP5 D;  3L9A X;  3KBX A;  4C3J G;  1DON A;  3T51 B;  1B53 A;  3BDO A;  4H7B A;  1S5D D;  2JEB I;  2MPM A;  1PYW D;  1O7L A;  3SK8 A;  2EXZ A;  3CRK C;  4KHZ A;  4ODG A;  2F0N A;  4BA2 I;  3AU7 A;  2NVY B;  5K5P A;  1I50 B;  2R61 A;  4ZQ3 A;  2DY7 A;  4IN3 A;  4LAA A;  1RKN A;  1Q8I A;  3K5N A;  4FXD A;  3BDC A;  5M3M B;  4H44 C;  2EVB A;  5C4Z A;  4TKO B;  1H9R A;  4PQX A;  4OGQ C;  1OXV A;  3QO2 A;  5ELE A;  5BN3 A;  3K5L A;  4KD4 A;  3J7A V;  4XT3 B;  4XQQ A;  3NSW A;  2PZT A;  2A69 C;  4X3S A;  3I4N B;  1RJT A;  3D4D A;  1TU2 B;  1U4M A;  4RGT A;  2L9H A;  5JAV A;  1SFO B;  2XRQ D;  4C3I G;  2NZ1 D;  2EY5 A;  5IGC A;  4HCE A;  1EY6 A;  4RGM A;  5LHY 1;  1VF5 C;  4CJ2 C;  3GTK B;  3CU7 A;  1I3Q B;  2Z4H A;  5CMD A;  4IUP A;  1UUP A;  1QNK A;  2EYM A;  4CHT B;  2QIL A;  3GTG B;  2HDL A;  4B9W A;  1B9N A;  2N88 A;  1TS3 A;  1JC7 A;  1S5E D;  4Q0F A;  2EPB A;  2IWH A;  3T53 B;  2K5Q A;  3KLR A;  1JE4 A;  2E2I B;  3DEO A;  1FYC A;  2HQE A;  4PMB A;  3OPO A;  1BR9 A;  2RQX A;  1B9M A;  3OOC A;  1D5M C;  5C0X I;  3H6M A;  5LL6 X;  1BNZ A;  3RD4 A;  4A3K B;  3KBG A;  1R9T B;  2JP1 A;  2EYH A;  4N9T A;  3KF8 A;  2ZXO A;  3TZU A;  2IX0 A;  2K28 A;  1NUC A;  2MP1 A;  4RAU C;  2L0C A;  5FO9 B;  2E2D C;  3VYR A;  2EOT A;  1IL8 A;  4RCN A;  1FNV A;  3HOZ B;  1EYD A;  4QF4 A;  2XRS D;  3HEJ A;  1JQY D;  3ITP A;  4RH6 A;  1T5E A;  1ML0 D;  2AWN A;  5E1F A;  4EQO A;  4FF4 A;  5IT9 L;  3DUZ A;  5J1Z A;  2I07 B;  3GTM B;  1HRJ A;  4FVM A;  2QF7 A;  4HED A;  3K7A B;  5KRU A;  4A3F B;  3PIP 3;  1M4V A;  2WP8 J;  4IZ8 A;  4DU9 A;  1F9R A;  3G4O A;  1II3 A;  5AFW A;  5I2Y A;  1GHJ A;  1LAC A;  3DXJ C;  4RKL A;  2SDF A;  3K57 A;  2RDH A;  3GTJ B;  1GHK A;  3C46 A;  2F0F A;  5DAU A;  2K5D A;  1F77 A;  1PTO C;  1LV9 A;  2EY6 A;  4OO1 H;  5EPJ A;  3VYS A;  4CKE A;  3NTH A;  1CA6 A;  1C8C A;  1SDF A;  1TII D;  3ERO A;  5IT9 E;  1PZI D;  2AUJ D;  1KNA A;  1L0Y B;  1FD7 D;  2QEJ C;  1HA6 A;  1X3Q A;  4KY7 A;  1CK1 A;  4F87 A;  4X3T A;  1A3V A;  3WDN A;  1GXD C;  3P20 A;  4G57 