4G08A

Crystal structure of the periplasmic domain of invg
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
b'GFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein InvG
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4g08A02
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 4g08A01
3GR5A 4G08A 2W75A 3EZJA 1ZZVA 2M5JA 4JTMA 2O5PA 2A02A 2W78A 2W6UA 2W77A 4M0HA 3OSSD 4E9JA 2W6TA 2IAHA 2W76A 4EC5A 2D1UA 2Y3MA 4AR0A 2W16A 4M0NA
chains in the Genus database with same CATH superfamily
3GKUA 2ANNA 2LTMA 1DTJA 2NN6G 2JEBI 2K1HA 2X06A 1J5EH 4JI6H 3I0PA 1FKAH 2CTLA 3KDKA 5A2QW 4B8CD 1ODHA 1FJGH 2FFMA 1IBMH 3T1YH 2G8YA 3RF2A 1ZZIA 4LF7H 4PDBA 2A1SA 3SB1A 5DT9A 2CPMA 2UXCH 3L7ZC 4GKJH 4JI4H 2PT7G 2CTFA 2LRRA 2CTKA 4JYAH 1DT4A 4OCHA 1F0XA 4AIMA 1WVNA 5K36G 1MSZA 3GABA 2LF0A 4OX9H 4E9JA 4NXNH 3OTOH 4DV5H 1VIHA 4BA1I 2IAHA 2OPVA 3J80W 4LIJA 1PQXA 2M6QA 2M8WA 2L4WA 2FPHX 1N34H 2UXBH 1X0AA 4JVYA 2D1UA 4NZRM 1HNWH 2D9IA 4FJUA 3V69A 4JV5H 4LF6H 4WANA 2E3UA 2P5ZX 4M0NA 4MTKA 4GKKH 3FAUA 2DGRA 2LTLA 1N32H 2O4CA 2Z6BD 3ADYA 3EZJA 4DR1H 2M5JA 5JEAG 1Z2IA 5LMNH 2E5LH 4JVHA 1K28D 2P2RA 1K1GA 1VBIA 4LFCH 3JAMW 3AEVB 2UXDH 1I6UA 4DV7H 4JI2H 4YHHH 1ZZJA 4AM3A 1UG8A 2W6UA 1S20A 1X4MA 4X64H 2UUCH 1SEIA 1N36H 4BA2I 4B3RH 3KDGA 5LL6b 2VQFH 4LFBH 2CPQA 2W6TA 1XMQH 1WE8A 4EC5A 1XNRH 4B3SH 4IFDG 1EC6A 1IBKH 4DV0H 2PQUA 4X62H 4G08A 4LF9H 1N33H 1WTHD 3NCVA 4OD6A 2HH2A 2F4VH 2FMRA 1ZZVA 4DUYH 2CTMA 5FLXW 3J81W 3CDDA 2O5PA 1AN7A 4DV6H 1X9ZA 3T1HH 2AXYA 4LF4H 1J5KA 1ZZKA 2A02A 1HNZH 2Z0SA 2W78A 2W77A 4LF5H 2CWFA 1X4NA 5IWAH 2JEAI 4M0HA 1VIGA 4B3TH 4DUZH 2JA9A 4DR5H 2WZPR 1S03G 2CTEA 4DV4H 2VKCA 4UHVA 1HNXH 2CTJA 2ZM6H 3J7AK 4DV1H 4K0KH 4LFAH 4DR2H 2UU9H 4QMFB 1J4WA 2CWHA 2BL5A 2JZXA 2PY9A 4AR0A 4NXMH 4OO1G 3D37A 1I94H 2ZQEA 1WTJA 5C0XG 1TUAA 3GR5A 2UUAH 1WRUA 3GS9A 4B3MH 4DR7H 5LMUH 4DR4H 2W75A 1XNQH 3OETA 4KHPH 4JI3H 2ANRA 1V9NA 4WALA 2OPUA 4NZTM 4X65H 1XMOH 3QD7X 4NBQA 2HHHH 2UUBH 4DR6H 2X531 4JTMA 3U1KA 4JI8H 2YQRA 4LF8H 3UOEA 4X66H 4JI0H 5IT9W 4YY3H 4FJSA 4AQYH 1ZTGA 3OSSD 2QNDA 3OV5A 1HR0H 1XRHA 4DV3H 1V8CA 2BA0A 2MJHA 1IBLH 2JVZA 4DR3H 1WHRA 2JE6I 4JI5H 2W76A 4JI1H 2VQEH 4B8TA 3VKEA 4H8AA 4JI7H 2Y3MA 5BR8H 1NXUA 4DV2H 1KHMA 2W16A 2HH3A
