The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
MDFREVIEQRYHQLLSRYIAELTKTSLYQAQKFSRKTIEHQIPPEEIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAYQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and functional characterization of partner switching regulating the environmental stress response in Bacillus subtilis.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Bacillus subtilis
|
| molecule keywords |
PHOSPHOSERINE PHOSPHATASE RSBU
|
| total genus |
38
|
| structure length |
85
|
| sequence length |
85
|
| chains with identical sequence |
B, C, D, E
|
| ec nomenclature |
ec
3.1.3.3: Phosphoserine phosphatase. |
| pdb deposition date | 2006-10-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08673 | RsbU_N | Phosphoserine phosphatase RsbU, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 | KaiA/RbsU domain |
#chains in the Genus database with same CATH superfamily 1R5Q A; 1R8J A; 1SV1 A; 2J70 A; 4G86 A; 1W53 A; 5C5E A; 2J6Y A; 1Q6A A; 1SUY A; 1Q6B A; 2J6Z A; 1V2Z A; #chains in the Genus database with same CATH topology 2J70 A; 1W53 A; 3IVA A; 1Q6A A; 3IV9 A; 2J6Z A; 3L9T A; 5C5E A; 3EZX A; 1QTE A; 4HH3 C; 1UZ3 A; 1SV1 A; 4G86 A; 4HEH A; 3H20 A; 1BMT A; 2PBI A; 3BUL A; 1SUY A; 1V2Z A; 1SLY A; 1K7Y A; 1UTU A; 2FMM E; 4X8Q A; 4M0M A; 3WHP A; 4JGI A; 3M1M A; 2J6Y A; 2I2X B; 3BJD A; 1Q6B A; 1R5Q A; 5C8D A; 1R8J A; 1QSA A; 1K98 A; #chains in the Genus database with same CATH homology 1R5Q A; 1R8J A; 1SV1 A; 2J70 A; 4G86 A; 1W53 A; 5C5E A; 2J6Y A; 1Q6A A; 1SUY A; 1Q6B A; 2J6Z A; 1V2Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