A;  1QJO A;  3IFT A;  4DNT B;  1CHP D;  4C1N K;  2BE5 C;  1D2B A;  1TWC B;  5KNB A;  1OXS C;  1PZK D;  5F2D A;  1WTR A;  1Q12 A;  4O42 A;  4DAP A;  3HS0 C;  1CM9 A;  4JBW A;  1X3P A;  2BDN A;  2IW3 A;  4J1M A;  1DZ1 A;  3TN2 A;  3K58 A;  4B9X A;  2KEE A;  1JR0 D;  5EKI A;  2JA5 B;  3R3O A;  3DWP A;  1UEA B;  1AW7 A;  3BS1 A;  2RSN A;  3TME A;  3FKI B;  1LT6 D;  4ID6 A;  1CA5 A;  3I90 A;  2E75 C;  2B2U C;  4IAL A;  1G6Z A;  2B39 A;  1HQM C;  3K59 A;  1DD2 A;  5CV8 A;  3DWA A;  3D31 A;  3D8G A;  3WOF A;  5K36 H;  4QUC A;  1E0B A;  1C48 A;  5C0X G;  4A3J B;  2BCO A;  1HCZ A;  1CHQ D;  3R8B A;  1K8O A;  1KAA A;  1HUM A;  1XWE A;  1R4P B;  3FRP B;  4CJ0 B;  1TY0 A;  3NTI A;  1F2Z A;  4DK0 A;  2I46 A;  2F0D A;  4KHV A;  3HP3 A;  2RBM A;  1CZG A;  4HN7 A;  2KA7 A;  4MN3 A;  2X69 A;  2L4N A;  2N55 A;  4MIU A;  4CGY B;  2NVQ B;  3MEH A;  2NVT B;  2NN6 G;  2EE1 A;  3I73 A;  1BF4 A;  3S15 B;  2KED A;  3N52 A;  4A3B B;  2F0M A;  3WOE A;  4A3E B;  1YNN C;  4XT1 B;  2AQ2 B;  2Z4I A;  1S4Z A;  1WTX A;  1EFI D;  3H91 A;  4R8I A;  1I6H B;  1B44 D;  3EA6 A;  4RHS A;  3R2T A;  5TSS A;  3TP6 A;  2E2H B;  2YYZ A;  4DAV A;  3V05 A;  3H0G B;  3U9O A;  3URY A;  5CV5 A;  4WFN 3;  5I6Y A;  2A6E C;  3GTQ B;  4V19 0;  1EIG A;  1SYB A;  3A7L A;  4PV1 C;  3MXG A;  3X3M A;  2K33 A;  4XQN A;  2PZW A;  1Q1E A;  4K8I A;  2PYK A;  2JA7 B;  4NKL A;  3QG1 A;  1A3U A;  2AQ3 B;  2B2W C;  4WJW A;  1FR3 A;  1LTI D;  4TQU S;  2K05 A;  1F9Q A;  3G6J B;  5HGT A;  4DXF A;  2F3W A;  3T56 B;  1X32 A;  5FO7 B;  5C5L A;  2A74 C;  2NB0 A;  2AQ1 B;  1MI2 A;  5CV4 A;  1BBX C;  2EYF A;  1YNJ C;  1D1K A;  1KNE A;  5BN5 A;  3NQI A;  2DNC A;  1SNP A;  1IYV A;  1EY9 A;  4H13 C;  3K0Y A;  3DEP A;  3VR4 A;  5CBE E;  3Q22 A;  2JA6 B;  2MJ8 A;  1AFP A;  3C0N A;  3DHQ A;  2PPB C;  5ELF A;  1DXM A;  1EEF D;  1PTO D;  1Q90 A;  4IQZ A;  3SVM A;  4OO1 I;  3I4L A;  5M5Y B;  4EQP A;  3J81 L;  3GP7 A;  2ID0 A;  2B2W A;  3S1R B;  3NHH A;  1F2M A;  4IUR A;  3J7Y W;  1HTP A;  1QE6 A;  3Q0A A;  4HSV A;  2B2T C;  2H4O A;  