1PRTB

The crystal structure of pertussis toxin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 44
structure length 196
sequence length 196
chains with identical sequence H
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1prtB01
1PTOF 2AQ1B 1BCPB 1PRTB 4RCOA 1D5ZC 1BXTA 1JR0D 1ET9A 5TSSA 3BVGA 5ELFA 3DWAA 1D5MC 3SEBA 1I4PA 1MD2D 1EU4A 2J4XA 2XRQD 1CHQD 5ELDA 1V1OA 1KLGD 4DXGA 1D6EC 3O13A 1TS3A 1I4HA 1PZJD 1I4QA 1TS2A 1PRTF 1CK1A 1HTLD 2NTTA 1HQRD 1PZID 1TY2A 1SEBD 1B1ZA 1PYWD 1AW7A 1V1PA 2NTSA 2AQ2B 1S5BD 3MC0B 1JWMD 3URYA 1HA5A 1LTGD 3BVMA 1LTRD 1D5XC 2SEBD 1UUPA 1I4GA 5FK9C 2R61A 1I4XA 1PTOD 1HXYD 1ESFA 1RF2D 5D3DA 3R8BA 1BCPC 1PRTC 3BZDB 3V05A 1TY0A 4RHSA 4RGTA 2XN9C 1PTOH 1S5ED 2XRSD 4RH6A 5D3IB 1EFID 1T5XD 4O1NA 4ZYSA 1FD7D 1ENFA 3W2DA 1S5FD 1XTCD 2RDHA 3DWQA 3R2IA 3R2TA 4UDUC 4RGNA 1G8ZD 1JQYD 1LLRD 1DYQA 1LT3D 1L0XB 1CT1D 3C0MA 2G9HD 3C0OA 1BCPF 1TS5A 3KLSX 1LT5D 1GOZA 1FNVA 1FNWA 4L6TB 1SE2A 2WV6D 3G4NA 1PTOB 3CHBD 2QILA 1STEA 1LTBD 2QEJC 4C56C 2RDGA 1Z52A 1LT4D 3MFGA 1LO5D 5ELCA 5I4DA 4RGMA 1JWUD 2XNAC 1EEFD 4K6LA 1KLUD 4L63B 3TSSA 2Z8LA 1SJED 1UNSA 2IPKD 1V1PB 1SJHD 1LTSD 2IJ0A 1L0YB 1S5DD 1RCVD 2O2LD 1CHPD 1JCKB 1PZKD 1KTKA 1FNUA 5ELBA 1TS4A 1RD9D 3G4OA 3BYTB 1BCPD 1PRTD 4BWGB 3OWEB 1EWCA 1SE4A 2ICIA 1CQVA 1LTTD 4Z9CB 3EFXD 1JWSD 1LT6D 3BVZA 4RFBA 1PREA 3C0NA 1LTID 1EU3A 1PTOC 4OHJA 1B44D 3DWPA 2AQ3B 1AN8A 1ET6A 1QILA 3BYYB 3GP7A 4RGOS 4TSSA 1DJRD 2CHBD 4RHRA 1I4RA 3EA6A 1EEID 5ELEA 1S5CD 1F77A 1SBBB 1SXTA 1XXGA 1FGBD 2TSSA 5FKAC 4DXFA 1RDPD 1SE3A 1M4VA 1LTAD
chains in the Genus database with same CATH superfamily
4GKJL 4QUCA 1N8RC 3OOCA 2VQFQ 3MVVA 3HOUH 5IYDH 5FLMH 2K33A 2JEBI 2AKWB 2DY7A 3EN2A 1R9TH 4IUQA 4AYBG 4P72A 4X66Q 1SFOB 4H7BA 3NP8A 4IPCA 2OWOA 3GV3A 1VQCA 5C44B 1E24A 3K57A 1C8CA 3LWEA 1SLJA 1HNZL 4TKOB 2ZXPA 2EE1A 4BXXH 5K36H 2Z4IA 5M3MH 2BA1A 2NTTA 5JJZA 1PZID 3R93A 4O0AA 1PYBA 2N55A 2N78A 3CU7A 1O7ZA 2F0OA 2F03A 3RZDH 1X3GA 4JI8L 2R61A 2KOLA 4DA2A 3PGZA 1FVIA 4FVMA 1RF2D 4A93H 1JOQA 4K5XA 1AEXA 3VR2A 1WD0A 1DOLA 1DONA 3KOJA 3OYYA 3CQZH 5IT9c 4K0KQ 4K0KL 1E22A 1KAAA 3H3VI 2F3VA 3W5OA 1G8ZD 5C0XH 1CZGA 4XQNA 3PIPA 1L0XB 5EPKA 3PF4A 3SE0A 1ZXTA 3S17H 1Q1EA 3OSOA 2K4KA 2KQ3A 2A68D 1WTHA 2ZXRA 1PFMA 4KY6A 3S15B 4JV5L 3KDFA 3FKIH 3QOJA 4G57A 1BBUA 4JBKA 4IUVA 5EBCA 2PCFB 4YHHL 1UE7A 1WI5A 3S1RB 5E7NA 2XNAC 1XNRQ 1NSNS 1XNRL 4B3RQ 4LFBQ 1GVPA 4B3RL 4LFBL 1K0SA 2R7ZH 1X3EA 1V1PB 1MJCA 5CV4A 1BUVT 2IX1A 3T13A 4CDCC 2UXCQ 1STAA 2UXCL 4CKEA 3NPPA 5IGEA 2UUBQ 3GTOH 3K0YA 4HIKA 3WWVA 1OXXK 1SE4A 1LTTD 4Z9CB 4K14A 5M5YH 2OXPA 3I8ZA 1KQSA 5BN3A 3C0NA 2CH4W 2L5TA 1TWAH 1IL8A 4RHRA 1G2SA 2EYFA 4FF4A 3EA6A 5JPNC 2JQOA 5J39A 1RDPD 3P20A 1VF7A 4NPSA 2JA7B 2AQ1B 1DZ1A 2A5HA 2B2WC 1TWCH 1ET9A 2ZXOA 1RIPA 5ELFA 1A15A 2PO4A 4A3BG 1WCMH 3TZUA 2JA6H 1ENAA 2JA5B 3K5LA 2NZHA 2PQAB 2ZTDA 4OL7A 1EYCA 1PH9A 1MKHA 1EZ8A 4DXGA 1D6EC 2A69D 4A3KH 5JJLA 4H02A 5M5WB 1V1PA 2VXWA 5D65A 3K81C 2PW7A 1XYIA 1CA6A 4GLVB 2BCOA 2WKDA 4MTKA 5M3FH 4GNXB 4C3JB 1ESFA 2Z0SA 1G2TA 1PFBA 1X6OA 4GS3A 4AQYQ 4GN3B 2R93G 1U9RA 1HHVA 3I4NB 1VMCA 4P74A 3DEPA 3DWQA 4IFDI 3D6WA 3TEHB 4GOPB 4IUPA 1MHWC 1J5EQ 2Q2IA 1FNWA 5EKLA 2HD3A 4BS9A 3PMFA 3A8JE 3M9BA 5GAHC 1AH9A 2MP1A 2R7FA 1T9HA 1Z52A 3E0JA 1LO5D 1YNND 3QR8A 1IBKL 1IBKQ 4UHVA 3GTLH 1Q3LA 2HQLA 1R9TB 2F0GA 4O42A 1ZYRC 3I3CA 2PQAA 1JE5A 3M4OH 1E2WA 3S2DB 4PMCA 1HZ9A 1UNSA 5IE8A 3S24A 3GTQH 2QDBA 1V8QA 2HHHQ 2CKZB 5KIXA 1B2TA 4G7OC 2F4VQ 1F9PA 4DV6L 3EROA 4L5SA 2D2CC 3HP3A 4NXNL 1UE1A 4HMIA 1QZHA 3UDXA 3AEVA 2L1BA 4DNRB 1JWSD 1J6QA 1NMGA 3RZDB 2XVSA 1LTID 4GNXA 3KYHC 4DUYL 3RZOH 4N9TA 2E2HH 1PYSB 2NN6G 5IP9G 1QOHA 3CQZB 1G291 3D8GA 1Z47A 4DAYB 1L1OB 5I6WA 1LTAD 2C35B 3HOXH 4KJOA 3HOVH 1U0LA 4U68A 3MA2B 1Y1WB 4L5TA 4G4KA 4DV7L 1IKLA 3BDOA 1KC8C 3SEBA 1XNQQ 3GTJB 2F1MA 2J0TD 3JAMc 4MTNA 1B53A 3W1GA 2F0DA 1HQRD 4R9WA 2R7ZB 2RVLA 4R4TA 4GLXA 2PMZE 3I4MG 1LTRD 1WYDA 4C3HH 3P7JA 1PH4A 1TU2B 4JI3Q 3DEOA 3NEMA 1XPOA 1SNCA 4JK1C 4X65Q 4X65L 3TN2A 4V0BA 2FHTA 3S14H 1OTCA 2BA0A 1TWHH 1ENFA 4A3DB 1TIID 2A6HD 3K58A 4R8IA 2PZUA 3CCUA 3KLSX 3R3OA 2EZVA 4LF4L 2KECA 1IYVA 1K28A 1K9MC 5IT9L 4DAYA 1L1OA 1XX8A 3OIQA 3AYHB 4A3IH 1VQ9A 2K5HA 3PIP3 1VMPA 2HIXA 3A5ZB 3KBXA 3M3YH 1KABA 2GVBA 5FJ8G 4CJ0B 3BG3A 2IY5B 3RMHA 1U4LA 2N49A 1WCMB 1EFWA 3HOYG 2VZAA 3S1QH 3KLRA 1VQ6A 4DR3Q 5H1SE 3CKIB 4HEDA 3M7GA 3CCRA 2IPKD 4JI7Q 4LUVA 4JI7L 1PMRA 1F9RA 4A3KB 1PXUA 1CSPA 1RJTA 4ZK9B 3L9AX 1VQGA 1Z7TA 3C1EA 2E76C 4ZKBB 3OWEB 2AMCB 2BE5C 2BH8A 2HQEA 4ZUIA 3HOZB 2LXKA 3J81E 2K32A 3ND9A 1ICWA 5M3FB 3GD7A 4IUTA 1STGA 1LUZA 2K05A 1MSHA 5LMNL 1EQRA 4MN3A 1CSQA 3I2ZA 1BBWA 2RDFA 3DM3A 3U9SA 5DLQE 2EYJA 5DNFA 4X62Q 3C3LA 4IJHA 4X62L 3LX0A 1X54A 3OPOA 2B63H 3T1HL 4DV5Q 1EY7A 1HCZA 1X3PA 1E1TA 4F7XA 1PH6A 5IY0A 2A74C 1AFPA 1B9NA 3PUYA 2JSOA 1MD2D 2VB2X 5KGUA 1Z9FA 1MGSA 2RCNA 3STBD 2I0QA 1PDQA 5IGBA 3K80C 5JEAJ 1PRTF 2KA7A 2KHSA 5T1IA 4LF6Q 4LF6L 3ERSX 1Y1VG 5JOBA 3GTQB 1E0BA 1JWMD 5I9OA 1KD1C 2KCMA 2E2JB 1JORA 2R93H 3SK8A 3HOUG 3AQQA 2MNAA 5IYDG 5FLMG 4AIMA 4JW0A 1TY0A 5FOBB 4KHVA 4WORA 3GV6A 1NTGA 2R92H 1WOCA 4JPBW 1B9MA 1FD7D 2Z6BA 2QKIC 3QO2A 3W2DA 1XTCD 4HIOA 2E2DC 3GTGH 4LMQD 2HT1A 5GROA 4LK1C 4EQ5A 4HSPA 4TRDA 4BXXG 3OWFA 5JJIA 5M3MG 3M4QA 1FNVA 4N8FA 3OW7A 4R4CA 4DKAC 1CKOA 4GN5A 1TKWB 2B2TC 2F0WA 1BO0A 4AYBB 4PNYA 4NB3A 2CVRA 4A93G 4FF3A 1EQVA 1LYLA 1SYCA 3CCSA 1BDOA 4IPHA 4IOCA 2C5CA 1G51A 2IJ0A 1QG7A 5C0XG 1RCVD 1CHPD 1H95A 1WTPA 2EPBA 4DR6Q 2IT1A 1FGUA 4I7AA 3CW2C 5KNDA 4KN4C 3FKIG 4B3MQ 4CDEC 3NSWA 2NN6H 4A3FG 1VQKA 1PTOC 1X32A 5IP9H 5IYBH 5IWAL 4LF7Q 1S3OA 4LF7L 4OX9L 1N33L 3MEFA 2E5LQ 4RWSC 3RLOA 1KDBA 3S14B 1VQHA 5ELEA 3K7AH 1KIXA 3Q22A 2SOBA 1DM0B 1YNXA 2ZJQA 2EYMA 4H0LC 2MJ8A 3HZXA 3SVMA 3A0JA 4YIJA 3CMEA 3D6CA 1UEBA 3BVGA 1Y8NB 1QNKA 3HEJA 3OW2A 4OEMB 3H09A 4R4IA 5ELDA 3CXCA 2ZT9C 3MAQA 1KLGD 3TREA 3L2PA 5JEAG 4DK1A 2LFNA 1MJEA 4LJZC 3A7AB 1EWHA 5BN5A 3J7A5 2EYHA 2CWPA 1VCIA 1I50H 1PYWD 5LMNW 2ZM6L 1AW7A 3MXNB 3I4MH 1HJPA 1TWGH 1W3SA 3JAML 1OXTA 1S5BD 2A6EC 1ILPA 1RHPA 1CKNB 1E2ZA 1SNQA 1W6KA 1P16A 2D0OA 4JBMA 1DD2A 3Q0AA 1LACA 1S5ED 4RH6A 4A4IA 4ZQ3A 4O1NA 4FXKC 3A8IE 4QIWE 2JA6G 2VQEQ 5M5XB 3SHLA 1GUOA 4APVA 1H9SB 3V2TA 3IL8A 2KHIA 1HNWL 1STHA 4KMUC 2WV6D 1NJIC 1QZGA 4YY3Q 2RKSA 1YHAA 5BR8Q 1A8VA 5BR8L 2A73B 3B6YA 2YTXA 2RBMA 4KV6A 1WD1A 4A3BB 1G6ZA 2M00A 2K52A 4JI6L 2AUKA 5J1ZA 3NQTA 1Q8IA 5CBEE 2JYOA 5EAYA 4OWXB 2F0TA 3IAYA 3T4AC 3H0GH 4IJLA 4OIJA 3HS0C 3SXHA 1TS4A 1BCPD 3NBIA 3KBGA 3MXNA 1GO3E 1M8AA 2RF4A 4ILWA 1RTOA 3EBEA 1CKNA 1HRJA 2F0KA 2R93B 3S1MB 2KENA 2Q8RE 5GAGC 1ET6A 4A3EH 4J6HA 4YWKA 1E7ZA 1XXGA 2BDNA 2X6GA 4C1NK 4ZKCB 3BZKA 4QQBX 1B3QA 4JYAL 1C4QA 1H9SA 2VUMH 3E5SA 4J8QA 1B50A 4DAPA 4NMZA 2PI2A 1O7IA 2PYKA 4DR4L 5EQ0A 4NP5A 1DXMA 2ID0A 4FYDA 4DV2L 1SNOA 3RNUA 4JI2L 1A62A 1TS2A 4OIKA 1ONLA 1O7LA 4DV0Q 2NTSA 3GTKB 2VQFL 1HA5A 1LTGD 3BVMA 4RMFA 1D1KA 1SN8A 3HOXG 1I4XA 2PZTA 1P8LA 5J3BA 3TRZA 2F0QA 3E9HA 1YNJD 1A3VA 4IPDA 2QW7A 3HOVG 4X66L 1EIYB 1VS0A 3NK9A 4KTAA 3L3OC 5A35A 4KK7A 1TWFB 5HURA 1CM9A 4XXEA 1Y8OB 4LUOA 4QUFA 3RLNA 4Y7NH 2FXQA 1BCPF 3G6EA 1K8OA 3K7AB 4EX5A 3G4NA 2Y0SE 2IL8A 2YTYA 3A54A 3H3VC 3UDIA 4HIDA 4JVZA 5LL6S 4C3HG 1NNXA 5IODA 3VYRA 1EEFD 3U4ZA 1II3A 4GNXC 4OONA 1HZCA 3K0XA 1GJXA 4U673 5C3XA 3PUXA 1IZ6A 3N6RA 3HKZE 2WB1E 3M7NA 1NUCA 1EQTA 4P2CB 4DV3Q 3W3AA 4DV3L 4DV1Q 4DV1L 1S40A 2R7DA 3MFYA 3I4MB 2AUJD 1TWGB 2ENBA 2ZTCA 4A3FH 2D62A 1CQFA 1PREA 3PIOA 4A3IG 1Q81C 1X3QA 2M9VA 4KD4A 3DWPA 5CORA 1QVFA 4A3GG 2RHSB 2F0NA 4HJ9A 1SXTA 1FGBD 3MWYW 4MIUA 4KKUA 5A2QL 1TS3A 3MHBA 2VS1A 4TVAB 1JOOA 2UUBL 3X3NA 3PQIA 4DGZA 2WKCA 3VA5A 3A7LA 2WINB 2VNUD 3SK5A 1EY5A 1EIFA 2EIFA 4HSVA 1VQMA 3PO3G 1EU4A 5JEAH 3E0EA 4X3SA 3TP7A 1YJ9A 3HOYB 4PMBA 1GUWA 1E2VA 2WAQE 2NBFA 5CGKA 2X69A 4LF9Q 4IUUA 3WDNA 4RKLA 2F0UA 1HZAA 4ALPA 4FF2A 3MC0B 1GUTA 1K83H 2NYZD 4OWWB 2B63G 4DNIA 1L1OC 2K28A 3GTPH 1HXYD 5FLXE 5M9OA 2YV5A 5AFWA 3V05A 2EY2A 1KNAA 4ULLA 1D8LA 1VQLA 1ZKOA 5C0XI 1Q7YC 1JQYD 4V190 3DM1A 1JT8A 4C2MB 4QL5A 3QG1A 1GHKA 3NWSA 1X56A 2ALYB 4J15A 1AZQA 5JPMC 4POFA 4IPGA 1STEA 2K50A 1KXLA 3DUZA 1LT4D 2RCFA 3WOFA 4KHZA 1K0RA 5ELNA 4RGMA 3RUZA 4AQYL 5DM63 2OT2A 2ZTEA 1X65A 3FEWX 4UP8A 3S1NB 1VDZA 2R92G 2JP1A 3ER0A 1SJED 3D3RA 2Q2HA 4A3JH 