4G08A

Crystal structure of the periplasmic domain of invg
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein InvG
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4g08A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 4g08A01
4EC5A 4E9JA 2W75A 4AR0A 3EZJA 2IAHA 2D1UA 4M0NA 2W6TA 2M5JA 3GR5A 2O5PA 2W77A 2W6UA 2W76A 4M0HA 4G08A 1ZZVA 4JTMA 2Y3MA 2A02A 2W16A 3OSSD 2W78A
chains in the Genus database with same CATH superfamily
1ZZJA 3T1YH 2LTLA 4FJSA 4EC5A 1VBIA 4DR6H 1XNRH 2HHHH 1K28D 2W75A 2X06A 4DV6H 4BA2I 1S20A 2JA9A 2VKCA 1WRUA 1DTJA 2JEAI 2OPUA 4JVHA 5FLXW 2UU9H 4GKKH 2CPMA 5LMNH 2IAHA 4K0KH 3GABA 1N33H 3CDDA 4YY3H 4B8TA 1FJGH 4WANA 2K1HA 4X65H 1Z2IA 2CTEA 2FPHX 4WALA 1ZZIA 2W6UA 4AQYH 2ZM6H 4OO1G 4NZRM 3U1KA 3QD7X 3V69A 1N36H 5A2QW 1FKAH 3SB1A 1KHMA 3GS9A 4OX9H 4G08A 4OD6A 1SEIA 2NN6G 3FAUA 3KDKA 1XRHA 2VQFH 4DR4H 1ZZVA 2F4VH 2FMRA 3OV5A 1I94H 2UUAH 4B8CD 2W16A 4DV7H 4DV2H 1XMQH 4AM3A 4B3RH 4JV5H 4X64H 1PQXA 2PT7G 2FFMA 1ZZKA 4LIJA 3J81W 5LL6b 3ADYA 2A1SA 4E9JA 4AIMA 4DV1H 1WE8A 1HR0H 4YHHH 1HNXH 1VIGA 2HH2A 4LF6H 2W6TA 2CWHA 1S03G 2ANNA 4QMFB 4JI7H 5JEAG 2E5LH 2O5PA 4H8AA 2G8YA 4LF5H 2JEBI 2P5ZX 4LFAH 1X4NA 4DV0H 2Z6BD 5C0XG 4M0HA 5LMUH 3L7ZC 4NXNH 3T1HH 3JAMW 2Z0SA 2PQUA 5DT9A 2VQEH 1WTJA 2CWFA 4JI2H 2CPQA 1HNZH 4LF4H 1XNQH 2JZXA 2CTLA 2E3UA 5BR8H 4JVYA 2YQRA 1IBMH 2X531 1UG8A 4B3MH 4B3SH 3GKUA 2AXYA 2UUBH 2WZPR 4DV4H 2CTKA 2UUCH 2JE6I 1VIHA 4LF7H 4NXMH 2OPVA 1N32H 4LFBH 4DR3H 2D1UA 4IFDG 1I6UA 4JI4H 1MSZA 1ZTGA 4JI3H 4M0NA 2D9IA 1IBKH 1X4MA 4OCHA 4DR1H 2M8WA 1J4WA 2M5JA 4JI0H 5IT9W 2PY9A 2LTMA 1ODHA 4PDBA 1X0AA 4FJUA 2QNDA 2UXDH 3UOEA 1WVNA 4BA1I 3J80W 2LRRA 2O4CA 4KHPH 2M6QA 1WHRA 4JI8H 2A02A 2L4WA 3AEVB 1X9ZA 1V9NA 3NCVA 2DGRA 4DR2H 2ZQEA 2BL5A 4JI5H 3J7AK 3D37A 5K36G 1NXUA 2ANRA 2JVZA 1F0XA 4DV3H 1WTHD 4X66H 4MTKA 4JI1H 4AR0A 1K1GA 3KDGA 3EZJA 4NZTM 4LF8H 4DR5H 1XMOH 1J5KA 4DUYH 1TUAA 2UXCH 4JI6H 2HH3A 3OTOH 2CTJA 2CTMA 4B3TH 4NBQA 2BA0A 3GR5A 3I0PA 2P2RA 2W77A 2W76A 4DR7H 1IBLH 4UHVA 2UXBH 1HNWH 1N34H 4GKJH 1AN7A 3RF2A 4LFCH 1DT4A 1J5EH 2MJHA 2LF0A 4DV5H 4X62H 1V8CA 1EC6A 3VKEA 4JYAH 2Y3MA 4JTMA 5IWAH 3OSSD 2W78A 4LF9H 2CTFA 3OETA 4DUZH