3TP7 A;  4FO2 A;  1AP0 A;  1CTM A;  2F3V A;  4A3G B;  4IFD J;  3ERQ A;  2KHS A;  4IFD I;  5E4W C;  2BA1 A;  5KYL A;  5FOB B;  4A3M B;  2F0P A;  3K6O A;  4FF3 A;  4KV6 A;  4K14 A;  2PW7 A;  3OSO A;  1TWG B;  4K6L A;  2PMZ B;  1PRT C;  1H9S B;  4NW2 A;  3C2P A;  2WKD A;  5D14 A;  4EQN A;  3CQZ B;  1MGS A;  1TY2 A;  3Q6S A;  3LX0 A;  1RHP A;  3MVV A;  1WTO A;  2F0E A;  1A2T A;  5C3E B;  3M7N A;  1K8M A;  4K8J A;  2G9D A;  4O1N A;  4KTA A;  3RZO B;  4DK1 A;  2H1E A;  3RMH A;  3GTP B;  3OWE B;  5C44 B;  1BCP C;  2WV6 D;  1L0X B;  1AZP A;  4CJ1 B;  4P2C B;  4KJN A;  1RDP D;  4CBV A;  3J7A F;  2HCI A;  1ZXT A;  2G9H D;  1NR4 A;  3QJY A;  4QCL A;  3KUP A;  4PMW A;  2EY2 A;  5EPK A;  1HFN A;  1B4O A;  2M00 A;  1OXT A;  3ZYY X;  1WTQ A;  1LT4 D;  1V1P A;  2F0S A;  4G7Z C;  2F1M A;  1V1P B;  1SJH D;  4ZAI A;  4A3D B;  1I6V C;  1G2T A;  1A3T A;  2XWJ B;  5C4H A;  1SYE A;  1U4L A;  2F0G A;  1WD0 A;  4A93 B;  5JEA G;  3CRL C;  3I4M B;  1KDA A;  3J80 E;  3L3O C;  4LMQ D;  1O7Z A;  3BYT B;  1C4Q A;  4K5V A;  5ISR A;  2Q8T A;  3SK4 A;  2R3Z A;  2IJ0 A;  2F0V A;  3M85 A;  3JAM L;  1D6E C;  1AZQ A;  1PZJ D;  5FK9 C;  3TSS A;  3P7J A;  1HQR D;  1IKM A;  1JOR A;  1STH A;  4FXG C;  5KIX A;  2QDB A;  2X6L A;  4KJO A;  1VMP A;  2C5C A;  3VYT A;  1LTS D;  3DM1 A;  2EYJ A;  2JA8 B;  4X3K A;  3P1H A;  1LT5 D;  1TWA B;  2MHV A;  1U4P A;  3L7Z C;  1JIC A;  2ZXR A;  1TS5 A;  1STY A;  1PRT F;  2NTS A;  1U9R A;  1YNJ D;  2EJM A;  2RDF A;  1MSH A;  5IGB A;  1Y8O B;  4KKS A;  4ZUI A;  4FNF A;  2B2V C;  3HOV B;  2EYL A;  2F0K A;  5LL6 S;  1SYF A;  1DJR D;  1EL0 A;  4CKC A;  2K7V A;  1PDQ A;  1HPC A;  1PXU A;  5CBA E;  3BZD B;  5IIF A;  3KLS X;  4RGN A;  1PTO B;  3DWQ A;  1EOT A;  1ZYR C;  3CHB D;  1J9O A;  2XWB B;  5C5M A;  4HSP A;  3MFG A;  1W6J A;  4BWG B;  2XIW A;  3R93 A;  1EWC A;  1MD2 D;  1DM0 B;  4FF2 A;  3I8Z A;  4I7Z C;  5CR3 A;  1Z6H A;  4FXK C;  3S1Q B;  3FVQ A;  1HHV A;  1CI3 M;  2LY7 A;  5JOB A;  3MTS A;  4RCO A;  3RLF A;  3FMC A;  2ICI A;  3BYY B;  4Z9C B;  2F0I A;  3NP8 