2QDLA 4R4OA 1N36Q 1Z6HA 1J5EL 3F2UA 1BOSA 5KNBA 3NTHA 1MSGA 1PZKD 1Y1VB 3G4OA 2NVTH 3T16A 1BQQT 1BKBA 3BDLA 4M1UB 3F8TA 2UUCQ 1XPUA 1SYGA 3HOUB 4F87A 4KD3A 2AWNA 4LWCA 2JK8A 4LAAA 3L7ZC 4AH6A 1VF5C 5C4XH 1A3UA 2QF7A 4IALA 1PH2A 3LGJA 3NENA 2D0PA 4FXGC 5E4WC 4DR7Q 5M3MB 2HHHL 4RCOA 1BCPB 1LTLA 4Y7NB 1YI2A 3UI2A 2F4VL 1IW7C 2N88A 3TBIB 2A68C 2NZOA 5C4JH 1GUNA 3CCJA 2B2VC 1VQAA 1VQ8A 1PV4A 4X64Q 2WP8J 1I4PA 2QCPX 2JA8H 3F2DA 2YU9H 4A93B 1JICA 4OXPA 2DNCA 3KJOA 1SR3A 1VQOA 5IYBG 2G9DA 2DNEA 4KJNA 1CK1A 1IXRA 1SSOA 5ISRA 1TY2A 2ASBA 3QWNA 1K3BC 2AQ2B 4GOPA 5JVH3 3CRLC 5ELOA 3S17B 4CBVA 1BF4A 2OQ0A 2CH4A 1X55A 3FKIB 1N32Q 1N32L 2KUMA 1MI2A 5JAVA 3PF5A 1XNQL 2F0IA 1TQOA 4A3FB 1H9KA 4FP5D 4LW1A 1PHJA 4HJ7A 1SAPA 2FMMA 4YWMA 3TP8A 2NVXH 1UAPA 4UP7A 5AJ3Q 1JB7A 3I4OA 1GXDC 3ND8A 1PH7A 1O78A 3J80E 3PUWA 2QILA 4C3IH 1Q82C 2RDGA 1KDCA 1V1QA 1W2BA 1K8AC 4JI3L 4G7ZC 3GTOB 5DAUA 2KCCA 3HGBA 4RA8A 5I4DA 4A75A 4XQQA 3HOWH 3EJIA 3CCMA 3ERQA 3HRZC 5M5YB 5I9PA 4QF4A 4CKCA 5FO9B 3FPUB 2Q2UA 1WFQA 5EGTA 1TWAB 2A69C 1L0YB 3NUCA 2CW0D 3FHWA 3S2HH 2O2LD 3NE5B 4JI0Q 4OO1H 2EOTA 4EQOA 4LUZA 4A3MG 1PRTD 2K5WA 2B2UA 1SMYD 2YYZA 3OHXC 4X3UA 1PH8A 3D0FA 4YCVA 4MNOA 4A3GH 1TWCB 4K2KA 2RHQB 1B44D 2XIWA 4OHJA 2B29A 3GP7A 1FJGQ 2XWBB 5GQOA 1FJGL 1E1OA 4ZRZA 2JA6B 3J7AF 2I5HA 2JE6I 2LKVA 3ONAB 4DR3L 4E6IA 4N8X1 2TSSA 2OQKA 2MPMA 2FJ2A 2OCEA 2F0EA 2EYOA 3HFZB 1I5FA 3PIO3 4JBJA 3I55A 3H0GG 2L15A 4HIMA 4LFCQ 1ILQA 1PH5A 3PO3H 1JMCA 3J81c 1XMQQ 2EVBA 4K5WA 4POGA 1A0IA 3Q23A 2E75C 5C4ZA 2GN5A 3K7UC 1SNMA 2K7VA 3K5MA 1YNNC 1VQ4A 4JI5Q 3A5UA 4RG1A 4NDXA 4A3EG 1I4QA 1YVCA 3CRKC 1B1ZA 4NW2A 2EY1A 1QE6A 1HQMC 3URYA 4DV5L 1D5XC 3DMUA 2CWAA 3S9WA 1M90C 1I4GA 5FK9C 3TP6A 2VUMG 3GDEA 4HTHA 3D4RA 1RKNA 3KLSA 3E9IA 3H15A 4DAVA 2H4OA 3GTLB 3EQLC 4I65A 4BY7H 4Q0FA 2P5ZX 5COYA 3DXJC 2Q8IB 3AFPA 3M4OB 2IWHA 3J81i 4IFDJ 4P71A 3Q6SA 1HUMA 2B2VA 4B9WA 3T1YQ 2LMCB 5IOCA 3T1YL 5HGTA 5ELCA 1EWIA 1D2BA 1J9OA 2IHEA 2XSCA 1EUJA 5C4JB 4DPGA 2XTIA 2GA4B 1NMFA 1STBA 4MHEA 1B8AA 3RZOB 4CJ1B 4JBWA 2E2HB 5CR3A 1VQ7A 2MO0A 1RD9D 1HNXQ 1EYGA 2SDFA 3OMGA 3HOXB 1FYCA 1NR2A 2M2LA 1QVGA 1PH3A 3HOVB 1WTQA 3F1ZA 3GTMH 1AZPA 2L11A 2RSOA 4UY8C 2KHJA 1YEZA 2A6HC 1M4VA 4IN3A 2C9OA 3S16H 3LNNA 3FDTA 2NVXB 2A1AA 2EY5A 3F2CA 3PO2H 4BBRH 1IKMA 3VA7A 2MO1A 3DWAA 1SROA 4DR6L 1D5MC 5IYCH 2PPBC 2KCTA 5IGCA 3U58A 4B3ML 2E74C 4C3HB 2N3SA 1G91A 3CCQA 1I6HH 3UDGA 1EY8A 2L9HA 2E5LL 2UUAQ 1TWHB 2UUAL 4XQJA 2IX3A 1U4MA 1TT2A 5D3DA 2WIIB 3KF8B 2I5LX 2IHFA 4A3IB 3I4LA 1EFID 4I7ZC 2RDHA 2FMCA 3LWUA 3M3YB 2CQOA 4A3GB 2UXBQ 4WJ4A 5FO7B 1LT3D 1HTPA 4TQUS 2K14A 2E8GA 2KCNA 3S1QB 4IFDG 3H91A 3P75A 1SE2A 2I46A 4CDDC 5G3LF 4HCSA 4BY1G 2K5VA 2QEJC 1KRSA 1R4QB 3W1BA 2RQXA 1M1KC 3K5OA 3PO3B 1L0WA 4DR2Q 2UXDQ 4UPAA 3TS2A 1NR4A 3P1HA 4CDFC 4FDBA 4L8JA 5NUCA 2FINB 4CJ2C 5KYLA 2VQEL 1N9WA 3S15H 3STBC 5IIFA 4JI1Q 1CUKA 1S5DD 2H5XA 2YTVA 1S72A 4A3MH 1KTKA 3KK7A 1I3QH 2NVYH 1HH2P 2OTLA 2O5IC 4YY3L 3H6MA 2ICIA 3S1RH 3SR1A 5E3FA 1PVOA 2B63B 2VB3X 1U4PA 5LMUQ 1DOKA 1STYA 5LMUL 2NN6I 1JB3A 4NKLA 1WTRA 1EYDA 1CI3M 3KF8A 1RTNA 1I4RA 1SBBB 2HUGA 3G48A 3A56A 1B70B 3RN2A 1NY4A 1PRTB 4A3JG 4KKSA 3G4SA 2DJFC 4LF5Q 1BXTA 4FNFA 4LF5L 3AMUA 3VYTA 3OTOQ 3VR4A 4A3CH 1CHQD 4ZCKA 4RKBA 4DK6C 1DCZA 4HN7A 2JA7H 1QNUA 1NCVA 4DFAA 1PZJD 1BR9A 2R92B 3J81L 5C3EG 3J7ZC 5E1FA 5C4XG 2PQEA 1OXUA 3NQIA 4AYBE 3GTGB 5I2XA 5CBAE 1JJGA 3G71A 1H9RA 5C6AA 3QJYA 2NVQH 4DUZQ 5IGFA 5L37A 1UUPA 5CV7A 1WTXA 1HR0Q 1ML0D 2EXZA 3BZDB 1PFNA 4XT3B 4PQXA 1T5XD 5JVG3 4GZYC 1A2UA 3R2IA 5M5WH 3VR3A 1WTOA 1LLRD 4WJWA 2JA8G 2PW5A 3C0OA 1Q12A 3I72A 4DV0L 3PUVA 4C3JH 2MUYA 3BS1A 1SE8A 4YCWA 3CHBD 2EXDA 3MZ5A 3MFGA 3X3MA 4BA2I 4KHPQ 4KHPL 1TXYA 1F2MA 3PV0A 4JC0A 1EY4A 3I91A 4JOIA 3KDFB 1LTSD 1YHBA 5DM73 1PH1A 1I6VC 3RLFA 5KYIA 2L4NA 1UEAB 3FMCA 3EVQA 1VQNA 3I70A 2F0MA 4X6AH 1EY6A 1VQJA 2PNRC 2V1CC 4M8AA 4C3IG 5HGQA 1HNZQ 3S2DH 1Y69U 3EIVA 3U4VA 5EKKA 4RGOS 1HUNA 1HA6A 3MTSA 1OO9B 3HOWG 1EEID 1S5CD 2K5QA 4X3TA 2R3ZA 5CV6A 5EPJA 4JI8Q 2K01A 2Z1CA 1I50B 4OO1G 4GOPC 3ULJA 2N8NA 1KHIA 1CA5A 2EJFC 2KBNA 3A55A 1ZYRD 4R1JA 2LSSA 1Q86C 2J4XA 2XRQD 5C3WA 2PI2E 3BZCA 5IT9E 1LV9A 1TVXA 3O13A 3MXGA 5KNCA 1HTLD 2VW9A 1YIJA 1A3TA 1IW7D 1U5KA 3TQYA 1GHJA 1Y1WH 4JV5Q 1SYEA 2IX0A 3PCOB 5HY6A 1WTWA 3IKJA 2L55A 3GTJH 1QJOA 4MZ9A 4A3MB 4PG3A 4YHHQ 1EYAA 1EOTA 1AE3A 3T56B 1I3QB 2NVYB 3R8BA 1BCPC 3NTIA 4YWLA 2Q8TA 2Y0SG 2I5MX 2ZJPA 4UDUC 4XIGS 4IQZA 3Q8DA 4IFDH 1G6PA 2G9HD 1YZ6A 2E2IH 1RL2A 4LF9L 3U50C 3CAMA 5JJKA 4BY1H 1EIHA 1EY9A 2CQAA 2V4DA 3MXUA 1L2FA 4GLAC 1XMOQ 3HKZG 1QVCA 2WB1G 1LTBD 3FP9A 5C5MA 3SDZA 3H0GB 4K2LA 5FLXc 1XMOL 1GM5A 4A3DH 4FF1A 3DHQA 2B2UC 3E3XA 1UE6A 2PMZB 3QIAA 1WJJA 2Z6KA 2WACA 3DLLA 3I73A 1HR0W 3RN5A 2Z8LA 4BBSG 4GKKQ 4ABNA 4GKKL 4A3EB 4DR1Q 4DR1L 4HAEA 2JXMB 3CD6A 1D7QA 4BY7G 1C9OA 1JCKB 3RR5A 1K3RA 3IRBA 1Q46A 5CV9A 2IW3A 5C5LA 2G5DA 3BYTB 1E3PA 1YJNA 1CQVA 2VUMB 2NVQB 1LT6D 2MGSA 4RFBA 4ZUJA 3CC7A 4ME3A 2F3WA 2EY6A 1YNJC 2DN8A 4JCVE 3V96A 1A2TA 3CPFA 2SNSA 1F77A 5DEHA 1K8MA 3T51B 2HCIA 4ZAIA 3NELA 4JG2A 5FO8B 1KNEA 2JJQA 2NUCA 1N36L 3WOEA 1QCBD 1EOVA 3MXPA 1EQQA 3K59A 1DOMA 3HOZH 2WAQG 4OGQC 1SDFA 3JC66 1OXVA 3FRPB 1UE5A 2Z9HA 4X3KA 5TSSA 4DV4Q 2ATWA 4DV4L 4CKBA 3I7FA 2UUCL 1UWVA 2K75A 2CCZA 4K8IA 1V1OA 1H9JA 1AE2A 3GQBA 4WFN3 1QWYA 2L0CA 5C3EH 1I4HA 2B2YA 5IP7H 3FVQA 2J7ZA 2XWJB 4C1NI 1D1IA 4DR7L 2BE5D 1C48A 5F2DA 1VQDA 5CYUA 1EIGA 1HFGA 1C7YA 2NZ1D 1KRTA 4F88A 2RA4A 3PO2G 4BBRG 2D9UA 2Z4HA 3TMEA 3CP0A 4X64L 5D3IB 5IYCG 3A8KE 3K6OA 4O2DA 1SNDA 3UE0A 1RODA 4BA1I 1O7YA 2F4IA 3R2TA 4PZ7A 4RAUC 5KRUA 4ME5A 1JJ2A 1IBMQ 3D4WA 2H1EA 1IBML 3IFTA 4HCEA 2PZWA 1TS5A 2E2JH 4DV6Q 1B3AA 4NXNQ 3ULLA 2O5JC 4ZLTF 4GN4B 5J22A 1BNZA 2K1BA 4C56C 4FXDA 2A8VA 5C44G 3KFUA 4DUYQ 3TS0A 5BN4A 2AWOA 1H9MA 1IL2A 1B4OA 4L63B 3BJUA 1GUSA 2F3IA 2Q2TA 3BU2A 2B8GA 4G7HC 1QUQB 3PSIA 5CV8A 5AJ3L 1VQIA 3J80c 1Q8KA 2K5NA 4BWGB 4A3LG 3F2BA 4DV7Q 4OWTB 1IYJB 2EJGC 3EFXD 2XGTA 5KEEA 1PLFA 4N9PA 1EU3A 3ULPA 4K5VA 4P73A 3JAME 4EQPA 3AFQA 1HPCA 1FR3A 2DJGC 4XDXA 5I2YA 1C0AA 4KY7A 5CV5A 4J1MA 1MIUA 1KDAA 2E2IB 4JI0L 1WTVA 2K04A 4B3SQ 4B3SL 4R8NA 4DNTB 1X3FA 3HKSA 3FPPA 4PMWA 5EBDA 4F8MA 4BY1B 3NWTA 1K83B 3BDCA 2EJMA 3M85A 5GADC 3PUZA 4EVOA 1EZ6A 3GTPB 2SNMA 3T53B 3J81j 4LF8Q 4LF8L 4CGYB 3J80i 3NHHA 1ENCA 1VQFA 4LF4Q 1IBLQ 4RCNA 1IBLL 2B2WA 2ES2A 4Q5VA 4EGVA 1CKMA 1CFMA 1QUQA 1HZBA 2DUDA 1GD7A 3JAMi 3NBHB 2NB0A 1ZEQX 5T1GA 3UDFA 1PTOD 4LFCL 3A74A 4IO9A 1XMQL 4RHSA 5IGGA 1EL0A 2F0VA 2XRSD 4IZ8A 4DK3C 4A3CG 3K8AA 1VQ5A 1SNPA 4JI5L 1YHQA 1EY0A 2LXJA 1CT1D 1PA6A 1HFNA 4ODGA 1O80A 2F0FA 2JA7G 2VL6A 1GOZA 3N52A 5C0XJ 3G7LA 3SK4A 4S3SA 2KVMA 4A3JB 1N34Q 1Q90A 5D14A 1N34L 3C1FA 4QCLA 2JA5G 2NVTB 5M5XH 1JWUD 5LMNQ 2RSNA 5C4HA 1ESRA 3KJPA 4BBSH 3C46A 3TDQA 1U4RA 5FLXL 2TMPA 2A6ED 1J8IA 2B3GA 5C3EB 3T1HQ 2F52A 4OO1I 3KF6B 5C4XB 1JOKA 3G6JB 4CHTB 4QIWB 3NTKA 1YJWA 4A3BH 2I07B 4QB4A 4KKTA 1EWCA 4C3JG 3BVZA 3NBHA 2HDLA 2OF1A 3IFDA 3I4NG 3D4DA 1SYDA 4ID6A 4YCUA 1DJRD 2CHBD 1JE4A 2HDMA 2K03A 2PNHA 4WRDA 3SK6A 2EYPA 1IHZA 2JA8B 4DK0A 4DXFA 2YU9B 2B8FA 2KEEA 2HIVA 1SE3A 1PTOH 3J7YW 3VR5A 1PTOF 3U9OA 1Q1BA 1CZWA 1D5ZC 5IGDA 3CC4A 1A6XA 3RD4A 1JR0D 1BVSA 4HJ5A 1CTMA 4UAIA 1HNXL 3S1MH 4IUNA 3KUPA 3MEHA 1B7YB 3CCLA 4HMJA 5G3LD 2MHVA 3OIPA 4WJ3M 3VR6A 2EDGA 1YBYA 2JA9A 2FFKB 3ITPA 4Y52H 1V9PA 5K36G 1A63A 1SEBD 4QJFA 1GUGA 2X6LA 3VDYA 4IOAA 2HCCA 3KF6A 2CW0C 2SEBD 4H44C 1XPRA 3TZDA 1XWEA 4PZ8A 1PRTC 4RGTA 3CC2A 1SMYC 4C3IB 1W6JA 3CF5A 2JEAI 2QA4A 1SYBA 2O4XA 3HOWB 3C0MA 3UE1A 5EKIA 3GTKH 3K5NA 1R4PB 5I6YA 4QGUA 1IYUA 4JOIC 1YITA 1SRUA 2KJXA 2QEXA 1Y1WG 1SFOH 2GVAA 5C44H 3S2HB 1JC7A 2F0LA 1SYFA 1TWFH 3VYSA 2BOSA 3L0OA 4LNQA 1STNA 4DR5Q 1FL0A 5IWAQ 3E6ZX 4HR7B 4DR5L 1WVLA 5A2QE 4OX9Q 1N33Q 2EQSA 4K6LA 1MBYA 2WFWA 5EJWA 5CMDA 2K6AA 4UP9A 2UXBL 3NXWA 3D31A 2R7ZG 4B08A 1NBWA 3CMAA 2EYLA 4A3LH 1FNUA 5ELBA 2F0PA 2UU9Q 1SMXA 2UU9L 5EPLA 1F2LA 4R4QA 4KY5A 3CPWA 1VQPA 5CC4A 4L5RC 2Y0SB 1AN8A 4TSSA 1QILA 3BYYB 3J80L 4DR2L 1LABA 4A3DG 2UXDL 2LY7A 4DAMA 3H94A 5K5PA 1V43A 2BDOA 2L12A 1I94Q 5FKAC 1I94L 2F0SA 5LL6X 2ZM6Q 4HJAA 4JI1L 2MFIA 1XJVA 3OMCA 4QMGA 1JJCB 3AU7A 2DY8A 2QGQA 1T5EA 2WB1B 3HKZB 4DN4M 4PV1C 4A76A 1LM0A 1F2YA 1KL9A 1WCMG 2OTJA 1QB5D 4BBSB 4K6DA 4KN7C 4A3KG 1HNWQ 2KEDA 1XTDA 3AB9A 4BY7B 1X9NA 3M4YA 4IURA 2LS01 5FJ8H 3HOZG 4XT1B 4OELB 3CCVA 3OTOL 4JI4Q 4JI4L 5M3FG 4NXMQ 3HOYH 1S4ZA 1F9SA 4NXML 1ASYA 2XN9C 3QOLA 3SGIA 4JI6Q 4ZYSA 1S5FD 2CFMA 3HG9A 2DGYA 4RGNA 1K8GA 1ASZA 2ICEC 1DYQA 1VQEA 4XTCS 4XYOA 2Z6KC 5E4XA 5GAEC 1NE3A 2JN4A 2ZJRA 1LT5D 4XYQA 2R6GA 4PZ6A 4L6TB 5IP7G 1OXSC 1NAPA 4DF7A 2A19A 2VY3A 1PTOB 4DU9A 2WAQB 1KAWA 4B9XA 3C2PA 1ICFB 4LFAQ 4DUZL 2JA5H 4LFAL 2NWGA 2OEOA 3ZYYX 4HJ8A 1F9QA 1HR0L 2AHOB 3ZJYC 1K73C 1Y14B 4FO2A 4C2MH 2F0JA 2K5DA 3M4PA 3VYUA 1KLUD 4L5QA 2BH2A 2MQHA 3H3VH 2F0HA 3TSSA 3KLWA 1SJHD 4JYAQ 3GTMB 4KI0A 3TP5A 4B3TQ 4B3TL 2D5DA 2B2TA 2B39A 3Q24A 3ICEA 3QB3A 4DR4Q 3S16B 3CCEA 3I56A 3I4NH 1F2ZA 4EQNA 3S1NH 1Y8PB 3PO2B 4BBRB 4P75A 2AQ3B 4KLKA 1BBXC 4DV2Q 3J7AV 1TR5A 4JI2Q 4K8JA 1DGSA 5LHY1 1VQBA 1Y1VH 1AP0A 3GO5A 1GKHA 1PFSA 3I90A 4QY7A 1I6HB 4H13C 2B2YC 4GKJQ
