The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
97
|
structure length |
97
|
Chain Sequence |
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb |
| molecule tags |
Dna binding protein/toxin
|
| source organism |
Escherichia coli k-12
|
| molecule keywords |
HTH-type transcriptional regulator mqsA(ygiT)
|
| total genus |
28
|
| structure length |
97
|
| sequence length |
97
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2009-05-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF15723 | MqsR_toxin | Motility quorum-sensing regulator, toxin of MqsA |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | YaeB-like fold | YaeB-like fold |
#chains in the Genus database with same CATH superfamily 3HI2 B; #chains in the Genus database with same CATH topology 4LS4 A; 3BPQ B; 4FXI A; 3HI2 B; 2A6R A; 2KHE A; 3G5O B; 2A8K A; 2OTR A; 4FXE D; 3AO9 A; 5CW7 B; 5CZF C; 4LSY A; 4LTT A; 4ML0 B; 5IWH A; 5IXL A; 5CZE B; 4MCT B; 5CEG B; 1WMI A; 2FHZ B; 2KC9 A; 4PX8 A; 2DJH A; 3OEI C; 4MMG A; 4FBD A; 2PD0 A; 4FXH A; 2DFX E; 4MCX B; 2A6S A; 2KC8 A; 4Q2U B; 1XQB A; 2A6Q E; 4MMJ A; 3KXE A; 4NRN A; 4YY3 Y; 4ML2 A; 3VJ7 A; 1Z8M A; #chains in the Genus database with same CATH homology 2FHZ B; 3HI2 B; 3VJ7 A; 2DJH A; 4FBD A; 2A8K A; 2PD0 A; 3AO9 A; 2DFX E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