A;  1SEB D;  3ND8 A;  1D5Z C;  5CGK A;  1Z47 A;  1EY0 A;  3OW7 A;  1ZEQ X;  1STG A;  2J4X A;  1EYA A;  2XSC A;  3MXU A;  5E4X A;  4RHR A;  1AN8 A;  2K1B A;  2VNU D;  2F4I A;  1XX8 A;  4OHJ A;  2PW5 A;  2O5I C;  2XNA C;  4PMC A;  3TP8 A;  4YIJ A;  4HMI A;  3BVM A;  1J8I A;  4X3U A;  2DY8 A;  4J6H A;  3V2T A;  5C0X J;  3GV3 A;  1KAB A;  4K6D A;  4DN4 M;  4KN7 C;  4IUQ A;  3HKZ B;  3PV0 A;  2PCF B;  1BCP B;  3NPP A;  3OIQ A;  2OXP A;  1I4H A;  2Q8R E;  4QUF A;  3EJI A;  1Y8P B;  3NQT A;  1GUO A;  1H9K A;  5JVG 3;  3PO3 B;  1CQF A;  4F7X A;  4BBS B;  3NWT A;  3FPU B;  5ELD A;  4AYB B;  2OT2 A;  5M5X B;  3GV6 A;  2Q8I B;  2NN6 I;  1F2Y A;  3M3Y B;  3Q23 A;  1ICW A;  1E2Z A;  1BCP D;  4M8A A;  4EVO A;  3NTK A;  1ILQ A;  2PNR C;  4LJZ C;  3A8I E;  3GTL B;  4XYQ A;  1FNU A;  2SNM A;  1JWM D;  1HXY D;  3FEW X;  4F8M A;  4TRD A;  4F88 A;  1S5B D;  4ILW A;  1SMY D;  1JOK A;  1A15 A;  2A68 C;  2L11 A;  2O4X A;  3TP5 A;  3W2D A;  2JYO A;  1NAP A;  5D65 A;  5JVH 3;  2PQE A;  1ONL A;  2DN8 A;  1EY8 A;  1A6X A;  2WAC A;  1XYI A;  1STB A;  1CZW A;  5EBC A;  1QB5 D;  5C0X H;  5I6W A;  5ELB A;  4Y7N B;  2FIN B;  3G4N A;  1TT2 A;  3S1N B;  1EU4 A;  2EY1 A;  2YU9 B;  1DOK A;  4LK1 C;  5I9O A;  4BBR B;  1SE4 A;  4ZYS A;  1I4Q A;  3IKJ A;  3MZ5 A;  3SHL A;  4KY6 A;  5IGD A;  1R4Q B;  5JJZ A;  1JWU D;  4BY7 B;  1SJE D;  1B50 A;  1SAP A;  4ZKC B;  1SYG A;  2KUM A;  1WCM B;  5DNF A;  3VA5 A;  3C1F A;  4RFB A;  5COY A;  2XN9 C;  2ZT9 C;  1PFM A;  2LFN A;  3NXW A;  3BVZ A;  5I9P A;  2KEC A;  5DM7 3;  4IFD H;  3IL8 A;  5C4J B;  1VDZ A;  3A56 A;  4C3J B;  4ULL A;  1IW7 D;  3HOU B;  1RTO A;  2NVX B;  4CKB A;  4EGV A;  3D6W A;  1SNQ A;  5CYU A;  1EEI D;  1GUG A;  5CV7 A;  3VR5 A;  2F0J A;  1SSO A;  1CQV A;  3BG3 A;  3TDQ A;  2SNS A;  2K01 A;  3TZD A;  2J0T D;  1PFB A;  1ZYR D;  1JOQ A;  2IX3 A;  5D3I B;  4HCS A;  1BCP F;  3MWY W;  3D4W A;  5KEE A;  4N9P A;  3I72 A;  3K5O A;  3H3V C;  2Z8L A;  3M4O B;  2K5W A;  1KDC A;  1PTO H;  3KK7 A;  4H0L C;  2EZV A;  2E2J B;  4DXG A;  1U4R A;  