chains in the Genus database with same CATH topology
4QUCA 3OOCA 3MVVA 2K33A 2JEBI 2DY7A 4IUQA 1SFOB 4H7BA 3NP8A 3GV3A 5C44B 3K57A 1C8CA 3LWEA 4TKOB 2ZXPA 2EE1A 5K36H 2Z4IA 2BA1A 2NTTA 5JJZA 1PZID 3R93A 2N55A 3CU7A 1O7ZA 2F0OA 2F03A 2R61A 2KOLA 4DA2A 4FVMA 1RF2D 1JOQA 4K5XA 1AEXA 3VR2A 1WD0A 1DOLA 1DONA 1KAAA 2F3VA 1G8ZD 5C0XH 1CZGA 4XQNA 1L0XB 5EPKA 3SE0A 1ZXTA 1Q1EA 3OSOA 2KQ3A 2A68D 3S15B 2ZXRA 1PFMA 4KY6A 3QOJA 4G57A 4IUVA 5EBCA 2PCFB 3S1RB 2XNAC 1NSNS 1V1PB 5CV4A 2IX1A 1BUVT 3T13A 1STAA 4CKEA 3NPPA 5IGEA 3K0YA 1OXXK 1SE4A 1LTTD 4Z9CB 4K14A 2OXPA 3I8ZA 5BN3A 3C0NA 2L5TA 1IL8A 4RHRA 1G2SA 2EYFA 4FF4A 3EA6A 5JPNC 5J39A 1RDPD 3P20A 1VF7A 2JA7B 2AQ1B 1DZ1A 2A5HA 2B2WC 1ET9A 2ZXOA 5ELFA 1A15A 2PO4A 3TZUA 1ENAA 2JA5B 3K5LA 4OL7A 1EYCA 1EZ8A 4DXGA 1D6EC 2A69D 5M5WB 1V1PA 2VXWA 5D65A 2PW7A 1XYIA 1CA6A 2BCOA 2WKDA 4C3JB 1ESFA 1G2TA 1PFBA 1U9RA 1HHVA 3I4NB 1VMCA 3DEPA 3DWQA 4IFDI 3D6WA 4IUPA 1FNWA 5EKLA 4BS9A 3PMFA 3A8JE 2MP1A 1Z52A 3E0JA 1LO5D 1YNND 1Q3LA 1R9TB 2F0GA 4O42A 1ZYRC 3I3CA 1E2WA 3S2DB 4PMCA 1UNSA 2QDBA 1V8QA 5KIXA 1B2TA 4G7OC 1F9PA 3EROA 2D2CC 3HP3A 4HMIA 2L1BA 4DNRB 1JWSD 3RZDB 2XVSA 1LTID 4N9TA 2NN6G 1QOHA 3CQZB 1G291 3D8GA 1Z47A 5I6WA 1LTAD 4KJOA 1Y1WB 4U68A 3MA2B 4G4KA 1IKLA 3BDOA 3SEBA 3GTJB 2F1MA 2J0TD 1B53A 2F0DA 1HQRD 4R9WA 2R7ZB 2RVLA 1LTRD 3P7JA 1TU2B 3DEOA 1SNCA 4JK1C 3TN2A 4V0BA 2FHTA 2BA0A 1ENFA 4A3DB 1TIID 2A6HD 3K58A 4R8IA 2PZUA 3KLSX 3R3OA 2EZVA 2KECA 1IYVA 5IT9L 4DAYA 1XX8A 3OIQA 3PIP3 1VMPA 3KBXA 1KABA 4CJ0B 3BG3A 3RMHA 1U4LA 1WCMB 3KLRA 3CKIB 4HEDA 3M7GA 2IPKD 1PMRA 1F9RA 4A3KB 1PXUA 1RJTA 4ZK9B 3L9AX 1Z7TA 3C1EA 2E76C 4ZKBB 3OWEB 2BE5C 2HQEA 4ZUIA 3HOZB 3J81E 2K32A 3ND9A 1ICWA 5M3FB 3GD7A 4IUTA 1STGA 2K05A 1MSHA 4MN3A 2RDFA 3U9SA 2EYJA 5DNFA 3C3LA 3LX0A 3OPOA 1EY7A 1HCZA 1X3PA 4F7XA 2A74C 1AFPA 1B9NA 2JSOA 3PUYA 1MD2D 2VB2X 5KGUA 1MGSA 1PDQA 5IGBA 5JEAJ 1PRTF 2KA7A 2KHSA 5T1IA 5JOBA 3GTQB 1E0BA 1JWMD 5I9OA 2E2JB 1JORA 3SK8A 1TY0A 5FOBB 4KHVA 4WORA 3GV6A 1B9MA 1FD7D 3QO2A 2QKIC 3W2DA 1XTCD 2E2DC 4LMQD 4LK1C 4HSPA 4TRDA 3OWFA 1FNVA 3OW7A 1TKWB 2B2TC 2F0WA 1BO0A 4AYBB 4PNYA 2CVRA 4FF3A 1EQVA 1SYCA 1BDOA 2C5CA 2IJ0A 1QG7A 5C0XG 1RCVD 1CHPD 1WTPA 2EPBA 2IT1A 5KNDA 4KN4C 3NSWA 2NN6H 1PTOC 1X32A 4RWSC 1KDBA 3S14B 5ELEA 3Q22A 2SOBA 1DM0B 2EYMA 4H0LC 2MJ8A 3HZXA 3SVMA 4YIJA 3D6CA 3BVGA 1Y8NB 1QNKA 3HEJA 3H09A 5ELDA 3MAQA 2ZT9C 1KLGD 5JEAG 4DK1A 2LFNA 4LJZC 3A7AB 1EWHA 5BN5A 2EYHA 1VCIA 1PYWD 1AW7A 3JAML 1OXTA 1S5BD 2A6EC 1ILPA 1RHPA 1E2ZA 1SNQA 1W6KA 1DD2A 3Q0AA 1LACA 1S5ED 4RH6A 4ZQ3A 4O1NA 4FXKC 3A8IE 5M5XB 3SHLA 1GUOA 1H9SB 3V2TA 3IL8A 1STHA 4KMUC 2WV6D 2RKSA 2A73B 4KV6A 2RBMA 1WD1A 4A3BB 1G6ZA 2M00A 2AUKA 5J1ZA 3NQTA 1Q8IA 5CBEE 2JYOA 2F0TA 3IAYA 3T4AC 4OIJA 3HS0C 3SXHA 1TS4A 1BCPD 3NBIA 3KBGA 3MXNA 1M8AA 4ILWA 1RTOA 1HRJA 2F0KA 2R93B 3S1MB 2Q8RE 1ET6A 4J6HA 1XXGA 2BDNA 2X6GA 4C1NK 4ZKCB 1C4QA 1H9SA 3E5SA 4J8QA 1B50A 4DAPA 4NMZA 2PYKA 5EQ0A 4NP5A 1DXMA 2ID0A 4FYDA 1SNOA 1TS2A 4OIKA 1ONLA 1O7LA 2NTSA 3GTKB 1HA5A 1LTGD 3BVMA 1D1KA 1I4XA 2PZTA 2F0QA 1YNJD 1A3VA 3NK9A 4KTAA 3L3OC 5A35A 4KK7A 1TWFB 5HURA 1CM9A 4XXEA 1Y8OB 4QUFA 1BCPF 1K8OA 3K7AB 3G4NA 2IL8A 3A54A 3H3VC 5LL6S 4C3HG 5IODA 3VYRA 1EEFD 1II3A 1GJXA 4U673 5C3XA 3PUXA 3N6RA 3M7NA 1NUCA 1EQTA 4P2CB 3W3AA 3MFYA 3I4MB 2AUJD 1TWGB 2ENBA 2D62A 1CQFA 1PREA 1X3QA 2M9VA 4KD4A 3DWPA 5CORA 2F0NA 1SXTA 1FGBD 3MWYW 4MIUA 4KKUA 5A2QL 1TS3A 3MHBA 1JOOA 3X3NA 4DGZA 2WKCA 3VA5A 3A7LA 2WINB 2VNUD 3SK5A 1EY5A 4HSVA 1EU4A 5JEAH 4X3SA 3TP7A 3HOYB 4PMBA 1GUWA 1E2VA 2NBFA 5CGKA 2X69A 4IUUA 3WDNA 4RKLA 2F0UA 4FF2A 3MC0B 1GUTA 2NYZD 2K28A 1HXYD 5FLXE 5M9OA 5AFWA 3V05A 2EY2A 1KNAA 4ULLA 1ZKOA 5C0XI 1JQYD 4V190 3DM1A 4C2MB 3QG1A 1GHKA 3NWSA 1AZQA 5JPMC 1STEA 3DUZA 1LT4D 3WOFA 4KHZA 4RGMA 3RUZA 5DM63 2OT2A 3FEWX 3S1NB 1VDZA 2JP1A 1SJED 3D3RA 1Z6HA 3F2UA 1BOSA 5KNBA 3NTHA 1MSGA 1PZKD 1Y1VB 3G4OA 3T16A 1BQQT 4M1UB 3BDLA 1SYGA 3HOUB 4F87A 4KD3A 2AWNA 4LAAA 3L7ZC 1VF5C 1A3UA 2QF7A 4IALA 4FXGC 5E4WC 5M3MB 4RCOA 1BCPB 4Y7NB 3UI2A 1IW7C 2N88A 3TBIB 2A68C 1GUNA 2B2VC 2WP8J 1I4PA 2QCPX 4A93B 1JICA 2DNCA 2G9DA 2DNEA 4KJNA 1CK1A 1SSOA 5ISRA 1TY2A 3QWNA 2AQ2B 5JVH3 3CRLC 3S17B 4CBVA 1BF4A 3FKIB 2KUMA 1MI2A 5JAVA 2F0IA 1TQOA 4A3FB 1H9KA 4FP5D 1SAPA 2FMMA 3TP8A 1UAPA 1GXDC 3ND8A 1O78A 3J80E 3PUWA 2QILA 2RDGA 1KDCA 3GTOB 4G7ZC 5DAUA 2KCCA 3HGBA 4RA8A 5I4DA 4XQQA 3EJIA 3ERQA 3HRZC 5M5YB 5I9PA 4QF4A 4CKCA 5FO9B 3FPUB 5EGTA 1TWAB 2A69C 1L0YB 3NUCA 2CW0D 2O2LD 3NE5B 4OO1H 2EOTA 4EQOA 1PRTD 2K5WA 2B2UA 1SMYD 2YYZA 3OHXC 4X3UA 1TWCB 4K2KA 4OHJA 1B44D 2XIWA 3GP7A 2XWBB 4ZRZA 2JA6B 3J7AF 2JE6I 2LKVA 3ONAB 4E6IA 2TSSA 2MPMA 2FJ2A 2F0EA 2EYOA 3PIO3 1ILQA 2EVBA 4K5WA 3Q23A 2E75C 5C4ZA 1SNMA 2K7VA 3K5MA 1YNNC 4NDXA 1I4QA 3CRKC 1B1ZA 4NW2A 2EY1A 1QE6A 1HQMC 3URYA 1D5XC 3DMUA 3S9WA 1I4GA 5FK9C 3TP6A 4HTHA 3D4RA 1RKNA 3KLSA 4DAVA 2H4OA 3GTLB 3EQLC 4I65A 4Q0FA 5COYA 3DXJC 2Q8IB 3M4OB 2IWHA 4IFDJ 3Q6SA 1HUMA 2B2VA 4B9WA 2LMCB 5IOCA 5HGTA 5ELCA 1D2BA 1J9OA 2XSCA 5C4JB 2GA4B 1STBA 4MHEA 3RZOB 4CJ1B 4JBWA 2E2HB 5CR3A 1RD9D 2SDFA 3OMGA 3HOXB 1FYCA 1NR2A 2M2LA 3HOVB 1WTQA 1AZPA 2L11A 2RSOA 2A6HC 1M4VA 4IN3A 2C9OA 3LNNA 3FDTA 2NVXB 2EY5A 1IKMA 3VA7A 3DWAA 1D5MC 2PPBC 5IGCA 2E74C 4C3HB 1G91A 1EY8A 2L9HA 1TWHB 4XQJA 2IX3A 1U4MA 1TT2A 5D3DA 2WIIB 4A3IB 3I4LA 1EFID 4I7ZC 2RDHA 2FMCA 3LWUA 3M3YB 4A3GB 5FO7B 1LT3D 1HTPA 4TQUS 2KCNA 3S1QB 4IFDG 3H91A 3P75A 1SE2A 2I46A 5G3LF 4HCSA 2QEJC 1R4QB 2RQXA 3K5OA 3PO3B 1NR4A 3P1HA 4L8JA 5NUCA 2FINB 4CJ2C 5KYLA 5IIFA 1S5DD 1KTKA 3KK7A 2O5IC 3H6MA 2ICIA 3SR1A 5E3FA 2B63B 2VB3X 1U4PA 1DOKA 1STYA 2NN6I 1JB3A 4NKLA 1WTRA 1EYDA 1CI3M 3KF8A 1RTNA 1I4RA 1SBBB 2HUGA 3A56A 1PRTB 4KKSA 1BXTA 4FNFA 3AMUA 3VYTA 3VR4A 1CHQD 4RKBA 1DCZA 4HN7A 1QNUA 1NCVA 4DFAA 1PZJD 1BR9A 2R92B 3J81L 5E1FA 2PQEA 1OXUA 3NQIA 3GTGB 5I2XA 5CBAE 1H9RA 5C6AA 3QJYA 5IGFA 1UUPA 5CV7A 1WTXA 1ML0D 2EXZA 3BZDB 1PFNA 4XT3B 4PQXA 1T5XD 5JVG3 4GZYC 1A2UA 3R2IA 1WTOA 3VR3A 1LLRD 4WJWA 2PW5A 3C0OA 1Q12A 3I72A 3PUVA 2MUYA 3BS1A 3CHBD 3MZ5A 3MFGA 3X3MA 4BA2I 1F2MA 3PV0A 1EY4A 3I91A 1LTSD 5DM73 1I6VC 3RLFA 5KYIA 2L4NA 1UEAB 3FMCA 3EVQA 3I70A 2F0MA 1EY6A 2PNRC 4M8AA 4C3IG 1Y69U 5EKKA 4RGOS 1HUNA 1HA6A 3MTSA 1OO9B 1EEID 1S5CD 2K5QA 4X3TA 2R3ZA 5CV6A 5EPJA 2K01A 2Z1CA 1I50B 4OO1G 1CA5A 2EJFC 3A55A 1ZYRD 2J4XA 2XRQD 5C3WA 5IT9E 1LV9A 1TVXA 3O13A 3MXGA 5KNCA 1HTLD 1A3TA 1IW7D 1GHJA 1SYEA 2IX0A 1WTWA 3IKJA 2L55A 1QJOA 4A3MB 1EYAA 1EOTA 3T56B 1I3QB 2NVYB 3R8BA 1BCPC 3NTIA 2Q8TA 4UDUC 4XIGS 4IQZA 4IFDH 2G9HD 1EIHA 1EY9A 2CQAA 2V4DA 3MXUA 1LTBD 5C5MA 3SDZA 3H0GB 4K2LA 4FF1A 3DHQA 2B2UC 2PMZB 3QIAA 2WACA 3I73A 2Z8LA 4ABNA 4A3EB 4HAEA 2JXMB 1JCKB 5CV9A 5C5LA 2IW3A 3BYTB 1CQVA 2VUMB 2NVQB 1LT6D 2MGSA 4RFBA 4ZUJA 2F3WA 2EY6A 1YNJC 2DN8A 3V96A 1A2TA 2SNSA 1F77A 5DEHA 1K8MA 3T51B 2HCIA 4ZAIA 5FO8B 1KNEA 2NUCA 3WOEA 1QCBD 3MXPA 3K59A 1DOMA 4OGQC 1SDFA 1OXVA 3FRPB 5TSSA 4X3KA 4CKBA 4K8IA 1V1OA 1H9JA 3GQBA 4WFN3 1QWYA 2L0CA 1I4HA 2B2YA 3FVQA 2J7ZA 2XWJB 4C1NI 1D1IA 2BE5D 1C48A 5F2DA 5CYUA 1EIGA 1HFGA 2NZ1D 4F88A 2RA4A 2D9UA 2Z4HA 3TMEA 5D3IB 3A8KE 3K6OA 1SNDA 1RODA 4BA1I 1O7YA 2F4IA 3R2TA 5KRUA 4RAUC 4ME5A 3D4WA 2H1EA 3IFTA 4HCEA 2PZWA 1TS5A 1B3AA 2O5JC 4ZLTF 5J22A 1BNZA 2K1BA 4C56C 4FXDA 5BN4A 2AWOA 1H9MA 1B4OA 4L63B 1GUSA 2B8GA 4G7HC 5CV8A 4BWGB 2EJGC 3EFXD 5KEEA 1PLFA 4N9PA 1EU3A 4K5VA 3JAME 4EQPA 1HPCA 1FR3A 4XDXA 5I2YA 4KY7A 5CV5A 4J1MA 1KDAA 2E2IB 