chains in the Genus database with same CATH topology
1J5EH 4JI6H 1FKAH 3KDKA 5A2QW 4B8CD 1ODHA 1FJGH 4PDBA 1IBMH 3T1YH 3RF2A 4LF7H 3SB1A 5DT9A 2UXCH 4GKJH 4JI4H 2PT7G 4JYAH 4OCHA 1F0XA 3GABA 2LF0A 4OX9H 4E9JA 4NXNH 3OTOH 4DV5H 2IAHA 3J80W 2L4WA 2FPHX 1N34H 2UXBH 2D1UA 4NZRM 1HNWH 2D9IA 4JV5H 4LF6H 4M0NA 4GKKH 3FAUA 2Z6BD 1N32H 2O4CA 3ADYA 3EZJA 4DR1H 2M5JA 5LMNH 2E5LH 1K28D 2UXDH 4LFCH 3JAMW 1I6UA 4DV7H 4JI2H 4YHHH 2W6UA 4X64H 2UUCH 1SEIA 1N36H 4B3RH 3KDGA 5LL6b 2VQFH 4LFBH 2W6TA 1XMQH 4EC5A 1XNRH 4B3SH 1IBKH 4DV0H 4X62H 4G08A 4LF9H 1N33H 1WTHD 3NCVA 4OD6A 2F4VH 1ZZVA 4DUYH 5FLXW 3J81W 2O5PA 1AN7A 4DV6H 1X9ZA 3T1HH 4LF4H 2A02A 1HNZH 2W78A 2W77A 4LF5H 5IWAH 4M0HA 4B3TH 4DUZH 4DR5H 2WZPR 1S03G 4DV4H 2VKCA 1HNXH 2ZM6H 3J7AK 4DV1H 4K0KH 4LFAH 4DR2H 2UU9H 4AR0A 4NXMH 1I94H 2ZQEA 3GR5A 2UUAH 3GS9A 4B3MH 4DR7H 5LMUH 4DR4H 2W75A 1XNQH 3OETA 4KHPH 1XMOH 4JI3H 4NZTM 4X65H 3QD7X 2HHHH 2UUBH 4DR6H 2X531 4JTMA 4JI8H 4LF8H 4X66H 4JI0H 5IT9W 4YY3H 4AQYH 3OSSD 3OV5A 1HR0H 4DV3H 1IBLH 4DR3H 4JI5H 2W76A 4JI1H 2VQEH 4JI7H 2Y3MA 5BR8H 4DV2H 2W16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR5 A;  4G08 A;  2W75 A;  3EZJ A;  1ZZV A;  2M5J A;  4JTM A;  2O5P A;  2A02 A;  2W78 A;  2W6U A;  2W77 A;  4M0H A;  3OSS D;  4E9J A;  2W6T A;  2IAH A;  2W76 A;  4EC5 A;  2D1U A;  2Y3M A;  4AR0 A;  2W16 A;  4M0N A; 
#chains in the Genus database with same CATH topology