2PZU A;  2WB1 B;  1SE3 A;  3LWU A;  3VA7 A;  3QOJ A;  1NCV A;  3MXP A;  1QNU A;  1EU3 A;  3OWF A;  4IFD G;  5EBD A;  5FKA C;  5C3W A;  1BDO A;  2C9O A;  1V8Q A;  5IGE A;  3A7A B;  3T4A C;  3D4R A;  1G91 A;  3RZD B;  3GO5 A;  1O80 A;  4IUT A;  4K2K A;  2E74 C;  4KKU A;  3U9S A;  2X6G A;  4UAI A;  2E76 C;  1STN A;  1Y1V B;  1F9P A;  1PFN A;  5A35 A;  2RVL A;  3E6Z X;  2F0W A;  3PMF A;  4FF1 A;  3VR2 A;  4QB4 A;  1PLF A;  3EFX D;  1LTA D;  5IGG A;  1G2S A;  2CHB D;  2A6H C;  1I4R A;  1ILP A;  1SYC A;  4UDU C;  4XYO A;  1I4G A;  3MAQ A;  3LNN A;  1TWH B;  4XIG S;  2Y0S B;  2Z1C A;  3NUC A;  5C6A A;  1HFG A;  1T5X D;  3PUX A;  3S14 B;  1SXT A;  4ZLT F;  3N6R A;  2D9U A;  4IUU A;  2R92 B;  1RTN A;  4FYD A;  4KN4 C;  1D5X C;  3H09 A;  4A3I B;  4B08 A;  4RGO S;  1Y69 U;  1ESR A;  3DMU A;  5D3D A;  3K5M A;  5FO8 B;  2LKV A;  3HOX B;  2V4D A;  1TS2 A;  1B3A A;  1LAB A;  3NBH A;  5CV9 A;  4Q5V A;  4KY5 A;  3VYU A;  1AEX A;  4WRD A;  3OMC A;  3O13 A;  2F0U A;  2FMC A;  2FFK B;  4XTC S;  1PMR A;  1STE A;  5I4D A;  3MA2 B;  1QCB D;  2TSS A;  1PTO F;  3EQL C;  1EZ8 A;  2K04 A;  3PIO 3;  3TBI B;  4ME5 A;  2IL8 A;  1LTB D;  1TR5 A;  1ENF A;  1QWY A;  1K83 B;  4M1U B;  2M9V A;  2FJ2 A;  1G29 1;  2A5H A;  5EPL A;  2HDM A;  1EQT A;  3T16 A;  1CT1 D;  5EKL A;  2R93 B;  2D2C C;  2BE5 D;  4IUN A;  1VMC A;  1KTK A;  2F0O A;  5FLX L;  2F03 A;  1H9M A;  2EJF C;  5C3X A;  3BVG A;  5JPN C;  4RA8 A;  1I4P A;  2RSO A;  1SBB B;  5CC4 A;  4G7O C;  1TWF B;  3C0O A;  1H9J A;  3SDZ A;  1Q1B A;  3A54 A;  1I4X A;  4OL7 A;  4ZK9 B;  2EYP A;  4E6I A;  3LWE A;  2HCC A;  3SK5 A;  1XXG A;  1LTG D;  4DFA A;  2DNE A;  3SXH A;  1Y8N B;  2VUM B;  1IHZ A;  5T1G A;  2NUC A;  2IT1 A;  1Z52 A;  1EIH A;  1OO9 B;  5T1I A;  4I65 A;  2XVS A;  3NWS A;  1F9S A;  1BOS A;  1E2V A;  1KDB A;  2A73 B;  2L5T A;  2O2L D;  2QKI C;  1F2L A;  2AWO A;  4OO1 G;  2L12 A;  2BA0 A;  1O78 A;  1W6K A;  3SK6 A;  1SYD A;  1STA A;  3HOY B;  3IFD A;  3KLS A;  4L63 B;  3ONA B;  1WTP A;  2K6A A;  4V0B A;  2IX1 A;  3S1M B;  5A2Q