The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
90
|
structure length |
90
|
Chain Sequence |
SHMLKLNLKKSFQKDFDKLLLNGFDDSVLNEVILTLRKKEPLDPQFQDHALKGKWKPFRECHIKPDVSLVYLVKDDELILLRLGSHSELF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of apo and copper bound HP0894 toxin from Helicobacter pylori 26695 and insight into mRNase activity
pubmed doi rcsb |
molecule tags |
Toxin
|
source organism |
Helicobacter pylori
|
molecule keywords |
Uncharacterized protein, Toxin
|
total genus |
26
|
structure length |
90
|
sequence length |
90
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-07-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05016 | ParE_toxin | ParE toxin of type II toxin-antitoxin system, parDE |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | YaeB-like fold | RelE-like |
#chains in the Genus database with same CATH superfamily 5CZE B; 4ML2 A; 5IWH A; 4PX8 A; 4MMJ A; 5CW7 B; 1Z8M A; 1WMI A; 2KC9 A; 4ML0 B; 4MCX B; 4YY3 Y; 4FXH A; 2A6S A; 2KC8 A; 2OTR A; 4LTT A; 3BPQ B; 2A6R A; 5CEG B; 4LS4 A; 4LSY A; 4NRN A; 5IXL A; 4MCT B; 3KXE A; 2A6Q E; 5CZF C; 4FXI A; 4Q2U B; 2KHE A; 3OEI C; 3G5O B; 4FXE D; 4MMG A; #chains in the Genus database with same CATH topology 5CZE B; 4ML2 A; 5IWH A; 4PX8 A; 4MMJ A; 5CW7 B; 2DFX E; 2A8K A; 1Z8M A; 2DJH A; 1WMI A; 2KC9 A; 1XQB A; 4ML0 B; 3AO9 A; 4MCX B; 2PD0 A; 4YY3 Y; 4FXH A; 3HI2 B; 2A6S A; 2KC8 A; 2OTR A; 4LTT A; 3BPQ B; 2A6R A; 5CEG B; 4FBD A; 4LS4 A; 4LSY A; 4NRN A; 5IXL A; 4MCT B; 3KXE A; 2A6Q E; 5CZF C; 2FHZ B; 4FXI A; 4Q2U B; 2KHE A; 3OEI C; 3G5O B; 4FXE D; 4MMG A; 3VJ7 A; #chains in the Genus database with same CATH homology 5CZE B; 4ML2 A; 5IWH A; 4PX8 A; 4MMJ A; 5CW7 B; 1Z8M A; 1WMI A; 2KC9 A; 4ML0 B; 4MCX B; 4YY3 Y; 4FXH A; 2A6S A; 2KC8 A; 2OTR A; 4LTT A; 3BPQ B; 2A6R A; 5CEG B; 4LS4 A; 4LSY A; 4NRN A; 5IXL A; 4MCT B; 3KXE A; 2A6Q E; 5CZF C; 4FXI A; 4Q2U B; 2KHE A; 3OEI C; 3G5O B; 4FXE D; 4MMG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...