 3GKU A;  2ANN A;  2LTM A;  1DTJ A;  2NN6 G;  2JEB I;  2K1H A;  2X06 A;  1J5E H;  4JI6 H;  3I0P A;  1FKA H;  2CTL A;  3KDK A;  5A2Q W;  4B8C D;  1ODH A;  1FJG H;  2FFM A;  1IBM H;  3T1Y H;  2G8Y A;  3RF2 A;  1ZZI A;  4LF7 H;  4PDB A;  2A1S A;  3SB1 A;  5DT9 A;  2CPM A;  2UXC H;  3L7Z C;  4GKJ H;  4JI4 H;  2PT7 G;  2CTF A;  2LRR A;  2CTK A;  4JYA H;  1DT4 A;  4OCH A;  1F0X A;  4AIM A;  1WVN A;  5K36 G;  1MSZ A;  3GAB A;  2LF0 A;  4OX9 H;  4E9J A;  4NXN H;  3OTO H;  4DV5 H;  1VIH A;  4BA1 I;  2IAH A;  2OPV A;  3J80 W;  4LIJ A;  1PQX A;  2M6Q A;  2M8W A;  2L4W A;  2FPH X;  1N34 H;  2UXB H;  1X0A A;  4JVY A;  2D1U A;  4NZR M;  1HNW H;  2D9I A;  4FJU A;  3V69 A;  4JV5 H;  4LF6 H;  4WAN A;  2E3U A;  2P5Z X;  4M0N A;  4MTK A;  4GKK H;  3FAU A;  2DGR A;  2LTL A;  1N32 H;  2O4C A;  2Z6B D;  3ADY A;  3EZJ A;  4DR1 H;  2M5J A;  5JEA G;  1Z2I A;  5LMN H;  2E5L H;  4JVH A;  1K28 D;  2P2R A;  1K1G A;  1VBI A;  4LFC H;  3JAM W;  3AEV B;  2UXD H;  1I6U A;  4DV7 H;  4JI2 H;  4YHH H;  1ZZJ A;  4AM3 A;  1UG8 A;  2W6U A;  1S20 A;  1X4M A;  4X64 H;  2UUC H;  1SEI A;  1N36 H;  4BA2 I;  4B3R H;  3KDG A;  5LL6 b;  2VQF H;  4LFB H;  2CPQ A;  2W6T A;  1XMQ H;  1WE8 A;  4EC5 A;  1XNR H;  4B3S H;  4IFD G;  1EC6 A;  1IBK H;  4DV0 H;  2PQU A;  4X62 H;  4G08 A;  4LF9 H;  1N33 H;  1WTH D;  3NCV A;  4OD6 A;  2HH2 A;  2F4V H;  2FMR A;  1ZZV A;  4DUY H;  2CTM A;  5FLX W;  3J81 W;  3CDD A;  2O5P A;  1AN7 A;  4DV6 H;  1X9Z A;  3T1H H;  2AXY A;  4LF4 H;  1J5K A;  1ZZK A;  2A02 A;  1HNZ H;  2Z0S A;  2W78 A;  2W77 A;  4LF5 H;  2CWF A;  1X4N A;  5IWA H;  2JEA I;  4M0H A;  1VIG A;  4B3T H;  4DUZ H;  2JA9 A;  4DR5 H;  2WZP R;  1S03 G;  2CTE A;  4DV4 H;  2VKC A;  4UHV A;  1HNX H;  2CTJ A;  2ZM6 H;  3J7A K;  4DV1 H;  4K0K H;  4LFA H;  4DR2 H;  2UU9 H;  4QMF B;  1J4W A;  2CWH A;  2BL5 A;  2JZX A;  2PY9 A;  4AR0 A;  4NXM H;  4OO1 G;  3D37 A;  1I94 H;  2ZQE A;  1WTJ A;  5C0X G;  1TUA A;  3GR5 A;  2UUA H;  1WRU A;  3GS9 A;  4B3M H;  4DR7 H;  5LMU H;  4DR4 H;  2W75 A;  1XNQ H;  3OET A;  4KHP H;  4JI3 H;  2ANR A;  1V9N A;  4WAL A;  2OPU A;  4NZT M;  4X65 H;  1XMO H;  3QD7 X;  4NBQ A;  2HHH H;  2UUB H;  4DR6 H;  2X53 1;  4JTM A;  3U1K A;  4JI8 H;  2YQR A;  4LF8 H;  3UOE A;  4X66 H;  4JI0 