1WTVA 2K04A 4R8NA 4DNTB 3FPPA 4PMWA 5EBDA 4F8MA 4BY1B 3NWTA 1K83B 3BDCA 2EJMA 3M85A 3PUZA 4EVOA 1EZ6A 3GTPB 2SNMA 3T53B 4CGYB 3NHHA 1ENCA 4RCNA 2B2WA 4Q5VA 4EGVA 1CFMA 2NB0A 1ZEQX 5T1GA 1PTOD 4RHSA 5IGGA 1EL0A 2F0VA 2XRSD 4IZ8A 1SNPA 1EY0A 1CT1D 1HFNA 4ODGA 1O80A 2F0FA 1GOZA 3N52A 5C0XJ 3G7LA 3SK4A 4S3SA 2KVMA 4A3JB 1Q90A 5D14A 3C1FA 4QCLA 2NVTB 1JWUD 2RSNA 5C4HA 1ESRA 3C46A 3TDQA 1U4RA 5FLXL 2TMPA 2A6ED 1J8IA 5C3EB 4OO1I 5C4XB 1JOKA 3G6JB 4CHTB 4QIWB 3NTKA 2I07B 4QB4A 4KKTA 1EWCA 4C3JG 3BVZA 3NBHA 2HDLA 2OF1A 3IFDA 3D4DA 1SYDA 4ID6A 1DJRD 2CHBD 1JE4A 2HDMA 2K03A 4WRDA 3SK6A 2EYPA 1IHZA 2JA8B 4DK0A 4DXFA 2YU9B 2B8FA 2KEEA 1SE3A 1PTOH 3J7YW 3VR5A 1PTOF 3U9OA 1Q1BA 1CZWA 1D5ZC 5IGDA 1A6XA 3RD4A 1JR0D 1CTMA 4UAIA 4IUNA 3KUPA 3MEHA 4HMJA 5G3LD 2MHVA 3OIPA 3VR6A 2EDGA 2FFKB 3ITPA 5K36G 1SEBD 1GUGA 2X6LA 2HCCA 2CW0C 2SEBD 4H44C 3TZDA 1XWEA 1PRTC 4RGTA 1SMYC 4C3IB 1W6JA 2JEAI 1SYBA 2O4XA 3HOWB 3C0MA 5EKIA 3K5NA 1R4PB 5I6YA 1IYUA 2KJXA 3S2HB 1JC7A 2F0LA 1SYFA 3VYSA 2BOSA 1STNA 3E6ZX 4HR7B 1WVLA 5A2QE 4K6LA 1MBYA 5EJWA 5CMDA 2K6AA 3NXWA 3D31A 4B08A 2EYLA 1FNUA 5ELBA 2F0PA 5EPLA 1F2LA 4KY5A 5CC4A 2Y0SB 1AN8A 4TSSA 1QILA 3BYYB 3J80L 1LABA 2LY7A 3H94A 5K5PA 1V43A 2BDOA 2L12A 5FKAC 2F0SA 5LL6X 3OMCA 4QMGA 3AU7A 2DY8A 2WB1B 1T5EA 3HKZB 4DN4M 4PV1C 1F2YA 1QB5D 4BBSB 4K6DA 4KN7C 2KEDA 3AB9A 4BY7B 3M4YA 4IURA 2LS01 4XT1B 1S4ZA 1F9SA 2XN9C 3QOLA 4ZYSA 1S5FD 3HG9A 4RGNA 2ICEC 1DYQA 4XTCS 5E4XA 4XYOA 1LT5D 4XYQA 2R6GA 4L6TB 1OXSC 1NAPA 4DF7A 1PTOB 4DU9A 2WAQB 4B9XA 3C2PA 2NWGA 2OEOA 3ZYYX 1F9QA 4FO2A 2F0JA 2K5DA 3VYUA 1KLUD 2F0HA 3TSSA 1SJHD 3GTMB 4KI0A 3TP5A 2D5DA 2B2TA 2B39A 3Q24A 3QB3A 3S16B 1F2ZA 4EQNA 1Y8PB 3PO2B 4BBRB 2AQ3B 1BBXC 3J7AV 1TR5A 4K8JA 5LHY1 1AP0A 3GO5A 3I90A 1I6HB 4H13C 2B2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO F;  2AQ1 B;  1BCP B;  1PRT B;  4RCO A;  1D5Z C;  1BXT A;  1JR0 D;  1ET9 A;  5TSS A;  3BVG A;  5ELF A;  3DWA A;  1D5M C;  3SEB A;  1I4P A;  1MD2 D;  1EU4 A;  2J4X A;  2XRQ D;  1CHQ D;  5ELD A;  1V1O A;  1KLG D;  4DXG A;  1D6E C;  3O13 A;  1TS3 A;  1I4H A;  1PZJ D;  1I4Q A;  1TS2 A;  1PRT F;  1CK1 A;  1HTL D;  2NTT A;  1HQR D;  1PZI D;  1TY2 A;  1SEB D;  1B1Z A;  1PYW D;  1AW7 A;  1V1P A;  2NTS A;  2AQ2 B;  1S5B D;  3MC0 B;  1JWM D;  3URY A;  1HA5 A;  1LTG D;  3BVM A;  1LTR D;  1D5X C;  2SEB D;  1UUP A;  1I4G A;  5FK9 C;  2R61 A;  1I4X A;  1PTO D;  1HXY D;  1ESF A;  1RF2 D;  5D3D A;  3R8B A;  1BCP C;  1PRT C;  3BZD B;  3V05 A;  1TY0 A;  4RHS A;  4RGT A;  2XN9 C;  1PTO H;  1S5E D;  2XRS D;  4RH6 A;  5D3I B;  1EFI D;  1T5X D;  4O1N A;  4ZYS A;  1FD7 D;  1ENF A;  3W2D A;  1S5F D;  1XTC D;  2RDH A;  3DWQ A;  3R2I A;  3R2T A;  4UDU C;  4RGN A;  1G8Z D;  1JQY D;  1LLR D;  1DYQ A;  1LT3 D;  1L0X B;  1CT1 D;  3C0M A;  2G9H D;  3C0O A;  1BCP F;  1TS5 A;  3KLS X;  1LT5 D;  1GOZ A;  1FNV A;  1FNW A;  4L6T B;  1SE2 A;  2WV6 D;  3G4N A;  1PTO B;  3CHB D;  2QIL A;  1STE A;  1LTB D;  2QEJ C;  4C56 C;  2RDG A;  1Z52 A;  1LT4 D;  3MFG A;  1LO5 D;  5ELC A;  5I4D A;  4RGM A;  1JWU D;  2XNA C;  1EEF D;  4K6L A;  1KLU D;  4L63 B;  3TSS A;  2Z8L A;  1SJE D;  1UNS A;  2IPK D;  1V1P B;  1SJH D;  1LTS D;  2IJ0 A;  1L0Y B;  1S5D D;  1RCV D;  2O2L D;  1CHP D;  1JCK B;  1PZK D;  1KTK A;  1FNU A;  5ELB A;  1TS4 A;  1RD9 D;  3G4O A;  3BYT B;  1BCP D;  1PRT D;  4BWG B;  3OWE B;  1EWC A;  1SE4 A;  2ICI A;  1CQV A;  1LTT D;  4Z9C B;  3EFX D;  1JWS D;  1LT6 D;  3BVZ A;  4RFB A;  1PRE A;  3C0N A;  1LTI D;  1EU3 A;  1PTO C;  4OHJ A;  1B44 D;  3DWP A;  2AQ3 B;  1AN8 A;  1ET6 A;  1QIL A;  3BYY B;  3GP7 A;  4RGO S;  4TSS A;  1DJR D;  2CHB D;  4RHR A;  1I4R A;  3EA6 A;  1EEI D;  5ELE A;  1S5C D;  1F77 A;  1SBB B;  1SXT A;  1XXG A;  1FGB D;  2TSS A;  5FKA C;  4DXF A;  1RDP D;  1SE3 A;  1M4V A;  1LTA D; 
#chains in the Genus database with same CATH topology
 4GKJ L;  4QUC A;  1N8R C;  3OOC A;  2VQF Q;  3MVV A;  3HOU H;  5IYD H;  5FLM H;  2K33 A;  2JEB I;  2AKW B;  2DY7 A;  3EN2 A;  1R9T H;  4IUQ A;  4AYB G;  4P72 A;  4X66 Q;  1SFO B;  4H7B A;  3NP8 A;  4IPC A;  2OWO A;  3GV3 A;  1VQC A;  5C44 B;  1E24 A;  3K57 A;  1C8C A;  3LWE A;  1SLJ A;  1HNZ L;  4TKO B;  2ZXP A;  2EE1 A;  4BXX H;  5K36 H;  2Z4I A;  5M3M H;  2BA1 A;  2NTT A;  5JJZ A;  1PZI D;  3R93 A;  4O0A A;  1PYB A;  2N55 A;  2N78 A;  3CU7 A;  1O7Z A;  2F0O A;  2F03 A;  3RZD H;  1X3G A;  4JI8 L;  2R61 A;  2KOL A;  4DA2 A;  3PGZ A;  1FVI A;  4FVM A;  1RF2 D;  4A93 H;  1JOQ A;  4K5X A;  1AEX A;  3VR2 A;  1WD0 A;  1DOL A;  1DON A;  3KOJ A;  3OYY A;  3CQZ H;  5IT9 c;  4K0K Q;  4K0K L;  1E22 A;  1KAA A;  3H3V I;  2F3V A;  3W5O A;  1G8Z D;  5C0X H;  1CZG A;  4XQN A;  3PIP A;  1L0X B;  5EPK A;  3PF4 A;  3SE0 A;  1ZXT A;  3S17 H;  1Q1E A;  3OSO A;  2K4K A;  2KQ3 A;  2A68 D;  1WTH A;  2ZXR A;  1PFM A;  4KY6 A;  3S15 B;  4JV5 L;  3KDF A;  3FKI H;  3QOJ A;  4G57 A;  1BBU A;  4JBK A;  4IUV A;  5EBC A;  2PCF B;  4YHH L;  1UE7 A;  1WI5 A;  3S1R B;  5E7N A;  2XNA C;  1XNR Q;  1NSN S;  1XNR L;  4B3R Q;  4LFB Q;  1GVP A;  4B3R L;  4LFB L;  1K0S A;  2R7Z H;  1X3E A;  1V1P B;  1MJC A;  5CV4 A;  1BUV T;  2IX1 A;  3T13 A;  4CDC C;  2UXC Q;  1STA A;  2UXC L;  4CKE A;  3NPP A;  5IGE A;  2UUB Q;  3GTO H;  3K0Y A;  4HIK A;  3WWV A;  1OXX K;  1SE4 A;  1LTT D;  4Z9C B;  4K14 A;  5M5Y H;  2OXP A;  3I8Z A;  1KQS A;  5BN3 A;  3C0N A;  2CH4 W;  2L5T A;  1TWA H;  1IL8 A;  4RHR A;  1G2S A;  2EYF A;  4FF4 A;  3EA6 A;  5JPN C;  2JQO A;  5J39 A;  1RDP D;  3P20 A;  1VF7 A;  4NPS A;  2JA7 B;  2AQ1 B;  1DZ1 A;  2A5H A;  2B2W C;  1TWC H;  1ET9 A;  2ZXO A;  1RIP A;  5ELF A;  1A15 A;  2PO4 A;  4A3B G;  1WCM H;  3TZU A;  2JA6 H;  1ENA A;  2JA5 B;  3K5L A;  2NZH A;  2PQA B;  2ZTD A;  4OL7 A;  1EYC A;  1PH9 A;  1MKH A;  1EZ8 A;  4DXG A;  1D6E C;  2A69 D;  4A3K H;  5JJL A;  4H02 A;  5M5W B;  1V1P A;  2VXW A;  5D65 A;  3K81 C;  2PW7 A;  1XYI A;  1CA6 A;  4GLV B;  2BCO A;  2WKD A;  4MTK A;  5M3F H;  4GNX B;  4C3J B;  1ESF A;  2Z0S A;  1G2T A;  1PFB A;  1X6O A;  4GS3 A;  4AQY Q;  4GN3 B;  2R93 G;  1U9R A;  1HHV A;  3I4N B;  1VMC A;  4P74 A;  3DEP A;  3DWQ A;  4IFD I;  3D6W A;  3TEH B;  4GOP B;  4IUP A;  1MHW C;  1J5E Q;  2Q2I A;  1FNW A;  5EKL A;  2HD3 A;  4BS9 A;  3PMF A;  3A8J E;  3M9B A;  5GAH C;  1AH9 A;  2MP1 A;  2R7F A;  1T9H A;  1Z52 A;  3E0J A;  1LO5 D;  1YNN D;  3QR8 A;  1IBK L;  1IBK Q;  4UHV A;  3GTL H;  1Q3L A;  2HQL A;  1R9T B;  2F0G A;  4O42 A;  1ZYR C;  3I3C A;  2PQA A;  1JE5 A;  3M4O H;  1E2W A;  3S2D B;  4PMC A;  1HZ9 A;  1UNS A;  5IE8 A;  3S24 A;  3GTQ H;  2QDB A;  1V8Q A;  2HHH Q;  2CKZ B;  5KIX A;  1B2T A;  4G7O C;  2F4V Q;  1F9P A;  4DV6 L;  3ERO A;  4L5S A;  2D2C C;  3HP3 A;  4NXN L;  1UE1 A;  4HMI A;  1QZH A;  3UDX A;  3AEV A;  2L1B A;  4DNR B;  1JWS D;  1J6Q A;  1NMG A;  3RZD B;  2XVS A;  1LTI D;  4GNX A;  3KYH C;  4DUY L;  3RZO H;  4N9T A;  2E2H H;  1PYS B;  2NN6 G;  5IP9 G;  1QOH A;  3CQZ B;  1G29 1;  3D8G A;  1Z47 A;  4DAY B;  1L1O B;  5I6W A;  1LTA D;  2C35 B;  3HOX H;  4KJO A;  3HOV H;  1U0L A;  4U68 A;  3MA2 B;  1Y1W B;  4L5T A;  4G4K A;  4DV7 L;  1IKL A;  3BDO A;  1KC8 C;  3SEB A;  1XNQ Q;  3GTJ B;  2F1M A;  2J0T D;  3JAM c;  4MTN A;  1B53 A;  3W1G A;  2F0D A;  1HQR D;  4R9W A;  2R7Z B;  2RVL A;  4R4T A;  4GLX A;  2PMZ E;  3I4M G;  1LTR D;  1WYD A;  4C3H H;  3P7J A;  1PH4 A;  1TU2 B;  4JI3 Q;  3DEO A;  3NEM A;  1XPO A;  1SNC A;  4JK1 C;  4X65 Q;  4X65 L;  3TN2 A;  4V0B A;  2FHT A;  3S14 H;  1OTC A;  2BA0 A;  1TWH H;  1ENF A;  4A3D B;  1TII D;  2A6H D;  3K58 A;  4R8I A;  2PZU A;  3CCU A;  3KLS X;  3R3O A;  2EZV A;  4LF4 L;  2KEC A;  1IYV A;  1K28 A;  1K9M C;  5IT9 L;  4DAY A;  1L1O A;  1XX8 A;  3OIQ A;  3AYH B;  4A3I H;  1VQ9 A;  2K5H A;  3PIP 3;  1VMP A;  2HIX A;  3A5Z B;  3KBX A;  3M3Y H;  1KAB A;  2GVB A;  5FJ8 G;  4CJ0 B;  3BG3 A;  2IY5 B;  3RMH A;  1U4L A;  2N49 A;  1WCM B;  1EFW A;  3HOY G;  2VZA A;  3S1Q H;  3KLR A;  1VQ6 A;  4DR3 Q;  5H1S E;  3CKI B;  4HED A;  3M7G A;  3CCR A;  2IPK D;  4JI7 Q;  4LUV A;  4JI7 L;  1PMR A;  1F9R A;  4A3K B;  1PXU A;  1CSP A;  1RJT A;  4ZK9 B;  3L9A X;  1VQG A;  1Z7T A;  3C1E A;  2E76 C;  4ZKB B;  3OWE B;  2AMC B;  2BE5 C;  2BH8 A;  2HQE A;  4ZUI A;  3HOZ B;  2LXK A;  3J81 E;  2K32 A;  