4G08A

Crystal structure of the periplasmic domain of invg
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Protein InvG
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4g08A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 4g08A01
2M5JA 4E9JA 4M0HA 3GR5A 4G08A 2D1UA 4AR0A 4M0NA 4EC5A 2W6TA 2A02A 2W16A 2W77A 3EZJA 4JTMA 2Y3MA 2W78A 2O5PA 1ZZVA 2W76A 2IAHA 2W6UA 2W75A 3OSSD
chains in the Genus database with same CATH superfamily
4JI1H 1WTJA 1PQXA 2PQUA 2VKCA 4B8TA 4LF4H 3J7AK 4DUYH 1EC6A 3FAUA 4H8AA 4NZRM 2ANNA 3V69A 4X66H 4LFAH 3I0PA 4YY3H 4B3MH 4IFDG 1HNZH 4FJSA 1WTHD 4AR0A 3QD7X 1V8CA 4KHPH 2P2RA 1MSZA 1N33H 2JZXA 4DR7H 4DV3H 1S20A 4DR1H 2M6QA 1J5KA 1K1GA 2X531 3CDDA 5FLXW 1ODHA 1I6UA 2E5LH 2JEBI 2JVZA 2D9IA 3KDGA 4UHVA 1KHMA 3OTOH 2W78A 1DT4A 2HH2A 2LRRA 1F0XA 5K36G 1HNWH 2K1HA 1FKAH 2W6UA 2W75A 4YHHH 4DR6H 1UG8A 2PY9A 3VKEA 1AN7A 1WHRA 3L7ZC 4NXMH 4DV5H 2WZPR 1IBMH 2JE6I 2M5JA 3AEVB 1IBKH 4JI2H 4LF9H 4DUZH 5DT9A 1DTJA 3J81W 2ZQEA 4DV0H 4JI4H 4DR2H 5LL6b 4LF7H 2F4VH 4WALA 4DV6H 2CWHA 4LF8H 2A1SA 4JV5H 4B3RH 3JAMW 2DGRA 2CPQA 4LIJA 4NBQA 4JVYA 2E3UA 1VIHA 4BA2I 4B3TH 2W77A 4DV1H 1XNQH 3UOEA 1ZZIA 4PDBA 4GKJH 4AM3A 1N32H 1K28D 2O5PA 2W76A 3U1KA 4LF5H 4NXNH 2UXBH 4B3SH 2FMRA 2JEAI 3KDKA 3SB1A 2CPMA 5A2QW 4OO1G 1X0AA 2LTLA 3GKUA 2CWFA 4GKKH 2UXCH 4B8CD 1IBLH 4OCHA 1HNXH 2CTJA 4FJUA 4E9JA 2UU9H 4M0HA 2OPUA 2X06A 3GR5A 4G08A 1FJGH 3T1YH 4JI7H 1WRUA 2AXYA 2CTKA 1NXUA 2FFMA 4JI3H 2D1UA 5BR8H 4LFCH 1X4MA 2M8WA 2MJHA 4DV2H 2LTMA 4DR5H 5IT9W 4OD6A 2L4WA 1XNRH 3D37A 4EC5A 1J4WA 1S03G 3OV5A 2W6TA 4JI5H 2CTMA 2HH3A 2A02A 2W16A 3ADYA 3RF2A 1X4NA 1X9ZA 3EZJA 1WE8A 4X64H 2Y3MA 2YQRA 4WANA 4X62H 4AIMA 1VBIA 1Z2IA 2QNDA 2OPVA 4MTKA 5C0XG 1XRHA 2UUCH 5LMUH 4K0KH 1TUAA 1ZZJA 2Z0SA 3OSSD 1N36H 1ZTGA 4JI0H 3NCVA 4NZTM 4BA1I 2O4CA 2CTFA 2PT7G 4OX9H 4JVHA 2VQEH 5JEAG 1I94H 1XMOH 4DV4H 2HHHH 2ZM6H 2JA9A 2UXDH 5LMNH 2FPHX 2Z6BD 3GS9A 2G8YA 4M0NA 3J80W 1ZZKA 1VIGA 2P5ZX 2VQFH 4DR3H 4DR4H 3GABA 1XMQH 4LFBH 2BL5A 2NN6G 4JI8H 1V9NA 1J5EH 5IWAH 4JYAH 4JTMA 4JI6H 3OETA 2ANRA 1ZZVA 2UUAH 1HR0H 2IAHA 2UUBH 1SEIA 2BA0A 4X65H 3T1HH 2LF0A 4LF6H 2CTLA 1WVNA 4QMFB 4AQYH 4DV7H 1N34H 2CTEA