chains in the Genus database with same CATH topology
3T1YH 4EC5A 4DR6H 1XNRH 2HHHH 1K28D 2W75A 4DV6H 2VKCA 5FLXW 2UU9H 4GKKH 5LMNH 2IAHA 4K0KH 3GABA 1N33H 4YY3H 1FJGH 4X65H 2FPHX 2W6UA 4AQYH 2ZM6H 4NZRM 1FKAH 3QD7X 1N36H 5A2QW 3SB1A 3GS9A 4OX9H 4G08A 4OD6A 1SEIA 3KDKA 3FAUA 2VQFH 4DR4H 1ZZVA 2F4VH 3OV5A 1I94H 2UUAH 4B8CD 2W16A 4DV7H 4DV2H 1XMQH 4JV5H 4B3RH 4X64H 2PT7G 3J81W 3ADYA 5LL6b 4E9JA 4DV1H 1HR0H 4YHHH 1HNXH 4LF6H 2W6TA 1S03G 4JI7H 2O5PA 2E5LH 4LF5H 4M0HA 2Z6BD 4LFAH 4DV0H 5LMUH 4NXNH 3T1HH 3JAMW 5DT9A 2VQEH 4JI2H 1HNZH 4LF4H 1XNQH 5BR8H 1IBMH 2X531 4B3MH 4B3SH 2UUBH 2WZPR 4DV4H 2UUCH 4LF7H 4NXMH 1N32H 4LFBH 4DR3H 2D1UA 4M0NA 1I6UA 4JI4H 4JI3H 2D9IA 1IBKH 4OCHA 4DR1H 2M5JA 4JI0H 5IT9W 1ODHA 4PDBA 2UXDH 3J80W 2O4CA 4KHPH 4JI8H 2A02A 2L4WA 1X9ZA 3NCVA 4DR2H 2ZQEA 4JI5H 3J7AK 1WTHD 1F0XA 4DV3H 4X66H 4JI1H 4AR0A 3KDGA 3EZJA 4NZTM 4LF8H 4DR5H 1XMOH 4DUYH 2UXCH 4JI6H 3OTOH 4B3TH 3GR5A 2W77A 2W76A 4DR7H 1IBLH 2UXBH 1HNWH 1N34H 4GKJH 1AN7A 3RF2A 4LFCH 1J5EH 2LF0A 4DV5H 4X62H 4JYAH 4JTMA 2Y3MA 5IWAH 3OSSD 2W78A 4LF9H 3OETA 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC5 A;  4E9J A;  2W75 A;  4AR0 A;  3EZJ A;  2IAH A;  2D1U A;  4M0N A;  2W6T A;  2M5J A;  3GR5 A;  2O5P A;  2W77 A;  2W6U A;  2W76 A;  4M0H A;  4G08 A;  1ZZV A;  4JTM A;  2Y3M A;  2A02 A;  2W16 A;  3OSS D;  2W78 A; 
#chains in the Genus database with same CATH topology
 1ZZJ A;  3T1Y H;  2LTL A;  4FJS A;  4EC5 A;  1VBI A;  4DR6 H;  1XNR H;  2HHH H;  1K28 D;  2W75 A;  2X06 A;  4DV6 H;  4BA2 I;  1S20 A;  2JA9 A;  2VKC A;  1WRU A;  1DTJ A;  2JEA I;  2OPU A;  4JVH A;  5FLX W;  2UU9 H;  4GKK H;  2CPM A;  5LMN H;  2IAH A;  4K0K H;  3GAB A;  1N33 H;  3CDD A;  4YY3 H;  4B8T A;  