2M5J | Genus

Total Genus 15

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	15
sequence length	107
structure length	107
Chain Sequence	SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVLGAGGNNA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__5624383864330125__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__5624383864330125__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/2M5J/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__5624383864330125__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"5624383864330125","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/2M5J/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__5624383864330125__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/file/5cfd511d81a2fe2a04b24741/pdb.gz

Viewer cachePut https://genus.fuw.edu.pl/file/5cfd511d81a2fe2a04b24741/pdb.gz

FileManager.getAtomSetCollectionFromFile(/file/5cfd511d81a2fe2a04b24741/pdb.gz)

loadScript /static/js/j2s/core/corezip.z.js

The Resolver thinks Pdb

loadScript /static/js/j2s/core/corebio.z.js

Time for openFile(/file/5cfd511d81a2fe2a04b24741/pdb.gz): 827 ms

reading 107 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

107 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 18 ms

Adding embedded #jmolscript: select ({0:106});backbone only;select *;

platformSpeed = 8

cartoonsFancy = true

sheetSmoothing = 1.0

traceAlpha = true

loadScript /static/js/j2s/core/corescriptcmd.z.js

specularPower = 9

ambientPercent = 20

antialiasDisplay = true

Script completed

Jmol script terminated

loadScript /static/js/j2s/J/g3d/HermiteRenderer.js

loadScript /static/js/j2s/J/renderbio/BioMeshRenderer.js

loadScript /static/js/j2s/J/render/MeshRenderer.js

loadScript /static/js/j2s/J/shape/Mesh.js

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

molecule tags	Signaling protein
source organism	Serratia marcescens
publication title	Interaction of a Partially Disordered Antisigma Factor with Its Partner, the Signaling Domain of the TonB-Dependent Transporter HasR pubmed doi rcsb
molecule keywords	HasR protein
total genus	15
structure length	107
sequence length	107
ec nomenclature
pdb deposition date	2013-02-26

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF07660	STN	Secretin and TonB N terminus short domain

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
3.55.50.30	Alpha Beta	3-Layer(bab) Sandwich	Phage tail protein beta-alpha-beta fold	Phage tail protein beta-alpha-beta fold	2m5jA00

4G08A 2W76A 1ZZVA 2W16A 4M0NA 2M5JA 2W6UA 2W78A 2D1UA 3GR5A 2W6TA 4JTMA 2W75A 2W77A 2IAHA 4M0HA 4AR0A 2A02A 2O5PA 3EZJA
chains in the Genus database with same CATH superfamily

3OV5A 2X531 4UHVA 3CDDA 4G08A 2Z6BD 1ZZVA 2W76A 2P5ZX 4M0NA 2W16A 2L4WA 2M5JA 2W6UA 2W78A 2D1UA 1K28D 2WZPR 3ADYA 3GR5A 2W6TA 4JTMA 2W75A 1WRUA 3GS9A 2W77A 2IAHA 4M0HA 3D37A 4AR0A 4MTKA 2A02A 1WTHD 2O5PA 3EZJA
chains in the Genus database with same CATH topology

3OV5A 2X531 4G08A 2Z6BD 1ZZVA 2W76A 4M0NA 2W16A 2L4WA 2M5JA 2W6UA 2W78A 2D1UA 1K28D 2WZPR 3ADYA 3GR5A 2W6TA 4JTMA 2W75A 3GS9A 2W77A 2IAHA 4M0HA 4AR0A 2A02A 1WTHD 2O5PA 3EZJA
chains in the Genus database with same CATH homology

#chains in the Genus database with same CATH superfamily
 4G08 A;  2W76 A;  1ZZV A;  2W16 A;  4M0N A;  2M5J A;  2W6U A;  2W78 A;  2D1U A;  3GR5 A;  2W6T A;  4JTM A;  2W75 A;  2W77 A;  2IAH A;  4M0H A;  4AR0 A;  2A02 A;  2O5P A;  3EZJ A; 
#chains in the Genus database with same CATH topology
 3OV5 A;  2X53 1;  4UHV A;  3CDD A;  4G08 A;  2Z6B D;  1ZZV A;  2W76 A;  2P5Z X;  4M0N A;  2W16 A;  2L4W A;  2M5J A;  2W6U A;  2W78 A;  2D1U A;  1K28 D;  2WZP R;  3ADY A;  3GR5 A;  2W6T A;  4JTM A;  2W75 A;  1WRU A;  3GS9 A;  2W77 A;  2IAH A;  4M0H A;  3D37 A;  4AR0 A;  4MTK A;  2A02 A;  1WTH D;  2O5P A;  3EZJ A; 
#chains in the Genus database with same CATH homology
 3OV5 A;  2X53 1;  4G08 A;  2Z6B D;  1ZZV A;  2W76 A;  4M0N A;  2W16 A;  2L4W A;  2M5J A;  2W6U A;  2W78 A;  2D1U A;  1K28 D;  2WZP R;  3ADY A;  3GR5 A;  2W6T A;  4JTM A;  2W75 A;  3GS9 A;  2W77 A;  2IAH A;  4M0H A;  4AR0 A;  2A02 A;  1WTH D;  2O5P A;  3EZJ A;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

2M5JA

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN

pfam database annotations