chains in the Genus database with same CATH topology
4JI1H 2VKCA 4LF4H 3J7AK 4DUYH 3FAUA 4NZRM 4LFAH 4X66H 4YY3H 4B3MH 1HNZH 1WTHD 4AR0A 3QD7X 4KHPH 1N33H 4DR7H 4DV3H 4DR1H 2X531 5FLXW 1ODHA 1I6UA 2E5LH 3KDGA 2D9IA 2W78A 3OTOH 1F0XA 1HNWH 1FKAH 2W6UA 2W75A 4YHHH 4DR6H 1AN7A 2WZPR 4NXMH 4DV5H 1IBMH 2M5JA 1IBKH 4JI2H 4LF9H 4DUZH 5DT9A 3J81W 2ZQEA 4DV0H 4JI4H 4DR2H 5LL6b 4LF7H 2F4VH 4DV6H 4LF8H 4JV5H 4B3RH 3JAMW 4B3TH 2W77A 4DV1H 1XNQH 1K28D 4PDBA 4GKJH 2O5PA 1N32H 2W76A 4LF5H 2UXBH 4NXNH 4B3SH 3KDKA 3SB1A 5A2QW 2UXCH 4GKKH 4B8CD 1IBLH 4OCHA 1HNXH 4M0HA 4E9JA 2UU9H 3GR5A 4G08A 1FJGH 3T1YH 4JI7H 4JI3H 2D1UA 5BR8H 4LFCH 4DV2H 4DR5H 5IT9W 4OD6A 2L4WA 1XNRH 4EC5A 1S03G 3OV5A 2W6TA 4JI5H 2A02A 2W16A 3ADYA 3RF2A 1X9ZA 3EZJA 4X64H 2Y3MA 4X62H 2UUCH 5LMUH 4K0KH 3OSSD 1N36H 4JI0H 3NCVA 4NZTM 2O4CA 2PT7G 4OX9H 2VQEH 1I94H 1XMOH 4DV4H 2HHHH 2ZM6H 2UXDH 5LMNH 2FPHX 2Z6BD 3GS9A 4M0NA 3J80W 2VQFH 4DR3H 4DR4H 3GABA 1XMQH 4LFBH 4JI8H 1J5EH 4JYAH 5IWAH 4JTMA 4JI6H 3OETA 1ZZVA 2UUAH 1HR0H 2IAHA 2UUBH 1SEIA 3T1HH 4X65H 2LF0A 4LF6H 4AQYH 4DV7H 1N34H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5J A;  4E9J A;  4M0H A;  3GR5 A;  4G08 A;  2D1U A;  4AR0 A;  4M0N A;  4EC5 A;  2W6T A;  2A02 A;  2W16 A;  2W77 A;  3EZJ A;  4JTM A;  2Y3M A;  2W78 A;  2O5P A;  1ZZV A;  2W76 A;  2IAH A;  2W6U A;  2W75 A;  3OSS D; 
#chains in the Genus database with same CATH topology
 4JI1 H;  1WTJ A;  1PQX A;  2PQU A;  2VKC A;  4B8T A;  4LF4 H;  3J7A K;  4DUY H;  1EC6 A;  3FAU A;  4H8A A;  4NZR M;  2ANN A;  3V69 A;  4X66 H;  4LFA H;  3I0P A;  4YY3 H;  4B3M H;  4IFD G;  1HNZ H;  4FJS A;  1WTH D;  4AR0 A;  3QD7 X;  1V8C A;  4KHP H;  2P2R A;  1MSZ A;  1N33 H;  2JZX A;  4DR7 H;  4DV3 H;  