1FJG H;  4WAN A;  2K1H A;  4X65 H;  1Z2I A;  2CTE A;  2FPH X;  4WAL A;  1ZZI A;  2W6U A;  4AQY H;  2ZM6 H;  4OO1 G;  4NZR M;  3U1K A;  3QD7 X;  3V69 A;  1N36 H;  5A2Q W;  1FKA H;  3SB1 A;  1KHM A;  3GS9 A;  4OX9 H;  4G08 A;  4OD6 A;  1SEI A;  2NN6 G;  3FAU A;  3KDK A;  1XRH A;  2VQF H;  4DR4 H;  1ZZV A;  2F4V H;  2FMR A;  3OV5 A;  1I94 H;  2UUA H;  4B8C D;  2W16 A;  4DV7 H;  4DV2 H;  1XMQ H;  4AM3 A;  4B3R H;  4JV5 H;  4X64 H;  1PQX A;  2PT7 G;  2FFM A;  1ZZK A;  4LIJ A;  3J81 W;  5LL6 b;  3ADY A;  2A1S A;  4E9J A;  4AIM A;  4DV1 H;  1WE8 A;  1HR0 H;  4YHH H;  1HNX H;  1VIG A;  2HH2 A;  4LF6 H;  2W6T A;  2CWH A;  1S03 G;  2ANN A;  4QMF B;  4JI7 H;  5JEA G;  2E5L H;  2O5P A;  4H8A A;  2G8Y A;  4LF5 H;  2JEB I;  2P5Z X;  4LFA H;  1X4N A;  4DV0 H;  2Z6B D;  5C0X G;  4M0H A;  5LMU H;  3L7Z C;  4NXN H;  3T1H H;  3JAM W;  2Z0S A;  2PQU A;  5DT9 A;  2VQE H;  1WTJ A;  2CWF A;  4JI2 H;  2CPQ A;  1HNZ H;  4LF4 H;  1XNQ H;  2JZX A;  2CTL A;  2E3U A;  5BR8 H;  4JVY A;  2YQR A;  1IBM H;  2X53 1;  1UG8 A;  4B3M H;  4B3S H;  3GKU A;  2AXY A;  2UUB H;  2WZP R;  4DV4 H;  2CTK A;  2UUC H;  2JE6 I;  1VIH A;  4LF7 H;  4NXM H;  2OPV A;  1N32 H;  4LFB H;  4DR3 H;  2D1U A;  4IFD G;  1I6U A;  4JI4 H;  1MSZ A;  1ZTG A;  4JI3 H;  4M0N A;  2D9I A;  1IBK H;  1X4M A;  4OCH A;  4DR1 H;  2M8W A;  1J4W A;  2M5J A;  4JI0 H;  5IT9 W;  2PY9 A;  2LTM A;  1ODH A;  4PDB A;  1X0A A;  4FJU A;  2QND A;  2UXD H;  3UOE A;  1WVN A;  4BA1 I;  3J80 W;  2LRR A;  2O4C A;  4KHP H;  2M6Q A;  1WHR A;  4JI8 H;  2A02 A;  2L4W A;  3AEV B;  1X9Z A;  1V9N A;  3NCV A;  2DGR A;  4DR2 H;  2ZQE A;  2BL5 A;  4JI5 H;  3J7A K;  3D37 A;  5K36 G;  1NXU A;  2ANR A;  2JVZ A;  1F0X A;  4DV3 H;  1WTH D;  4X66 H;  4MTK A;  4JI1 H;  4AR0 A;  1K1G A;  3KDG A;  3EZJ A;  4NZT M;  4LF8 H;  4DR5 H;  1XMO H;  1J5K A;  4DUY H;  1TUA A;  2UXC H;  4JI6 H;  2HH3 A;  3OTO H;  2CTJ A;  2CTM A;  4B3T H;  4NBQ A;  2BA0 A;  3GR5 A;  