H;  5IT9 W;  4YY3 H;  4FJS A;  4AQY H;  1ZTG A;  3OSS D;  2QND A;  3OV5 A;  1HR0 H;  1XRH A;  4DV3 H;  1V8C A;  2BA0 A;  2MJH A;  1IBL H;  2JVZ A;  4DR3 H;  1WHR A;  2JE6 I;  4JI5 H;  2W76 A;  4JI1 H;  2VQE H;  4B8T A;  3VKE A;  4H8A A;  4JI7 H;  2Y3M A;  5BR8 H;  1NXU A;  4DV2 H;  1KHM A;  2W16 A;  2HH3 A; 
#chains in the Genus database with same CATH homology
 1J5E H;  4JI6 H;  1FKA H;  3KDK A;  5A2Q W;  4B8C D;  1ODH A;  1FJG H;  4PDB A;  1IBM H;  3T1Y H;  3RF2 A;  4LF7 H;  3SB1 A;  5DT9 A;  2UXC H;  4GKJ H;  4JI4 H;  2PT7 G;  4JYA H;  4OCH A;  1F0X A;  3GAB A;  2LF0 A;  4OX9 H;  4E9J A;  4NXN H;  3OTO H;  4DV5 H;  2IAH A;  3J80 W;  2L4W A;  2FPH X;  1N34 H;  2UXB H;  2D1U A;  4NZR M;  1HNW H;  2D9I A;  4JV5 H;  4LF6 H;  4M0N A;  4GKK H;  3FAU A;  2Z6B D;  1N32 H;  2O4C A;  3ADY A;  3EZJ A;  4DR1 H;  2M5J A;  5LMN H;  2E5L H;  1K28 D;  2UXD H;  4LFC H;  3JAM W;  1I6U A;  4DV7 H;  4JI2 H;  4YHH H;  2W6U A;  4X64 H;  2UUC H;  1SEI A;  1N36 H;  4B3R H;  3KDG A;  5LL6 b;  2VQF H;  4LFB H;  2W6T A;  1XMQ H;  4EC5 A;  1XNR H;  4B3S H;  1IBK H;  4DV0 H;  4X62 H;  4G08 A;  4LF9 H;  1N33 H;  1WTH D;  3NCV A;  4OD6 A;  2F4V H;  1ZZV A;  4DUY H;  5FLX W;  3J81 W;  2O5P A;  1AN7 A;  4DV6 H;  1X9Z A;  3T1H H;  4LF4 H;  2A02 A;  1HNZ H;  2W78 A;  2W77 A;  4LF5 H;  5IWA H;  4M0H A;  4B3T H;  4DUZ H;  4DR5 H;  2WZP R;  1S03 G;  4DV4 H;  2VKC A;  1HNX H;  2ZM6 H;  3J7A K;  4DV1 H;  4K0K H;  4LFA H;  4DR2 H;  2UU9 H;  4AR0 A;  4NXM H;  1I94 H;  2ZQE A;  3GR5 A;  2UUA H;  3GS9 A;  4B3M H;  4DR7 H;  5LMU H;  4DR4 H;  2W75 A;  1XNQ H;  3OET A;  4KHP H;  1XMO H;  4JI3 H;  4NZT M;  4X65 H;  3QD7 X;  2HHH H;  2UUB H;  4DR6 H;  2X53 1;  4JTM A;  4JI8 H;  4LF8 H;  4X66 H;  4JI0 H;  5IT9 W;  4YY3 H;  4AQY H;  3OSS D;  3OV5 A;  1HR0 H;  4DV3 H;  1IBL H;  4DR3 H;  4JI5 H;  2W76 A;  4JI1 H;  2VQE H;  4JI7 H;  2Y3M A;  5BR8 H;  4DV2 H;  2W16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...