3ND9 A;  1ICW A;  5M3F B;  3GD7 A;  4IUT A;  1STG A;  1LUZ A;  2K05 A;  1MSH A;  5LMN L;  1EQR A;  4MN3 A;  1CSQ A;  3I2Z A;  1BBW A;  2RDF A;  3DM3 A;  3U9S A;  5DLQ E;  2EYJ A;  5DNF A;  4X62 Q;  3C3L A;  4IJH A;  4X62 L;  3LX0 A;  1X54 A;  3OPO A;  2B63 H;  3T1H L;  4DV5 Q;  1EY7 A;  1HCZ A;  1X3P A;  1E1T A;  4F7X A;  1PH6 A;  5IY0 A;  2A74 C;  1AFP A;  1B9N A;  3PUY A;  2JSO A;  1MD2 D;  2VB2 X;  5KGU A;  1Z9F A;  1MGS A;  2RCN A;  3STB D;  2I0Q A;  1PDQ A;  5IGB A;  3K80 C;  5JEA J;  1PRT F;  2KA7 A;  2KHS A;  5T1I A;  4LF6 Q;  4LF6 L;  3ERS X;  1Y1V G;  5JOB A;  3GTQ B;  1E0B A;  1JWM D;  5I9O A;  1KD1 C;  2KCM A;  2E2J B;  1JOR A;  2R93 H;  3SK8 A;  3HOU G;  3AQQ A;  2MNA A;  5IYD G;  5FLM G;  4AIM A;  4JW0 A;  1TY0 A;  5FOB B;  4KHV A;  4WOR A;  3GV6 A;  1NTG A;  2R92 H;  1WOC A;  4JPB W;  1B9M A;  1FD7 D;  2Z6B A;  2QKI C;  3QO2 A;  3W2D A;  1XTC D;  4HIO A;  2E2D C;  3GTG H;  4LMQ D;  2HT1 A;  5GRO A;  4LK1 C;  4EQ5 A;  4HSP A;  4TRD A;  4BXX G;  3OWF A;  5JJI A;  5M3M G;  3M4Q A;  1FNV A;  4N8F A;  3OW7 A;  4R4C A;  4DKA C;  1CKO A;  4GN5 A;  1TKW B;  2B2T C;  2F0W A;  1BO0 A;  4AYB B;  4PNY A;  4NB3 A;  2CVR A;  4A93 G;  4FF3 A;  1EQV A;  1LYL A;  1SYC A;  3CCS A;  1BDO A;  4IPH A;  4IOC A;  2C5C A;  1G51 A;  2IJ0 A;  1QG7 A;  5C0X G;  1RCV D;  1CHP D;  1H95 A;  1WTP A;  2EPB A;  4DR6 Q;  2IT1 A;  1FGU A;  4I7A A;  3CW2 C;  5KND A;  4KN4 C;  3FKI G;  4B3M Q;  4CDE C;  3NSW A;  2NN6 H;  4A3F G;  1VQK A;  1PTO C;  1X32 A;  5IP9 H;  5IYB H;  5IWA L;  4LF7 Q;  1S3O A;  4LF7 L;  4OX9 L;  1N33 L;  3MEF A;  2E5L Q;  4RWS C;  3RLO A;  1KDB A;  3S14 B;  1VQH A;  5ELE A;  3K7A H;  1KIX A;  3Q22 A;  2SOB A;  1DM0 B;  1YNX A;  2ZJQ A;  2EYM A;  4H0L C;  2MJ8 A;  3HZX A;  3SVM A;  3A0J A;  4YIJ A;  3CME A;  3D6C A;  1UEB A;  3BVG A;  1Y8N B;  1QNK A;  3HEJ A;  3OW2 A;  4OEM B;  3H09 A;  4R4I A;  5ELD A;  3CXC A;  2ZT9 C;  3MAQ A;  1KLG D;  3TRE A;  3L2P A;  5JEA G;  4DK1 A;  2LFN A;  1MJE A;  4LJZ C;  3A7A B;  1EWH A;  5BN5 A;  3J7A 5;  2EYH A;  2CWP A;  1VCI A;  1I50 H;  1PYW D;  5LMN W;  2ZM6 L;  1AW7 A;  3MXN B;  3I4M H;  1HJP A;  1TWG H;  1W3S A;  3JAM L;  1OXT A;  1S5B D;  2A6E C;  1ILP A;  1RHP A;  1CKN B;  1E2Z A;  1SNQ A;  1W6K A;  1P16 A;  2D0O A;  4JBM A;  1DD2 A;  3Q0A A;  1LAC A;  1S5E D;  4RH6 A;  4A4I A;  4ZQ3 A;  4O1N A;  4FXK C;  3A8I E;  4QIW E;  2JA6 G;  2VQE Q;  5M5X B;  3SHL A;  1GUO A;  4APV A;  1H9S B;  3V2T A;  3IL8 A;  2KHI A;  1HNW L;  1STH A;  4KMU C;  2WV6 D;  1NJI C;  1QZG A;  4YY3 Q;  2RKS A;  1YHA A;  5BR8 Q;  1A8V A;  5BR8 L;  2A73 B;  3B6Y A;  2YTX A;  2RBM A;  4KV6 A;  1WD1 A;  4A3B B;  1G6Z A;  2M00 A;  2K52 A;  4JI6 L;  2AUK A;  5J1Z A;  3NQT A;  1Q8I A;  5CBE E;  2JYO A;  5EAY A;  4OWX B;  2F0T A;  3IAY A;  3T4A C;  3H0G H;  4IJL A;  4OIJ A;  3HS0 C;  3SXH A;  1TS4 A;  1BCP D;  3NBI A;  3KBG A;  3MXN A;  1GO3 E;  1M8A A;  2RF4 A;  4ILW A;  1RTO A;  3EBE A;  1CKN A;  1HRJ A;  2F0K A;  2R93 B;  3S1M B;  2KEN A;  2Q8R E;  5GAG C;  1ET6 A;  4A3E H;  4J6H A;  4YWK A;  1E7Z A;  1XXG A;  2BDN A;  2X6G A;  4C1N K;  4ZKC B;  3BZK A;  4QQB X;  1B3Q A;  4JYA L;  1C4Q A;  1H9S A;  2VUM H;  3E5S A;  4J8Q A;  1B50 A;  4DAP A;  4NMZ A;  2PI2 A;  1O7I A;  2PYK A;  4DR4 L;  5EQ0 A;  4NP5 A;  1DXM A;  2ID0 A;  4FYD A;  4DV2 L;  1SNO A;  3RNU A;  4JI2 L;  1A62 A;  1TS2 A;  4OIK A;  1ONL A;  1O7L A;  4DV0 Q;  2NTS A;  3GTK B;  2VQF L;  1HA5 A;  1LTG D;  3BVM A;  4RMF A;  1D1K A;  1SN8 A;  3HOX G;  1I4X A;  2PZT A;  1P8L A;  5J3B A;  3TRZ A;  2F0Q A;  3E9H A;  1YNJ D;  1A3V A;  4IPD A;  2QW7 A;  3HOV G;  4X66 L;  1EIY B;  1VS0 A;  3NK9 A;  4KTA A;  3L3O C;  5A35 A;  4KK7 A;  1TWF B;  5HUR A;  1CM9 A;  4XXE A;  1Y8O B;  4LUO A;  4QUF A;  3RLN A;  4Y7N H;  2FXQ A;  1BCP F;  3G6E A;  1K8O A;  3K7A B;  4EX5 A;  3G4N A;  2Y0S E;  2IL8 A;  2YTY A;  3A54 A;  3H3V C;  3UDI A;  4HID A;  4JVZ A;  5LL6 S;  4C3H G;  1NNX A;  5IOD A;  3VYR A;  1EEF D;  3U4Z A;  1II3 A;  4GNX C;  4OON A;  1HZC A;  3K0X A;  1GJX A;  4U67 3;  5C3X A;  3PUX A;  1IZ6 A;  3N6R A;  3HKZ E;  2WB1 E;  3M7N A;  1NUC A;  1EQT A;  4P2C B;  4DV3 Q;  3W3A A;  4DV3 L;  4DV1 Q;  4DV1 L;  1S40 A;  2R7D A;  3MFY A;  3I4M B;  2AUJ D;  1TWG B;  2ENB A;  2ZTC A;  4A3F H;  2D62 A;  1CQF A;  1PRE A;  3PIO A;  4A3I G;  1Q81 C;  1X3Q A;  2M9V A;  4KD4 A;  3DWP A;  5COR A;  1QVF A;  4A3G G;  2RHS B;  2F0N A;  4HJ9 A;  1SXT A;  1FGB D;  3MWY W;  4MIU A;  4KKU A;  5A2Q L;  1TS3 A;  3MHB A;  2VS1 A;  4TVA B;  1JOO A;  2UUB L;  3X3N A;  3PQI A;  4DGZ A;  2WKC A;  3VA5 A;  3A7L A;  2WIN B;  2VNU D;  3SK5 A;  1EY5 A;  1EIF A;  2EIF A;  4HSV A;  1VQM A;  3PO3 G;  1EU4 A;  5JEA H;  3E0E A;  4X3S A;  3TP7 A;  1YJ9 A;  3HOY B;  4PMB A;  1GUW A;  1E2V A;  2WAQ E;  2NBF A;  5CGK A;  2X69 A;  4LF9 Q;  4IUU A;  3WDN A;  4RKL A;  2F0U A;  1HZA A;  4ALP A;  4FF2 A;  3MC0 B;  1GUT A;  1K83 H;  2NYZ D;  4OWW B;  2B63 G;  4DNI A;  1L1O C;  2K28 A;  3GTP H;  1HXY D;  5FLX E;  5M9O A;  2YV5 A;  5AFW A;  3V05 A;  2EY2 A;  1KNA A;  4ULL A;  1D8L A;  1VQL A;  1ZKO A;  5C0X I;  1Q7Y C;  1JQY D;  4V19 0;  3DM1 A;  1JT8 A;  4C2M B;  4QL5 A;  3QG1 A;  1GHK A;  3NWS A;  1X56 A;  2ALY B;  4J15 A;  1AZQ A;  5JPM C;  4POF A;  4IPG A;  1STE A;  2K50 A;  1KXL A;  3DUZ A;  1LT4 D;  2RCF A;  3WOF A;  4KHZ A;  1K0R A;  5ELN A;  4RGM A;  3RUZ A;  4AQY L;  5DM6 3;  2OT2 A;  2ZTE A;  1X65 A;  3FEW X;  4UP8 A;  3S1N B;  1VDZ A;  2R92 G;  2JP1 A;  3ER0 A;  1SJE D;  3D3R A;  2Q2H A;  4A3J H;  2QDL A;  4R4O A;  1N36 Q;  1Z6H A;  1J5E L;  3F2U A;  1BOS A;  5KNB A;  3NTH A;  1MSG A;  1PZK D;  1Y1V B;  3G4O A;  2NVT H;  3T16 A;  1BQQ T;  1BKB A;  3BDL A;  4M1U B;  3F8T A;  2UUC Q;  1XPU A;  1SYG A;  3HOU B;  4F87 A;  4KD3 A;  2AWN A;  4LWC A;  2JK8 A;  4LAA A;  3L7Z C;  4AH6 A;  1VF5 C;  5C4X H;  1A3U A;  2QF7 A;  4IAL A;  1PH2 A;  3LGJ A;  3NEN A;  2D0P A;  4FXG C;  5E4W C;  4DR7 Q;  5M3M B;  2HHH L;  4RCO A;  1BCP B;  1LTL A;  4Y7N B;  1YI2 A;  3UI2 A;  2F4V L;  1IW7 C;  2N88 A;  3TBI B;  2A68 C;  2NZO A;  5C4J H;  1GUN A;  3CCJ A;  2B2V C;  1VQA A;  1VQ8 A;  1PV4 A;  4X64 Q;  2WP8 J;  1I4P A;  2QCP X;  2JA8 H;  3F2D A;  2YU9 H;  4A93 B;  1JIC A;  4OXP A;  2DNC A;  3KJO A;  1SR3 A;  1VQO A;  5IYB G;  2G9D A;  2DNE A;  4KJN A;  1CK1 A;  1IXR A;  1SSO A;  5ISR A;  1TY2 A;  2ASB A;  3QWN A;  1K3B C;  2AQ2 B;  4GOP A;  5JVH 3;  3CRL C;  5ELO A;  3S17 B;  4CBV A;  1BF4 A;  2OQ0 A;  2CH4 A;  1X55 A;  3FKI B;  1N32 Q;  1N32 L;  2KUM A;  1MI2 A;  5JAV A;  3PF5 A;  1XNQ L;  2F0I A;  1TQO A;  4A3F B;  1H9K A;  4FP5 D;  4LW1 A;  1PHJ A;  4HJ7 A;  1SAP A;  2FMM A;  4YWM A;  3TP8 A;  2NVX H;  1UAP A;  4UP7 A;  5AJ3 Q;  1JB7 A;  3I4O A;  1GXD C;  3ND8 A;  1PH7 A;  1O78 A;  3J80 E;  3PUW A;  2QIL A;  4C3I H;  1Q82 C;  2RDG A;  1KDC A;  1V1Q A;  1W2B A;  1K8A C;  4JI3 L;  4G7Z C;  3GTO B;  5DAU A;  2KCC A;  3HGB A;  4RA8 A;  5I4D A;  4A75 A;  4XQQ A;  3HOW H;  3EJI A;  3CCM A;  3ERQ A;  3HRZ C;  5M5Y B;  5I9P A;  4QF4 A;  4CKC A;  5FO9 B;  3FPU B;  2Q2U A;  1WFQ A;  5EGT A;  1TWA B;  2A69 C;  1L0Y B;  3NUC A;  2CW0 D;  3FHW A;  3S2H H;  2O2L D;  3NE5 B;  4JI0 Q;  4OO1 H;  2EOT A;  4EQO A;  4LUZ A;  4A3M G;  1PRT D;  2K5W A;  2B2U A;  1SMY D;  2YYZ A;  3OHX C;  4X3U A;  1PH8 A;  3D0F A;  4YCV A;  4MNO A;  4A3G H;  1TWC B;  4K2K A;  2RHQ B;  1B44 D;  2XIW A;  4OHJ A;  2B29 A;  3GP7 A;  1FJG Q;  2XWB B;  5GQO A;  1FJG L;  1E1O A;  4ZRZ A;  2JA6 B;  3J7A F;  2I5H A;  2JE6 I;  2LKV A;  3ONA B;  4DR3 L;  4E6I A;  4N8X 1;  2TSS A;  2OQK A;  2MPM A;  2FJ2 A;  2OCE A;  2F0E A;  2EYO A;  3HFZ B;  1I5F A;  3PIO 3;  4JBJ A;  3I55 A;  3H0G G;  2L15 A;  4HIM A;  4LFC Q;  1ILQ A;  1PH5 A;  3PO3 H;  1JMC A;  3J81 c;  1XMQ Q;  2EVB A;  4K5W A;  4POG A;  1A0I A;  3Q23 A;  2E75 C;  5C4Z A;  2GN5 A;  3K7U C;  1SNM A;  2K7V A;  3K5M A;  1YNN C;  1VQ4 A;  4JI5 Q;  3A5U A;  4RG1 A;  4NDX A;  4A3E G;  1I4Q A;  1YVC A;  3CRK C;  1B1Z A;  4NW2 A;  2EY1 A;  1QE6 A;  1HQM C;  3URY A;  4DV5 L;  1D5X C;  3DMU A;  2CWA A;  3S9W A;  1M90 C;  1I4G A;  5FK9 C;  3TP6 A;  2VUM G;  3GDE A;  4HTH A;  3D4R A;  1RKN A;  3KLS A;  3E9I A;  3H15 A;  4DAV A;  2H4O A;  3GTL B;  3EQL C;  