1S20 A;  4DR1 H;  2M6Q A;  1J5K A;  1K1G A;  2X53 1;  3CDD A;  5FLX W;  1ODH A;  1I6U A;  2E5L H;  2JEB I;  2JVZ A;  2D9I A;  3KDG A;  4UHV A;  1KHM A;  3OTO H;  2W78 A;  1DT4 A;  2HH2 A;  2LRR A;  1F0X A;  5K36 G;  1HNW H;  2K1H A;  1FKA H;  2W6U A;  2W75 A;  4YHH H;  4DR6 H;  1UG8 A;  2PY9 A;  3VKE A;  1AN7 A;  1WHR A;  3L7Z C;  4NXM H;  4DV5 H;  2WZP R;  1IBM H;  2JE6 I;  2M5J A;  3AEV B;  1IBK H;  4JI2 H;  4LF9 H;  4DUZ H;  5DT9 A;  1DTJ A;  3J81 W;  2ZQE A;  4DV0 H;  4JI4 H;  4DR2 H;  5LL6 b;  4LF7 H;  2F4V H;  4WAL A;  4DV6 H;  2CWH A;  4LF8 H;  2A1S A;  4JV5 H;  4B3R H;  3JAM W;  2DGR A;  2CPQ A;  4LIJ A;  4NBQ A;  4JVY A;  2E3U A;  1VIH A;  4BA2 I;  4B3T H;  2W77 A;  4DV1 H;  1XNQ H;  3UOE A;  1ZZI A;  4PDB A;  4GKJ H;  4AM3 A;  1N32 H;  1K28 D;  2O5P A;  2W76 A;  3U1K A;  4LF5 H;  4NXN H;  2UXB H;  4B3S H;  2FMR A;  2JEA I;  3KDK A;  3SB1 A;  2CPM A;  5A2Q W;  4OO1 G;  1X0A A;  2LTL A;  3GKU A;  2CWF A;  4GKK H;  2UXC H;  4B8C D;  1IBL H;  4OCH A;  1HNX H;  2CTJ A;  4FJU A;  4E9J A;  2UU9 H;  4M0H A;  2OPU A;  2X06 A;  3GR5 A;  4G08 A;  1FJG H;  3T1Y H;  4JI7 H;  1WRU A;  2AXY A;  2CTK A;  1NXU A;  2FFM A;  4JI3 H;  2D1U A;  5BR8 H;  4LFC H;  1X4M A;  2M8W A;  2MJH A;  4DV2 H;  2LTM A;  4DR5 H;  5IT9 W;  4OD6 A;  2L4W A;  1XNR H;  3D37 A;  4EC5 A;  1J4W A;  1S03 G;  3OV5 A;  2W6T A;  4JI5 H;  2CTM A;  2HH3 A;  2A02 A;  2W16 A;  3ADY A;  3RF2 A;  1X4N A;  1X9Z A;  3EZJ A;  1WE8 A;  4X64 H;  2Y3M A;  2YQR A;  4WAN A;  4X62 H;  4AIM A;  1VBI A;  1Z2I A;  2QND A;  2OPV A;  4MTK A;  5C0X G;  1XRH A;  2UUC H;  5LMU H;  4K0K H;  1TUA A;  1ZZJ A;  2Z0S A;  3OSS D;  1N36 H;  1ZTG A;  4JI0 H;  3NCV A;  4NZT M;  4BA1 I;  2O4C A;  2CTF A;  2PT7 G;  4OX9 H;  4JVH A;  2VQE H;  5JEA G;  1I94 H;  1XMO H;  4DV4 H;  2HHH H;  2ZM6 H;  2JA9 A;  2UXD H;  5LMN H;  2FPH X;  2Z6B D;  3GS9 A;  2G8Y A;  4M0N A;  3J80 W;  1ZZK A;  1VIG A;  2P5Z X;  2VQF H;  4DR3 H;  4DR4 