The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
GPLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
pubmed doi rcsb |
| molecule keywords |
Protein EMSY
|
| molecule tags |
Transcription
|
| source organism |
Homo sapiens
|
| total genus |
39
|
| structure length |
118
|
| sequence length |
118
|
| ec nomenclature | |
| pdb deposition date | 2006-01-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| E | PF03735 | ENT | ENT domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 1UZ3 A; 2FMM E; 1UTU A; #chains in the Genus database with same CATH topology 2J70 A; 5C8D A; 2FMM E; 1SV1 A; 2I2X B; 1Q6B A; 1R5Q A; 3IVA A; 4JGI A; 3BJD A; 1QTE A; 1SUY A; 3WHP A; 1W53 A; 3EZX A; 4HH3 C; 1SLY A; 3BUL A; 2J6Y A; 4G86 A; 1V2Z A; 1K7Y A; 1UZ3 A; 1Q6A A; 4M0M A; 3H20 A; 3L9T A; 1QSA A; 4X8Q A; 2J6Z A; 3IV9 A; 1UTU A; 5C5E A; 4HEH A; 3M1M A; 1K98 A; 1BMT A; 2PBI A; 1R8J A; #chains in the Genus database with same CATH homology 2FMM E; 1UZ3 A; 3M1M A; 4M0M A; 3L9T A; 3H20 A; 2PBI A; 4X8Q A; 1UTU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...