3I0P A;  2P2R A;  2W77 A;  2W76 A;  4DR7 H;  1IBL H;  4UHV A;  2UXB H;  1HNW H;  1N34 H;  4GKJ H;  1AN7 A;  3RF2 A;  4LFC H;  1DT4 A;  1J5E H;  2MJH A;  2LF0 A;  4DV5 H;  4X62 H;  1V8C A;  1EC6 A;  3VKE A;  4JYA H;  2Y3M A;  4JTM A;  5IWA H;  3OSS D;  2W78 A;  4LF9 H;  2CTF A;  3OET A;  4DUZ H; 
#chains in the Genus database with same CATH homology
 3T1Y H;  4EC5 A;  4DR6 H;  1XNR H;  2HHH H;  1K28 D;  2W75 A;  4DV6 H;  2VKC A;  5FLX W;  2UU9 H;  4GKK H;  5LMN H;  2IAH A;  4K0K H;  3GAB A;  1N33 H;  4YY3 H;  1FJG H;  4X65 H;  2FPH X;  2W6U A;  4AQY H;  2ZM6 H;  4NZR M;  1FKA H;  3QD7 X;  1N36 H;  5A2Q W;  3SB1 A;  3GS9 A;  4OX9 H;  4G08 A;  4OD6 A;  1SEI A;  3KDK A;  3FAU A;  2VQF H;  4DR4 H;  1ZZV A;  2F4V H;  3OV5 A;  1I94 H;  2UUA H;  4B8C D;  2W16 A;  4DV7 H;  4DV2 H;  1XMQ H;  4JV5 H;  4B3R H;  4X64 H;  2PT7 G;  3J81 W;  3ADY A;  5LL6 b;  4E9J A;  4DV1 H;  1HR0 H;  4YHH H;  1HNX H;  4LF6 H;  2W6T A;  1S03 G;  4JI7 H;  2O5P A;  2E5L H;  4LF5 H;  4M0H A;  2Z6B D;  4LFA H;  4DV0 H;  5LMU H;  4NXN H;  3T1H H;  3JAM W;  5DT9 A;  2VQE H;  4JI2 H;  1HNZ H;  4LF4 H;  1XNQ H;  5BR8 H;  1IBM H;  2X53 1;  4B3M H;  4B3S H;  2UUB H;  2WZP R;  4DV4 H;  2UUC H;  4LF7 H;  4NXM H;  1N32 H;  4LFB H;  4DR3 H;  2D1U A;  4M0N A;  1I6U A;  4JI4 H;  4JI3 H;  2D9I A;  1IBK H;  4OCH A;  4DR1 H;  2M5J A;  4JI0 H;  5IT9 W;  1ODH A;  4PDB A;  2UXD H;  3J80 W;  2O4C A;  4KHP H;  4JI8 H;  2A02 A;  2L4W A;  1X9Z A;  3NCV A;  4DR2 H;  2ZQE A;  4JI5 H;  3J7A K;  1WTH D;  1F0X A;  4DV3 H;  4X66 H;  4JI1 H;  4AR0 A;  3KDG A;  3EZJ A;  4NZT M;  4LF8 H;  4DR5 H;  1XMO H;  4DUY H;  2UXC H;  4JI6 H;  3OTO H;  4B3T H;  3GR5 A;  2W77 A;  2W76 A;  4DR7 H;  1IBL H;  2UXB H;  1HNW H;  1N34 H;  4GKJ H;  1AN7 A;  3RF2 A;  4LFC H;  1J5E H;  2LF0 A;  4DV5 H;  4X62 H;  4JYA H;  4JTM A;  2Y3M A;  5IWA H;  3OSS D;  2W78 A;  4LF9 H;  3OET A;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...