The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
135
|
sequence length |
364
|
structure length |
364
|
Chain Sequence |
PAGNTALCTVGKSGNDLHYRGYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPETDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRPFVSIDDRC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of Salmonella typhimurium 2-methylcitrate synthase: Insights on domain movement and substrate specificity
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Salmonella enterica
|
molecule keywords |
2-methylcitrate synthase
|
total genus |
135
|
structure length |
364
|
sequence length |
364
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J
|
ec nomenclature |
ec
2.3.3.16: Citrate synthase (unknown stereospecificity). |
pdb deposition date | 2010-08-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00285 | Citrate_synt | Citrate synthase, C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Cytochrome p450-Terp; domain 2 | Cytochrome P450-Terp, domain 2 | ||
Mainly Alpha | Orthogonal Bundle | Citrate Synthase; domain 1 | Citrate Synthase, domain 1 |
#chains in the Genus database with same CATH superfamily 2P2W A; 6CSC A; 1NXG A; 1CSC A; 1IXE A; 5CTS A; 4G6B A; 1VGM A; 2H12 A; 1CSI A; 2R26 A; 4CTS A; 1O7X A; 3MSU A; 1OWB A; 1VGP A; 4CSC A; 4JAD A; 1CSH A; 1CSR A; 1AMZ A; 4XGH A; 3HWK A; 1CSS A; 2IFC A; 5CSC B; 6CTS A; 4YBO A; 1AJ8 A; 3TQG A; 4JAF A; 3O8J A; 2CTS A; 3CSC A; 4JAE A; 1A59 A; 1IOM A; 2R9E A; 2CSC A; 4JAG A; 1NXE A; 1OWC A; 1AL6 A; 2IBP A; 4E6Y A; 4TVM A; 3ENJ A; 2C6X A; 1CTS A; 5CSC A; #chains in the Genus database with same CATH topology 2P2W A; 6CSC A; 1NXG A; 1CSC A; 1IXE A; 5CTS A; 4G6B A; 1VGM A; 2H12 A; 1CSI A; 2R26 A; 4CTS A; 1O7X A; 3MSU A; 1OWB A; 1VGP A; 4CSC A; 4JAD A; 1CSH A; 1CSR A; 4XGH A; 1AMZ A; 3HWK A; 1CSS A; 2IFC A; 5CSC B; 6CTS A; 4YBO A; 1AJ8 A; 3TQG A; 4JAF A; 3O8J A; 2CTS A; 3CSC A; 4JAE A; 1A59 A; 1IOM A; 2R9E A; 2CSC A; 4JAG A; 1NXE A; 1OWC A; 1AL6 A; 2IBP A; 4E6Y A; 4TVM A; 3ENJ A; 2C6X A; 1CTS A; 5CSC A; #chains in the Genus database with same CATH homology 2P2W A; 6CSC A; 1NXG A; 1CSC A; 1IXE A; 5CTS A; 4G6B A; 1VGM A; 2H12 A; 1CSI A; 2R26 A; 4CTS A; 1O7X A; 3MSU A; 1OWB A; 1VGP A; 4CSC A; 4JAD A; 1CSH A; 1CSR A; 1AMZ A; 4XGH A; 3HWK A; 1CSS A; 2IFC A; 5CSC B; 6CTS A; 4YBO A; 1AJ8 A; 3TQG A; 4JAF A; 3O8J A; 2CTS A; 3CSC A; 4JAE A; 1A59 A; 1IOM A; 2R9E A; 2CSC A; 4JAG A; 1NXE A; 1OWC A; 1AL6 A; 2IBP A; 4E6Y A; 4TVM A; 3ENJ A; 2C6X A; 1CTS A; 5CSC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...