H;  3GAB A;  1XMQ H;  4LFB H;  2BL5 A;  2NN6 G;  4JI8 H;  1V9N A;  1J5E H;  5IWA H;  4JYA H;  4JTM A;  4JI6 H;  3OET A;  2ANR A;  1ZZV A;  2UUA H;  1HR0 H;  2IAH A;  2UUB H;  1SEI A;  2BA0 A;  4X65 H;  3T1H H;  2LF0 A;  4LF6 H;  2CTL A;  1WVN A;  4QMF B;  4AQY H;  4DV7 H;  1N34 H;  2CTE A; 
#chains in the Genus database with same CATH homology
 4JI1 H;  2VKC A;  4LF4 H;  3J7A K;  4DUY H;  3FAU A;  4NZR M;  4LFA H;  4X66 H;  4YY3 H;  4B3M H;  1HNZ H;  1WTH D;  4AR0 A;  3QD7 X;  4KHP H;  1N33 H;  4DR7 H;  4DV3 H;  4DR1 H;  2X53 1;  5FLX W;  1ODH A;  1I6U A;  2E5L H;  3KDG A;  2D9I A;  2W78 A;  3OTO H;  1F0X A;  1HNW H;  1FKA H;  2W6U A;  2W75 A;  4YHH H;  4DR6 H;  1AN7 A;  2WZP R;  4NXM H;  4DV5 H;  1IBM H;  2M5J A;  1IBK H;  4JI2 H;  4LF9 H;  4DUZ H;  5DT9 A;  3J81 W;  2ZQE A;  4DV0 H;  4JI4 H;  4DR2 H;  5LL6 b;  4LF7 H;  2F4V H;  4DV6 H;  4LF8 H;  4JV5 H;  4B3R H;  3JAM W;  4B3T H;  2W77 A;  4DV1 H;  1XNQ H;  1K28 D;  4PDB A;  4GKJ H;  2O5P A;  1N32 H;  2W76 A;  4LF5 H;  2UXB H;  4NXN H;  4B3S H;  3KDK A;  3SB1 A;  5A2Q W;  2UXC H;  4GKK H;  4B8C D;  1IBL H;  4OCH A;  1HNX H;  4M0H A;  4E9J A;  2UU9 H;  3GR5 A;  4G08 A;  1FJG H;  3T1Y H;  4JI7 H;  4JI3 H;  2D1U A;  5BR8 H;  4LFC H;  4DV2 H;  4DR5 H;  5IT9 W;  4OD6 A;  2L4W A;  1XNR H;  4EC5 A;  1S03 G;  3OV5 A;  2W6T A;  4JI5 H;  2A02 A;  2W16 A;  3ADY A;  3RF2 A;  1X9Z A;  3EZJ A;  4X64 H;  2Y3M A;  4X62 H;  2UUC H;  5LMU H;  4K0K H;  3OSS D;  1N36 H;  4JI0 H;  3NCV A;  4NZT M;  2O4C A;  2PT7 G;  4OX9 H;  2VQE H;  1I94 H;  1XMO H;  4DV4 H;  2HHH H;  2ZM6 H;  2UXD H;  5LMN H;  2FPH X;  2Z6B D;  3GS9 A;  4M0N A;  3J80 W;  2VQF H;  4DR3 H;  4DR4 H;  3GAB A;  1XMQ H;  4LFB H;  4JI8 H;  1J5E H;  4JYA H;  5IWA H;  4JTM A;  4JI6 H;  3OET A;  1ZZV A;  2UUA H;  1HR0 H;  2IAH A;  2UUB H;  1SEI A;  3T1H H;  4X65 H;  2LF0 A;  4LF6 H;  4AQY H;  4DV7 H;  1N34 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...