4I65 A;  4BY7 H;  4Q0F A;  2P5Z X;  5COY A;  3DXJ C;  2Q8I B;  3AFP A;  3M4O B;  2IWH A;  3J81 i;  4IFD J;  4P71 A;  3Q6S A;  1HUM A;  2B2V A;  4B9W A;  3T1Y Q;  2LMC B;  5IOC A;  3T1Y L;  5HGT A;  5ELC A;  1EWI A;  1D2B A;  1J9O A;  2IHE A;  2XSC A;  1EUJ A;  5C4J B;  4DPG A;  2XTI A;  2GA4 B;  1NMF A;  1STB A;  4MHE A;  1B8A A;  3RZO B;  4CJ1 B;  4JBW A;  2E2H B;  5CR3 A;  1VQ7 A;  2MO0 A;  1RD9 D;  1HNX Q;  1EYG A;  2SDF A;  3OMG A;  3HOX B;  1FYC A;  1NR2 A;  2M2L A;  1QVG A;  1PH3 A;  3HOV B;  1WTQ A;  3F1Z A;  3GTM H;  1AZP A;  2L11 A;  2RSO A;  4UY8 C;  2KHJ A;  1YEZ A;  2A6H C;  1M4V A;  4IN3 A;  2C9O A;  3S16 H;  3LNN A;  3FDT A;  2NVX B;  2A1A A;  2EY5 A;  3F2C A;  3PO2 H;  4BBR H;  1IKM A;  3VA7 A;  2MO1 A;  3DWA A;  1SRO A;  4DR6 L;  1D5M C;  5IYC H;  2PPB C;  2KCT A;  5IGC A;  3U58 A;  4B3M L;  2E74 C;  4C3H B;  2N3S A;  1G91 A;  3CCQ A;  1I6H H;  3UDG A;  1EY8 A;  2L9H A;  2E5L L;  2UUA Q;  1TWH B;  2UUA L;  4XQJ A;  2IX3 A;  1U4M A;  1TT2 A;  5D3D A;  2WII B;  3KF8 B;  2I5L X;  2IHF A;  4A3I B;  3I4L A;  1EFI D;  4I7Z C;  2RDH A;  2FMC A;  3LWU A;  3M3Y B;  2CQO A;  4A3G B;  2UXB Q;  4WJ4 A;  5FO7 B;  1LT3 D;  1HTP A;  4TQU S;  2K14 A;  2E8G A;  2KCN A;  3S1Q B;  4IFD G;  3H91 A;  3P75 A;  1SE2 A;  2I46 A;  4CDD C;  5G3L F;  4HCS A;  4BY1 G;  2K5V A;  2QEJ C;  1KRS A;  1R4Q B;  3W1B A;  2RQX A;  1M1K C;  3K5O A;  3PO3 B;  1L0W A;  4DR2 Q;  2UXD Q;  4UPA A;  3TS2 A;  1NR4 A;  3P1H A;  4CDF C;  4FDB A;  4L8J A;  5NUC A;  2FIN B;  4CJ2 C;  5KYL A;  2VQE L;  1N9W A;  3S15 H;  3STB C;  5IIF A;  4JI1 Q;  1CUK A;  1S5D D;  2H5X A;  2YTV A;  1S72 A;  4A3M H;  1KTK A;  3KK7 A;  1I3Q H;  2NVY H;  1HH2 P;  2OTL A;  2O5I C;  4YY3 L;  3H6M A;  2ICI A;  3S1R H;  3SR1 A;  5E3F A;  1PVO A;  2B63 B;  2VB3 X;  1U4P A;  5LMU Q;  1DOK A;  1STY A;  5LMU L;  2NN6 I;  1JB3 A;  4NKL A;  1WTR A;  1EYD A;  1CI3 M;  3KF8 A;  1RTN A;  1I4R A;  1SBB B;  2HUG A;  3G48 A;  3A56 A;  1B70 B;  3RN2 A;  1NY4 A;  1PRT B;  4A3J G;  4KKS A;  3G4S A;  2DJF C;  4LF5 Q;  1BXT A;  4FNF A;  4LF5 L;  3AMU A;  3VYT A;  3OTO Q;  3VR4 A;  4A3C H;  1CHQ D;  4ZCK A;  4RKB A;  4DK6 C;  1DCZ A;  4HN7 A;  2JA7 H;  1QNU A;  1NCV A;  4DFA A;  1PZJ D;  1BR9 A;  2R92 B;  3J81 L;  5C3E G;  3J7Z C;  5E1F A;  5C4X G;  2PQE A;  1OXU A;  3NQI A;  4AYB E;  3GTG B;  5I2X A;  5CBA E;  1JJG A;  3G71 A;  1H9R A;  5C6A A;  3QJY A;  2NVQ H;  4DUZ Q;  5IGF A;  5L37 A;  1UUP A;  5CV7 A;  1WTX A;  1HR0 Q;  1ML0 D;  2EXZ A;  3BZD B;  1PFN A;  4XT3 B;  4PQX A;  1T5X D;  5JVG 3;  4GZY C;  1A2U A;  3R2I A;  5M5W H;  3VR3 A;  1WTO A;  1LLR D;  4WJW A;  2JA8 G;  2PW5 A;  3C0O A;  1Q12 A;  3I72 A;  4DV0 L;  3PUV A;  4C3J H;  2MUY A;  3BS1 A;  1SE8 A;  4YCW A;  3CHB D;  2EXD A;  3MZ5 A;  3MFG A;  3X3M A;  4BA2 I;  4KHP Q;  4KHP L;  1TXY A;  1F2M A;  3PV0 A;  4JC0 A;  1EY4 A;  3I91 A;  4JOI A;  3KDF B;  1LTS D;  1YHB A;  5DM7 3;  1PH1 A;  1I6V C;  3RLF A;  5KYI A;  2L4N A;  1UEA B;  3FMC A;  3EVQ A;  1VQN A;  3I70 A;  2F0M A;  4X6A H;  1EY6 A;  1VQJ A;  2PNR C;  2V1C C;  4M8A A;  4C3I G;  5HGQ A;  1HNZ Q;  3S2D H;  1Y69 U;  3EIV A;  3U4V A;  5EKK A;  4RGO S;  1HUN A;  1HA6 A;  3MTS A;  1OO9 B;  3HOW G;  1EEI D;  1S5C D;  2K5Q A;  4X3T A;  2R3Z A;  5CV6 A;  5EPJ A;  4JI8 Q;  2K01 A;  2Z1C A;  1I50 B;  4OO1 G;  4GOP C;  3ULJ A;  2N8N A;  1KHI A;  1CA5 A;  2EJF C;  2KBN A;  3A55 A;  1ZYR D;  4R1J A;  2LSS A;  1Q86 C;  2J4X A;  2XRQ D;  5C3W A;  2PI2 E;  3BZC A;  5IT9 E;  1LV9 A;  1TVX A;  3O13 A;  3MXG A;  5KNC A;  1HTL D;  2VW9 A;  1YIJ A;  1A3T A;  1IW7 D;  1U5K A;  3TQY A;  1GHJ A;  1Y1W H;  4JV5 Q;  1SYE A;  2IX0 A;  3PCO B;  5HY6 A;  1WTW A;  3IKJ A;  2L55 A;  3GTJ H;  1QJO A;  4MZ9 A;  4A3M B;  4PG3 A;  4YHH Q;  1EYA A;  1EOT A;  1AE3 A;  3T56 B;  1I3Q B;  2NVY B;  3R8B A;  1BCP C;  3NTI A;  4YWL A;  2Q8T A;  2Y0S G;  2I5M X;  2ZJP A;  4UDU C;  4XIG S;  4IQZ A;  3Q8D A;  4IFD H;  1G6P A;  2G9H D;  1YZ6 A;  2E2I H;  1RL2 A;  4LF9 L;  3U50 C;  3CAM A;  5JJK A;  4BY1 H;  1EIH A;  1EY9 A;  2CQA A;  2V4D A;  3MXU A;  1L2F A;  4GLA C;  1XMO Q;  3HKZ G;  1QVC A;  2WB1 G;  1LTB D;  3FP9 A;  5C5M A;  3SDZ A;  3H0G B;  4K2L A;  5FLX c;  1XMO L;  1GM5 A;  4A3D H;  4FF1 A;  3DHQ A;  2B2U C;  3E3X A;  1UE6 A;  2PMZ B;  3QIA A;  1WJJ A;  2Z6K A;  2WAC A;  3DLL A;  3I73 A;  1HR0 W;  3RN5 A;  2Z8L A;  4BBS G;  4GKK Q;  4ABN A;  4GKK L;  4A3E B;  4DR1 Q;  4DR1 L;  4HAE A;  2JXM B;  3CD6 A;  1D7Q A;  4BY7 G;  1C9O A;  1JCK B;  3RR5 A;  1K3R A;  3IRB A;  1Q46 A;  5CV9 A;  2IW3 A;  5C5L A;  2G5D A;  3BYT B;  1E3P A;  1YJN A;  1CQV A;  2VUM B;  2NVQ B;  1LT6 D;  2MGS A;  4RFB A;  4ZUJ A;  3CC7 A;  4ME3 A;  2F3W A;  2EY6 A;  1YNJ C;  2DN8 A;  4JCV E;  3V96 A;  1A2T A;  3CPF A;  2SNS A;  1F77 A;  5DEH A;  1K8M A;  3T51 B;  2HCI A;  4ZAI A;  3NEL A;  4JG2 A;  5FO8 B;  1KNE A;  2JJQ A;  2NUC A;  1N36 L;  3WOE A;  1QCB D;  1EOV A;  3MXP A;  1EQQ A;  3K59 A;  1DOM A;  3HOZ H;  2WAQ G;  4OGQ C;  1SDF A;  3JC6 6;  1OXV A;  3FRP B;  1UE5 A;  2Z9H A;  4X3K A;  5TSS A;  4DV4 Q;  2ATW A;  4DV4 L;  4CKB A;  3I7F A;  2UUC L;  1UWV A;  2K75 A;  2CCZ A;  4K8I A;  1V1O A;  1H9J A;  1AE2 A;  3GQB A;  4WFN 3;  1QWY A;  2L0C A;  5C3E H;  1I4H A;  2B2Y A;  5IP7 H;  3FVQ A;  2J7Z A;  2XWJ B;  4C1N I;  1D1I A;  4DR7 L;  2BE5 D;  1C48 A;  5F2D A;  1VQD A;  5CYU A;  1EIG A;  1HFG A;  1C7Y A;  2NZ1 D;  1KRT A;  4F88 A;  2RA4 A;  3PO2 G;  4BBR G;  2D9U A;  2Z4H A;  3TME A;  3CP0 A;  4X64 L;  5D3I B;  5IYC G;  3A8K E;  3K6O A;  4O2D A;  1SND A;  3UE0 A;  1ROD A;  4BA1 I;  1O7Y A;  2F4I A;  3R2T A;  4PZ7 A;  4RAU C;  5KRU A;  4ME5 A;  1JJ2 A;  1IBM Q;  3D4W A;  2H1E A;  1IBM L;  3IFT A;  4HCE A;  2PZW A;  1TS5 A;  2E2J H;  4DV6 Q;  1B3A A;  4NXN Q;  3ULL A;  2O5J C;  4ZLT F;  4GN4 B;  5J22 A;  1BNZ A;  2K1B A;  4C56 C;  4FXD A;  2A8V A;  5C44 G;  3KFU A;  4DUY Q;  3TS0 A;  5BN4 A;  2AWO A;  1H9M A;  1IL2 A;  1B4O A;  4L63 B;  3BJU A;  1GUS A;  2F3I A;  2Q2T A;  3BU2 A;  2B8G A;  4G7H C;  1QUQ B;  3PSI A;  5CV8 A;  5AJ3 L;  1VQI A;  3J80 c;  1Q8K A;  2K5N A;  4BWG B;  4A3L G;  3F2B A;  4DV7 Q;  4OWT B;  1IYJ B;  2EJG C;  3EFX D;  2XGT A;  5KEE A;  1PLF A;  4N9P A;  1EU3 A;  3ULP A;  4K5V A;  4P73 A;  3JAM E;  4EQP A;  3AFQ A;  1HPC A;  1FR3 A;  2DJG C;  4XDX A;  5I2Y A;  1C0A A;  4KY7 A;  5CV5 A;  4J1M A;  1MIU A;  1KDA A;  2E2I B;  4JI0 L;  1WTV A;  2K04 A;  4B3S Q;  4B3S L;  4R8N A;  4DNT B;  1X3F A;  3HKS A;  3FPP A;  4PMW A;  5EBD A;  4F8M A;  4BY1 B;  3NWT A;  1K83 B;  3BDC A;  2EJM A;  3M85 A;  5GAD C;  3PUZ A;  4EVO A;  1EZ6 A;  3GTP B;  2SNM A;  3T53 B;  3J81 j;  4LF8 Q;  4LF8 L;  4CGY B;  3J80 i;  3NHH A;  1ENC A;  1VQF A;  4LF4 Q;  1IBL Q;  4RCN A;  1IBL L;  2B2W A;  2ES2 A;  4Q5V A;  4EGV A;  1CKM A;  1CFM A;  1QUQ A;  1HZB A;  2DUD A;  1GD7 A;  3JAM i;  3NBH B;  2NB0 A;  1ZEQ X;  5T1G A;  3UDF A;  1PTO D;  4LFC L;  3A74 A;  4IO9 A;  1XMQ L;  4RHS A;  5IGG A;  1EL0 A;  2F0V A;  2XRS D;  4IZ8 A;  4DK3 C;  4A3C G;  3K8A A;  1VQ5 A;  1SNP A;  4JI5 L;  1YHQ A;  1EY0 A;  2LXJ A;  1CT1 D;  1PA6 A;  1HFN A;  4ODG A;  1O80 A;  2F0F A;  2JA7 G;  2VL6 A;  1GOZ A;  3N52 A;  5C0X J;  3G7L A;  3SK4 A;  4S3S A;  2KVM A;  4A3J B;  1N34 Q;  1Q90 A;  5D14 A;  1N34 L;  3C1F A;  4QCL A;  2JA5 G;  2NVT B;  5M5X H;  1JWU D;  5LMN Q;  2RSN A;  5C4H A;  1ESR A;  3KJP A;  4BBS H;  3C46 A;  3TDQ A;  1U4R A;  5FLX L;  2TMP A;  2A6E D;  1J8I A;  2B3G A;  5C3E B;  3T1H Q;  2F52 A;  4OO1 I;  3KF6 B;  5C4X B;  1JOK A;  3G6J B;  4CHT B;  4QIW B;  3NTK A;  1YJW A;  4A3B H;  2I07 B;  4QB4 A;  4KKT A;  1EWC A;  4C3J G;  3BVZ A;  3NBH A;  2HDL A;  2OF1 A;  3IFD A;  3I4N G;  3D4D A;  1SYD A;  4ID6 A;  4YCU A;  1DJR D;  2CHB D;  1JE4 A;  2HDM A;  2K03 A;  2PNH A;  4WRD A;  3SK6 A;  2EYP A;  1IHZ A;  2JA8 B;  4DK0 A;  4DXF A;  2YU9 B;  2B8F A;  2KEE A;  2HIV A;  1SE3 A;  1PTO H;  3J7Y W;  3VR5 A;  1PTO F;  3U9O A;  1Q1B A;  1CZW A;  1D5Z C;  5IGD A;  3CC4 A;  1A6X A;  3RD4 A;  1JR0 D;  1BVS A;  4HJ5 A;  1CTM A;  4UAI A;  1HNX L;  3S1M H;  4IUN A;  3KUP A;  3MEH A;  1B7Y B;  3CCL A;  4HMJ A;  5G3L D;  2MHV A;  3OIP A;  4WJ3 M;  3VR6 A;  2EDG A;  1YBY A;  2JA9 A;  2FFK B;  3ITP A;  