E;  1JB3 A;  1EY5 A;  2WIN B;  3OHX C;  5EJW A;  3C0M A;  1HA5 A;  2A6H D;  2O5J C;  1OXU A;  4BA1 I;  1DOL A;  2B63 B;  2VB2 X;  2JXM B;  5KYI A;  1ESF A;  1V1O A;  3NBI A;  1GUN A;  1SND A;  2ICE C;  5IGF A;  3HOW B;  5JEA J;  4HTH A;  4C3I B;  2L1B A;  3NK9 A;  4S3S A;  5CV6 A;  4DA2 A;  2F0Q A;  2SEB D;  1SNC A;  1KLG D;  5M5W B;  4OIJ A;  2NTT A;  5A2Q L;  1FGB D;  4G4K A;  3QB3 A;  1PRE A;  3J80 L;  1ZKO A;  4NMZ A;  1PRT B;  3AMU A;  1BXT A;  2NWG A;  1SE2 A;  2F0T A;  2K03 A;  3P75 A;  1OXX K;  5DM6 3;  2WAQ B;  2IPK D;  1LT3 D;  3S17 B;  4GZY C;  4NDX A;  2CW0 D;  5EGT A;  3X3N A;  1WD1 A;  1BO0 A;  2WII B;  5DEH A;  3VR6 A;  1TQO A;  3MHB A;  4NP5 A;  4ZKB B;  2BDO A;  2QCP X;  2ENB A;  3IAY A;  3PUZ A;  4U68 A;  2JE6 I;  1JWS D;  4K5W A;  4JK1 C;  4DAY A;  4K2L A;  2KCN A;  3FDT A;  1BQQ T;  3HRZ C;  2FMM A;  2L55 A;  5KNC A;  4K5X A;  4C3H B;  3RUZ A;  3HGB A;  1CFM A;  2K32 A;  3M4Y A;  1TVX A;  3HZX A;  3SR1 A;  1EZ6 A;  1GUW A;  3E5S A;  2A68 D;  1D1I A;  3H94 A;  1S5C D;  4R8N A;  2HUG A;  3SE0 A;  4KK7 A;  1QG7 A;  1DCZ A;  4ABN A;  1PRT D;  1WTV A;  2R7Z B;  2M2L A;  4ZUJ A;  1YNN D;  4QIW B;  2BOS A;  1GOZ A;  1H9S A;  3T13 A;  4OIK A;  5HUR A;  1NSN S;  4TSS A;  2JEA I;  3CKI B;  3OMG A;  2CW0 C;  2A6E D;  2JSO A;  2LMC B;  3J81 E;  4C3H G;  3E0J A;  5EQ0 A;  5EKK A;  4QMG A;  2J7Z A;  4C1N I;  4XXE A;  5IOD A;  1O7Y A;  4J8Q A;  5C4X B;  2B2U A;  4IUV A;  4KD3 A;  3VR3 A;  1Y1W B;  3EVQ A;  5J39 A;  1G8Z D;  3A55 A;  5FLX E;  2VXW A;  1JCK B;  3PUV A;  2LS0 1;  4L8J A;  1HUN A;  2B2Y C;  4HAE A;  1NR2 A;  1ENA A;  1FNW A;  4KI0 A;  4C2M B;  5JPM C;  1ET6 A;  4ZRZ A;  2RDG A;  2F0H A;  3A8K E;  5E3F A;  2D5D A;  2EYO A;  3Q24 A;  4R9W A;  2NBF A;  1TS4 A;  5K36 G;  2OF1 A;  4PNY A;  2B2T A;  3MXN A;  3I3C A;  3QIA A;  2F0L A;  3HG9 A;  5IOC A;  3PUW A;  3GQB A;  4BS9 A;  1WTW A;  1QIL A;  1Z7T A;  1RF2 D;  5M9O A;  2GA4 B;  2OEO A;  1BUV T;  2KVM A;  3QOL A;  1ET9 A;  3S16 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...