The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
107
|
structure length |
107
|
Chain Sequence |
SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVLGAGGNNA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Interaction of a Partially Disordered Antisigma Factor with Its Partner, the Signaling Domain of the TonB-Dependent Transporter HasR
pubmed doi rcsb |
molecule tags |
Signaling protein
|
source organism |
Serratia marcescens
|
molecule keywords |
HasR protein
|
total genus |
15
|
structure length |
107
|
sequence length |
107
|
ec nomenclature | |
pdb deposition date | 2013-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07660 | STN | Secretin and TonB N terminus short domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bab) Sandwich | Phage tail protein beta-alpha-beta fold | Phage tail protein beta-alpha-beta fold |
#chains in the Genus database with same CATH superfamily 3GR5 A; 4JTM A; 2W75 A; 2M5J A; 1ZZV A; 4M0H A; 2IAH A; 2W76 A; 2O5P A; 2W78 A; 4M0N A; 2W16 A; 3EZJ A; 4AR0 A; 2W77 A; 2W6T A; 2A02 A; 2D1U A; 2W6U A; 4G08 A; #chains in the Genus database with same CATH topology 3GR5 A; 3GS9 A; 2P5Z X; 4UHV A; 4JTM A; 2W75 A; 3OV5 A; 2M5J A; 1ZZV A; 4M0H A; 2IAH A; 2W76 A; 2O5P A; 3ADY A; 1WRU A; 4MTK A; 2W78 A; 1K28 D; 2Z6B D; 4M0N A; 2W16 A; 2WZP R; 2X53 1; 2L4W A; 3EZJ A; 3CDD A; 4AR0 A; 2W77 A; 3D37 A; 2W6T A; 2A02 A; 2D1U A; 2W6U A; 4G08 A; 1WTH D; #chains in the Genus database with same CATH homology 3GR5 A; 3GS9 A; 4JTM A; 2W75 A; 3OV5 A; 2M5J A; 1ZZV A; 4M0H A; 2IAH A; 2W76 A; 2O5P A; 3ADY A; 2W78 A; 1K28 D; 2Z6B D; 4M0N A; 2W16 A; 2WZP R; 2X53 1; 2L4W A; 3EZJ A; 4AR0 A; 2W77 A; 2W6T A; 2A02 A; 2D1U A; 2W6U A; 4G08 A; 1WTH D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...