4Y52 H;  1V9P A;  5K36 G;  1A63 A;  1SEB D;  4QJF A;  1GUG A;  2X6L A;  3VDY A;  4IOA A;  2HCC A;  3KF6 A;  2CW0 C;  2SEB D;  4H44 C;  1XPR A;  3TZD A;  1XWE A;  4PZ8 A;  1PRT C;  4RGT A;  3CC2 A;  1SMY C;  4C3I B;  1W6J A;  3CF5 A;  2JEA I;  2QA4 A;  1SYB A;  2O4X A;  3HOW B;  3C0M A;  3UE1 A;  5EKI A;  3GTK H;  3K5N A;  1R4P B;  5I6Y A;  4QGU A;  1IYU A;  4JOI C;  1YIT A;  1SRU A;  2KJX A;  2QEX A;  1Y1W G;  1SFO H;  2GVA A;  5C44 H;  3S2H B;  1JC7 A;  2F0L A;  1SYF A;  1TWF H;  3VYS A;  2BOS A;  3L0O A;  4LNQ A;  1STN A;  4DR5 Q;  1FL0 A;  5IWA Q;  3E6Z X;  4HR7 B;  4DR5 L;  1WVL A;  5A2Q E;  4OX9 Q;  1N33 Q;  2EQS A;  4K6L A;  1MBY A;  2WFW A;  5EJW A;  5CMD A;  2K6A A;  4UP9 A;  2UXB L;  3NXW A;  3D31 A;  2R7Z G;  4B08 A;  1NBW A;  3CMA A;  2EYL A;  4A3L H;  1FNU A;  5ELB A;  2F0P A;  2UU9 Q;  1SMX A;  2UU9 L;  5EPL A;  1F2L A;  4R4Q A;  4KY5 A;  3CPW A;  1VQP A;  5CC4 A;  4L5R C;  2Y0S B;  1AN8 A;  4TSS A;  1QIL A;  3BYY B;  3J80 L;  4DR2 L;  1LAB A;  4A3D G;  2UXD L;  2LY7 A;  4DAM A;  3H94 A;  5K5P A;  1V43 A;  2BDO A;  2L12 A;  1I94 Q;  5FKA C;  1I94 L;  2F0S A;  5LL6 X;  2ZM6 Q;  4HJA A;  4JI1 L;  2MFI A;  1XJV A;  3OMC A;  4QMG A;  1JJC B;  3AU7 A;  2DY8 A;  2QGQ A;  1T5E A;  2WB1 B;  3HKZ B;  4DN4 M;  4PV1 C;  4A76 A;  1LM0 A;  1F2Y A;  1KL9 A;  1WCM G;  2OTJ A;  1QB5 D;  4BBS B;  4K6D A;  4KN7 C;  4A3K G;  1HNW Q;  2KED A;  1XTD A;  3AB9 A;  4BY7 B;  1X9N A;  3M4Y A;  4IUR A;  2LS0 1;  5FJ8 H;  3HOZ G;  4XT1 B;  4OEL B;  3CCV A;  3OTO L;  4JI4 Q;  4JI4 L;  5M3F G;  4NXM Q;  3HOY H;  1S4Z A;  1F9S A;  4NXM L;  1ASY A;  2XN9 C;  3QOL A;  3SGI A;  4JI6 Q;  4ZYS A;  1S5F D;  2CFM A;  3HG9 A;  2DGY A;  4RGN A;  1K8G A;  1ASZ A;  2ICE C;  1DYQ A;  1VQE A;  4XTC S;  4XYO A;  2Z6K C;  5E4X A;  5GAE C;  1NE3 A;  2JN4 A;  2ZJR A;  1LT5 D;  4XYQ A;  2R6G A;  4PZ6 A;  4L6T B;  5IP7 G;  1OXS C;  1NAP A;  4DF7 A;  2A19 A;  2VY3 A;  1PTO B;  4DU9 A;  2WAQ B;  1KAW A;  4B9X A;  3C2P A;  1ICF B;  4LFA Q;  4DUZ L;  2JA5 H;  4LFA L;  2NWG A;  2OEO A;  3ZYY X;  4HJ8 A;  1F9Q A;  1HR0 L;  2AHO B;  3ZJY C;  1K73 C;  1Y14 B;  4FO2 A;  4C2M H;  2F0J A;  2K5D A;  3M4P A;  3VYU A;  1KLU D;  4L5Q A;  2BH2 A;  2MQH A;  3H3V H;  2F0H A;  3TSS A;  3KLW A;  1SJH D;  4JYA Q;  3GTM B;  4KI0 A;  3TP5 A;  4B3T Q;  4B3T L;  2D5D A;  2B2T A;  2B39 A;  3Q24 A;  3ICE A;  3QB3 A;  4DR4 Q;  3S16 B;  3CCE A;  3I56 A;  3I4N H;  1F2Z A;  4EQN A;  3S1N H;  1Y8P B;  3PO2 B;  4BBR B;  4P75 A;  2AQ3 B;  4KLK A;  1BBX C;  4DV2 Q;  3J7A V;  1TR5 A;  4JI2 Q;  4K8J A;  1DGS A;  5LHY 1;  1VQB A;  1Y1V H;  1AP0 A;  3GO5 A;  1GKH A;  1PFS A;  3I90 A;  4QY7 A;  1I6H B;  4H13 C;  2B2Y C;  4GKJ Q; 
#chains in the Genus database with same CATH homology
 4QUC A;  3OOC A;  3MVV A;  2K33 A;  2JEB I;  2DY7 A;  4IUQ A;  1SFO B;  4H7B A;  3NP8 A;  3GV3 A;  5C44 B;  3K57 A;  1C8C A;  3LWE A;  4TKO B;  2ZXP A;  2EE1 A;  5K36 H;  2Z4I A;  2BA1 A;  2NTT A;  5JJZ A;  1PZI D;  3R93 A;  2N55 A;  3CU7 A;  1O7Z A;  2F0O A;  2F03 A;  2R61 A;  2KOL A;  4DA2 A;  4FVM A;  1RF2 D;  1JOQ A;  4K5X A;  1AEX A;  3VR2 A;  1WD0 A;  1DOL A;  1DON A;  1KAA A;  2F3V A;  1G8Z D;  5C0X H;  1CZG A;  4XQN A;  1L0X B;  5EPK A;  3SE0 A;  1ZXT A;  1Q1E A;  3OSO A;  2KQ3 A;  2A68 D;  3S15 B;  2ZXR A;  1PFM A;  4KY6 A;  3QOJ A;  4G57 A;  4IUV A;  5EBC A;  2PCF B;  3S1R B;  2XNA C;  1NSN S;  1V1P B;  5CV4 A;  2IX1 A;  1BUV T;  3T13 A;  1STA A;  4CKE A;  3NPP A;  5IGE A;  3K0Y A;  1OXX K;  1SE4 A;  1LTT D;  4Z9C B;  4K14 A;  2OXP A;  3I8Z A;  5BN3 A;  3C0N A;  2L5T A;  1IL8 A;  4RHR A;  1G2S A;  2EYF A;  4FF4 A;  3EA6 A;  5JPN C;  5J39 A;  1RDP D;  3P20 A;  1VF7 A;  2JA7 B;  2AQ1 B;  1DZ1 A;  2A5H A;  2B2W C;  1ET9 A;  2ZXO A;  5ELF A;  1A15 A;  2PO4 A;  3TZU A;  1ENA A;  2JA5 B;  3K5L A;  4OL7 A;  1EYC A;  1EZ8 A;  4DXG A;  1D6E C;  2A69 D;  5M5W B;  1V1P A;  2VXW A;  5D65 A;  2PW7 A;  1XYI A;  1CA6 A;  2BCO A;  2WKD A;  4C3J B;  1ESF A;  1G2T A;  1PFB A;  1U9R A;  1HHV A;  3I4N B;  1VMC A;  3DEP A;  3DWQ A;  4IFD I;  3D6W A;  4IUP A;  1FNW A;  5EKL A;  4BS9 A;  3PMF A;  3A8J E;  2MP1 A;  1Z52 A;  3E0J A;  1LO5 D;  1YNN D;  1Q3L A;  1R9T B;  2F0G A;  4O42 A;  1ZYR C;  3I3C A;  1E2W A;  3S2D B;  4PMC A;  1UNS A;  2QDB A;  1V8Q A;  5KIX A;  1B2T A;  4G7O C;  1F9P A;  3ERO A;  2D2C C;  3HP3 A;  4HMI A;  2L1B A;  4DNR B;  1JWS D;  3RZD B;  2XVS A;  1LTI D;  4N9T A;  2NN6 G;  1QOH A;  3CQZ B;  1G29 1;  3D8G A;  1Z47 A;  5I6W A;  1LTA D;  4KJO A;  1Y1W B;  4U68 A;  3MA2 B;  4G4K A;  1IKL A;  3BDO A;  3SEB A;  3GTJ B;  2F1M A;  2J0T D;  1B53 A;  2F0D A;  1HQR D;  4R9W A;  2R7Z B;  2RVL A;  1LTR D;  3P7J A;  1TU2 B;  3DEO A;  1SNC A;  4JK1 C;  3TN2 A;  4V0B A;  2FHT A;  2BA0 A;  1ENF A;  4A3D B;  1TII D;  2A6H D;  3K58 A;  4R8I A;  2PZU A;  3KLS X;  3R3O A;  2EZV A;  2KEC A;  1IYV A;  5IT9 L;  4DAY A;  1XX8 A;  3OIQ A;  3PIP 3;  1VMP A;  3KBX A;  1KAB A;  4CJ0 B;  3BG3 A;  3RMH A;  1U4L A;  1WCM B;  3KLR A;  3CKI B;  4HED A;  3M7G A;  2IPK D;  1PMR A;  1F9R A;  4A3K B;  1PXU A;  1RJT A;  4ZK9 B;  3L9A X;  1Z7T A;  3C1E A;  2E76 C;  4ZKB B;  3OWE B;  2BE5 C;  2HQE A;  4ZUI A;  3HOZ B;  3J81 E;  2K32 A;  3ND9 A;  1ICW A;  5M3F B;  3GD7 A;  4IUT A;  1STG A;  2K05 A;  1MSH A;  4MN3 A;  2RDF A;  3U9S A;  2EYJ A;  5DNF A;  3C3L A;  3LX0 A;  3OPO A;  1EY7 A;  1HCZ A;  1X3P A;  4F7X A;  2A74 C;  1AFP A;  1B9N A;  2JSO A;  3PUY A;  1MD2 D;  2VB2 X;  5KGU A;  1MGS A;  1PDQ A;  5IGB A;  5JEA J;  1PRT F;  2KA7 A;  2KHS A;  5T1I A;  5JOB A;  3GTQ B;  1E0B A;  1JWM D;  5I9O A;  2E2J B;  1JOR A;  3SK8 A;  1TY0 A;  5FOB B;  4KHV A;  4WOR A;  3GV6 A;  1B9M A;  1FD7 D;  3QO2 A;  2QKI C;  3W2D A;  1XTC D;  2E2D C;  4LMQ D;  4LK1 C;  4HSP A;  4TRD A;  3OWF A;  1FNV A;  3OW7 A;  1TKW B;  2B2T C;  2F0W A;  1BO0 A;  4AYB B;  4PNY A;  2CVR A;  4FF3 A;  1EQV A;  1SYC A;  1BDO A;  2C5C A;  2IJ0 A;  1QG7 A;  5C0X G;  1RCV D;  1CHP D;  1WTP A;  2EPB A;  2IT1 A;  5KND A;  4KN4 C;  3NSW A;  2NN6 H;  1PTO C;  1X32 A;  4RWS C;  1KDB A;  3S14 B;  5ELE A;  3Q22 A;  2SOB A;  1DM0 B;  2EYM A;  4H0L C;  2MJ8 A;  3HZX A;  3SVM A;  4YIJ A;  3D6C A;  3BVG A;  1Y8N B;  1QNK A;  3HEJ A;  3H09 A;  5ELD A;  3MAQ A;  2ZT9 C;  1KLG D;  5JEA G;  4DK1 A;  2LFN A;  4LJZ C;  3A7A B;  1EWH A;  5BN5 A;  2EYH A;  1VCI A;  1PYW D;  1AW7 A;  3JAM L;  1OXT A;  1S5B D;  2A6E C;  1ILP A;  1RHP A;  1E2Z A;  1SNQ A;  1W6K A;  1DD2 A;  3Q0A A;  1LAC A;  1S5E D;  4RH6 A;  4ZQ3 A;  4O1N A;  4FXK C;  3A8I E;  5M5X B;  3SHL A;  1GUO A;  1H9S B;  3V2T A;  3IL8 A;  1STH A;  4KMU C;  2WV6 D;  2RKS A;  2A73 B;  4KV6 A;  2RBM A;  1WD1 A;  4A3B B;  1G6Z A;  2M00 A;  2AUK A;  5J1Z A;  3NQT A;  1Q8I A;  5CBE E;  2JYO A;  2F0T A;  3IAY A;  3T4A C;  4OIJ A;  3HS0 C;  3SXH A;  1TS4 A;  1BCP D;  3NBI A;  3KBG A;  3MXN A;  1M8A A;  4ILW A;  1RTO A;  1HRJ A;  2F0K A;  2R93 B;  3S1M B;  2Q8R E;  1ET6 A;  4J6H A;  1XXG A;  2BDN A;  2X6G A;  4C1N K;  4ZKC B;  1C4Q A;  1H9S A;  3E5S A;  4J8Q A;  1B50 A;  4DAP A;  4NMZ A;  2PYK A;  5EQ0 A;  4NP5 A;  1DXM A;  2ID0 A;  4FYD A;  1SNO A;  1TS2 A;  4OIK A;  1ONL A;  1O7L A;  2NTS A;  3GTK B;  1HA5 A;  1LTG D;  3BVM A;  1D1K A;  1I4X A;  2PZT A;  2F0Q A;  1YNJ D;  1A3V A;  3NK9 A;  4KTA A;  3L3O C;  5A35 A;  4KK7 A;  1TWF B;  5HUR A;  1CM9 A;  4XXE A;  1Y8O B;  4QUF A;  1BCP F;  1K8O A;  3K7A B;  3G4N A;  2IL8 A;  3A54 A;  3H3V C;  5LL6 S;  4C3H G;  5IOD A;  3VYR A;  1EEF D;  1II3 A;  1GJX A;  4U67 3;  5C3X A;  3PUX A;  3N6R A;  3M7N A;  1NUC A;  1EQT A;  4P2C B;  3W3A A;  3MFY A;  3I4M B;  2AUJ D;  1TWG B;  2ENB A;  2D62 A;  1CQF A;  1PRE A;  1X3Q A;  2M9V A;  4KD4 A;  3DWP A;  5COR A;  2F0N A;  1SXT A;  1FGB D;  3MWY W;  4MIU A;  4KKU A;  5A2Q L;  1TS3 A;  3MHB A;  1JOO A;  3X3N A;  4DGZ A;  2WKC A;  3VA5 A;  3A7L A;  2WIN B;  2VNU D;  3SK5 A;  1EY5 A;  4HSV A;  1EU4 A;  5JEA H;  4X3S A;  3TP7 A;  3HOY B;  4PMB A;  1GUW A;  1E2V A;  2NBF A;  5CGK A;  2X69 A;  4IUU A;  3WDN A;  4RKL A;  2F0U A;  4FF2 A;  3MC0 B;  1GUT A;  2NYZ D;  2K28 A;  1HXY D;  5FLX E;  5M9O A;  5AFW A;  3V05 A;  2EY2 A;  1KNA A;  4ULL A;  1ZKO A;  5C0X I;  1JQY D;  4V19 0;  3DM1 A;  4C2M B;  3QG1 A;  1GHK A;  3NWS A;  1AZQ A;  5JPM C;  1STE A;  3DUZ A;  1LT4 D;  3WOF A;  4KHZ A;  4RGM A;  3RUZ A;  5DM6 3;  2OT2 A;  3FEW X;  3S1N B;  1VDZ A;  2JP1 A;  1SJE D;  3D3R A;  1Z6H A;  3F2U A;  1BOS A;  5KNB A;  3NTH A;  1MSG A;  1PZK D;  1Y1V B;  3G4O A;  3T16 A;  1BQQ T;  4M1U B;  3BDL A;  1SYG A;  3HOU B;  4F87 A;  4KD3 A;  2AWN A;  4LAA A;  3L7Z C;  1VF5 C;  1A3U A;  2QF7 A;  4IAL A;  4FXG C;  5E4W C;  5M3M B;  4RCO A;  1BCP B;  4Y7N B;  3UI2 A;  1IW7 C;  2N88 A;  3TBI B;  2A68 C;  1GUN A;  2B2V C;  2WP8 J;  1I4P A;  2QCP X;  4A93 B;  1JIC A;  2DNC A;  2G9D A;  2DNE A;  4KJN A;  1CK1 A;  1SSO A;  5ISR A;  1TY2 A;  3QWN A;  2AQ2 B;  5JVH 3;  3CRL C;  3S17 B;  4CBV A;  1BF4 A;  3FKI B;  2KUM A;  1MI2 A;  5JAV A;  2F0I A;  1TQO A;  4A3F B;  1H9K A;  4FP5 D;  1SAP A;  2FMM A;  3TP8 A;  1UAP A;  1GXD C;  3ND8 A;  1O78 A;  3J80 E;  3PUW A;  2QIL A;  2RDG A;  1KDC A;  3GTO B;  4G7Z C;  5DAU A;  2KCC A;  3HGB A;  4RA8 A;  5I4D A;  4XQQ A;  3EJI A;  3ERQ A;  3HRZ C;  5M5Y B;  5I9P A;  4QF4 A;  4CKC A;  5FO9 B;  3FPU B;  5EGT A;  1TWA B;  2A69 C;  1L0Y B;  3NUC A;  2CW0 D;  2O2L D;  3NE5 B;  4OO1 H;  2EOT A;  4EQO A;  1PRT D;  2K5W A;  2B2U A;  1SMY D;  2YYZ A;  3OHX C;  4X3U A;  1TWC B;  4K2K A;  4OHJ A;  1B44 D;  2XIW A;  3GP7 A;  2XWB B;  4ZRZ A;  2JA6 B;  3J7A F;  2JE6 I;  2LKV A;  3ONA B;  4E6I A;  2TSS A;  2MPM A;  2FJ2 A;  2F0E A;  2EYO A;  3PIO 3;  1ILQ A;  2EVB A;  4K5W A;  3Q23 A;  2E75 C;  5C4Z A;  1SNM A;  2K7V A;  3K5M A;  1YNN C;  4NDX A;  1I4Q A;  3CRK C;  1B1Z A;  4NW2 A;  2EY1 A;  1QE6 A;  1HQM C;  3URY A;  1D5X C;  3DMU A;  3S9W A;  1I4G A;  5FK9 C;  3TP6 A;  4HTH A;  3D4R A;  1RKN A;  3KLS A;  4DAV A;  2H4O A;  3GTL B;  3EQL C;  4I65 A;  4Q0F A;  5COY A;  3DXJ C;  2Q8I B;  3M4O B;  2IWH A;  4IFD J;  3Q6S A;  1HUM A;  2B2V A;  4B9W A;  2LMC B;  5IOC A;  5HGT A;  5ELC A;  1D2B A;  1J9O A;  2XSC A;  5C4J B;  2GA4 B;  1STB A;  4MHE A;  3RZO B;  4CJ1 B;  4JBW A;  2E2H B;  5CR3 A;  1RD9 D;  2SDF A;  3OMG A;  3HOX B;  1FYC A;  1NR2 A;  2M2L A;  3HOV B;  1WTQ A;  1AZP A;  2L11 A;  2RSO A;  2A6H C;  1M4V A;  4IN3 A;  2C9O A;  3LNN A;  3FDT A;  2NVX B;  2EY5 A;  1IKM A;  3VA7 A;  3DWA A;  1D5M C;  2PPB C;  5IGC A;  2E74 C;  4C3H B;  1G91 A;  1EY8 A;  2L9H A;  1TWH B;  4XQJ A;  2IX3 A;  1U4M A;  1TT2 A;  5D3D A;  2WII B;  4A3I B;  3I4L A;  1EFI D;  4I7Z C;  2RDH A;  2FMC A;  3LWU A;  3M3Y B;  4A3G B;  5FO7 B;  1LT3 D;  1HTP A;  4TQU S;  2KCN A;  3S1Q B;  4IFD G;  3H91 A;  3P75 A;  1SE2 A;  2I46 A;  5G3L F;  4HCS A;  2QEJ C;  1R4Q B;  2RQX A;  3K5O A;  3PO3 B;  1NR4 A;  3P1H A;  4L8J A;  5NUC A;  2FIN B;  4CJ2 C;  5KYL A;  5IIF A;  1S5D D;  1KTK A;  3KK7 A;  2O5I C;  3H6M A;  2ICI A;  3SR1 A;  5E3F A;  2B63 B;  2VB3 X;  1U4P A;  1DOK A;  1STY A;  2NN6 I;  1JB3 A;  4NKL A;  1WTR A;  1EYD A;  1CI3 M;  3KF8 A;  1RTN A;  1I4R A;  1SBB B;  2HUG A;  3A56 A;  1PRT B;  4KKS A;  1BXT A;  4FNF A;  3AMU A;  3VYT A;  3VR4 A;  1CHQ D;  4RKB A;  1DCZ A;  4HN7 A;  1QNU A;  1NCV A;  4DFA A;  1PZJ D;  1BR9 A;  2R92 B;  3J81 L;  5E1F A;  2PQE A;  1OXU A;  3NQI A;  3GTG B;  5I2X A;  5CBA E;  1H9R A;  5C6A A;  3QJY A;  5IGF A;  1UUP A;  5CV7 A;  1WTX A;  1ML0 D;  2EXZ A;  3BZD B;  1PFN A;  4XT3 B;  4PQX A;  1T5X D;  5JVG 3;  4GZY C;  1A2U A;  3R2I A;  1WTO A;  3VR3 A;  1LLR D;  4WJW A;  2PW5 A;  3C0O A;  1Q12 A;  3I72 A;  3PUV A;  2MUY A;  3BS1 A;  3CHB D;  3MZ5 A;  3MFG A;  3X3M A;  4BA2 I;  1F2M A;  3PV0 A;  1EY4 A;  3I91 A;  1LTS D;  5DM7 3;  1I6V C;  3RLF A;  5KYI A;  2L4N A;  1UEA B;  3FMC A;  3EVQ A;  3I70 A;  2F0M A;  1EY6 A;  2PNR C;  4M8A A;  4C3I G;  1Y69 U;  5EKK A;  4RGO S;  1HUN A;  1HA6 A;  3MTS A;  1OO9 B;  1EEI D;  1S5C D;  2K5Q A;  4X3T A;  2R3Z A;  5CV6 A;  5EPJ A;  2K01 A;  2Z1C A;  1I50 B;  4OO1 G;  1CA5 A;  2EJF C;  3A55 A;  1ZYR D;  2J4X A;  2XRQ D;  5C3W A;  5IT9 E;  1LV9 A;  1TVX A;  3O13 A;  3MXG A;  5KNC A;  1HTL D;  1A3T A;  1IW7 D;  1GHJ A;  1SYE A;  2IX0 A;  1WTW A;  3IKJ A;  2L55 A;  1QJO A;  4A3M B;  1EYA A;  1EOT A;  3T56 B;  1I3Q B;  2NVY B;  3R8B A;  1BCP C;  3NTI A;  2Q8T A;  4UDU C;  4XIG S;  4IQZ A;  4IFD H;  2G9H D;  1EIH A;  1EY9 A;  2CQA A;  2V4D A;  3MXU A;  1LTB D;  5C5M A;  3SDZ A;  3H0G B;  4K2L A;  4FF1 A;  3DHQ A;  2B2U C;  2PMZ B;  3QIA A;  2WAC A;  3I73 A;  2Z8L A;  4ABN A;  4A3E B;  4HAE A;  2JXM B;  1JCK B;  5CV9 A;  5C5L A;  2IW3 A;  3BYT B;  1CQV A;  2VUM B;  2NVQ B;  1LT6 D;  2MGS A;  4RFB A;  4ZUJ A;  2F3W A;  2EY6 A;  1YNJ C;  2DN8 A;  3V96 A;  1A2T A;  2SNS A;  1F77 A;  5DEH A;  1K8M A;  3T51 B;  2HCI A;  4ZAI A;  5FO8 B;  1KNE A;  2NUC A;  3WOE A;  1QCB D;  3MXP A;  3K59 A;  1DOM A;  4OGQ C;  1SDF A;  1OXV A;  3FRP B;  5TSS A;  4X3K A;  4CKB A;  4K8I A;  1V1O A;  1H9J A;  3GQB A;  4WFN 3;  1QWY A;  2L0C A;  1I4H A;  2B2Y A;  3FVQ A;  2J7Z A;  2XWJ B;  4C1N I;  1D1I A;  2BE5 D;  1C48 A;  5F2D A;  5CYU A;  1EIG A;  1HFG A;  2NZ1 D;  4F88 A;  2RA4 A;  2D9U A;  2Z4H A;  3TME A;  5D3I B;  3A8K E;  3K6O A;  1SND A;  1ROD A;  4BA1 I;  1O7Y A;  2F4I A;  3R2T A;  5KRU A;  4RAU C;  4ME5 A;  3D4W A;  2H1E A;  3IFT A;  4HCE A;  2PZW A;  1TS5 A;  1B3A A;  2O5J C;  4ZLT F;  5J22 A;  1BNZ A;  2K1B A;  4C56 C;  4FXD A;  5BN4 A;  2AWO A;  1H9M A;  1B4O A;  4L63 B;  1GUS A;  2B8G A;  4G7H C;  5CV8 A;  4BWG B;  2EJG C;  3EFX D;  5KEE A;  1PLF A;  4N9P A;  1EU3 A;  4K5V A;  3JAM E;  4EQP A;  1HPC A;  1FR3 A;  4XDX A;  5I2Y A;  4KY7 A;  5CV5 A;  4J1M A;  1KDA A;  2E2I B;  1WTV A;  2K04 A;  4R8N A;  4DNT B;  3FPP A;  4PMW A;  5EBD A;  4F8M A;  4BY1 B;  3NWT A;  1K83 B;  3BDC A;  2EJM A;  3M85 A;  3PUZ A;  4EVO A;  1EZ6 A;  3GTP B;  2SNM A;  3T53 B;  4CGY B;  3NHH A;  1ENC A;  4RCN A;  2B2W A;  4Q5V A;  4EGV A;  1CFM A;  2NB0 A;  1ZEQ X;  5T1G A;  1PTO D;  4RHS A;  5IGG A;  1EL0 A;  2F0V A;  2XRS D;  4IZ8 A;  1SNP A;  1EY0 A;  1CT1 D;  1HFN A;  4ODG A;  1O80 A;  2F0F A;  1GOZ A;  3N52 A;  5C0X J;  3G7L A;  3SK4 A;  4S3S A;  2KVM A;  4A3J B;  1Q90 A;  5D14 A;  3C1F A;  4QCL A;  2NVT B;  1JWU D;  2RSN A;  5C4H A;  1ESR A;  3C46 A;  3TDQ A;  1U4R A;  5FLX L;  2TMP A;  2A6E D;  1J8I A;  5C3E B;  4OO1 I;  5C4X B;  1JOK A;  3G6J B;  4CHT B;  4QIW B;  3NTK A;  2I07 B;  4QB4 A;  4KKT A;  1EWC A;  4C3J G;  3BVZ A;  3NBH A;  2HDL A;  2OF1 A;  3IFD A;  3D4D A;  1SYD A;  4ID6 A;  1DJR D;  2CHB D;  1JE4 A;  2HDM A;  2K03 A;  4WRD A;  3SK6 A;  2EYP A;  1IHZ A;  2JA8 B;  4DK0 A;  4DXF A;  2YU9 B;  2B8F A;  2KEE A;  1SE3 A;  1PTO H;  3J7Y W;  3VR5 A;  1PTO F;  3U9O A;  1Q1B A;  1CZW A;  1D5Z C;  5IGD A;  1A6X A;  3RD4 A;  1JR0 D;  1CTM A;  4UAI A;  4IUN A;  3KUP A;  3MEH A;  4HMJ A;  5G3L D;  2MHV A;  3OIP A;  3VR6 A;  2EDG A;  2FFK B;  3ITP A;  5K36 G;  1SEB D;  1GUG A;  2X6L A;  2HCC A;  2CW0 C;  2SEB D;  4H44 C;  3TZD A;  1XWE A;  1PRT C;  4RGT A;  1SMY C;  4C3I B;  1W6J A;  2JEA I;  1SYB A;  2O4X A;  3HOW B;  3C0M A;  5EKI A;  3K5N A;  1R4P B;  5I6Y A;  1IYU A;  2KJX A;  3S2H B;  1JC7 A;  2F0L A;  1SYF A;  3VYS A;  2BOS A;  1STN A;  3E6Z X;  4HR7 B;  1WVL A;  5A2Q E;  4K6L A;  1MBY A;  5EJW A;  5CMD A;  2K6A A;  3NXW A;  3D31 A;  4B08 A;  2EYL A;  1FNU A;  5ELB A;  2F0P A;  5EPL A;  1F2L A;  4KY5 A;  5CC4 A;  2Y0S B;  1AN8 A;  4TSS A;  1QIL A;  3BYY B;  3J80 L;  1LAB A;  2LY7 A;  3H94 A;  5K5P A;  1V43 A;  2BDO A;  2L12 A;  5FKA C;  2F0S A;  5LL6 X;  3OMC A;  4QMG A;  3AU7 A;  2DY8 A;  2WB1 B;  1T5E A;  3HKZ B;  4DN4 M;  4PV1 C;  1F2Y A;  1QB5 D;  4BBS B;  4K6D A;  4KN7 C;  2KED A;  3AB9 A;  4BY7 B;  3M4Y A;  4IUR A;  2LS0 1;  4XT1 B;  1S4Z A;  1F9S A;  2XN9 C;  3QOL A;  4ZYS A;  1S5F D;  3HG9 A;  4RGN A;  2ICE C;  1DYQ A;  4XTC S;  5E4X A;  4XYO A;  1LT5 D;  4XYQ A;  2R6G A;  4L6T B;  1OXS C;  1NAP A;  4DF7 A;  1PTO B;  4DU9 A;  2WAQ B;  4B9X A;  3C2P A;  2NWG A;  2OEO A;  3ZYY X;  1F9Q A;  4FO2 A;  2F0J A;  2K5D A;  3VYU A;  1KLU D;  2F0H A;  3TSS A;  1SJH D;  3GTM B;  4KI0 A;  3TP5 A;  2D5D A;  2B2T A;  2B39 A;  3Q24 A;  3QB3 A;  3S16 B;  1F2Z A;  4EQN A;  1Y8P B;  3PO2 B;  4BBR B;  2AQ3 B;  1BBX C;  3J7A V;  1TR5 A;  4K8J A;  5LHY 1;  1AP0 A;  3GO5 A;  3I90 A;  1I6H B;  4H13 C;  2B2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...