The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
149
|
sequence length |
433
|
structure length |
429
|
Chain Sequence |
ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKGGGGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAAGADASLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQGAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLIAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Proposed mechanism for the condensation reaction of citrate synthase: 1.9-A structure of the ternary complex with oxaloacetate and carboxymethyl coenzyme A.
pubmed doi rcsb |
| molecule keywords |
CITRATE SYNTHASE
|
| molecule tags |
Oxo-acid-lyase
|
| source organism |
Gallus gallus
|
| total genus |
149
|
| structure length |
429
|
| sequence length |
433
|
| ec nomenclature |
ec
2.3.3.1: Citrate (Si)-synthase. |
| pdb deposition date | 1989-11-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00285 | Citrate_synt | Citrate synthase, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Cytochrome p450-Terp; domain 2 | Cytochrome P450-Terp, domain 2 | ||
| Mainly Alpha | Orthogonal Bundle | Citrate Synthase; domain 1 | Citrate Synthase, domain 1 |
#chains in the Genus database with same CATH superfamily 1CSR A; 2CTS A; 2CSC A; 4CTS A; 3HWK A; 5CSC B; 4JAD A; 4JAG A; 2R9E A; 1AL6 A; 1AJ8 A; 1VGP A; 5CSC A; 4JAF A; 1NXG A; 1CSI A; 1AMZ A; 3CSC A; 5CTS A; 4XGH A; 2H12 A; 1O7X A; 2IFC A; 2IBP A; 4TVM A; 1IXE A; 1NXE A; 2C6X A; 4JAE A; 1VGM A; 1CSH A; 1CSC A; 3TQG A; 1OWB A; 1A59 A; 1OWC A; 3ENJ A; 2R26 A; 4G6B A; 4E6Y A; 3O8J A; 6CTS A; 2P2W A; 4YBO A; 4CSC A; 1CSS A; 3MSU A; 6CSC A; 1IOM A; 1CTS A; #chains in the Genus database with same CATH topology 1CSR A; 2CTS A; 2CSC A; 4CTS A; 3HWK A; 5CSC B; 4JAD A; 4JAG A; 2R9E A; 1AL6 A; 1AJ8 A; 1VGP A; 5CSC A; 4JAF A; 1NXG A; 1CSI A; 1AMZ A; 3CSC A; 5CTS A; 4XGH A; 2H12 A; 1O7X A; 2IFC A; 2IBP A; 4TVM A; 1IXE A; 1NXE A; 2C6X A; 4JAE A; 1VGM A; 1CSH A; 1CSC A; 3TQG A; 1OWB A; 1A59 A; 1OWC A; 3ENJ A; 2R26 A; 4G6B A; 4E6Y A; 3O8J A; 6CTS A; 2P2W A; 4YBO A; 4CSC A; 1CSS A; 3MSU A; 6CSC A; 1IOM A; 1CTS A; #chains in the Genus database with same CATH homology 1CSR A; 2CTS A; 2CSC A; 4CTS A; 3HWK A; 5CSC B; 4JAD A; 4JAG A; 2R9E A; 1AL6 A; 1AJ8 A; 1VGP A; 5CSC A; 4JAF A; 1NXG A; 1CSI A; 1AMZ A; 3CSC A; 5CTS A; 4XGH A; 2H12 A; 1O7X A; 2IFC A; 2IBP A; 4TVM A; 1IXE A; 1NXE A; 2C6X A; 4JAE A; 1VGM A; 1CSH A; 1CSC A; 3TQG A; 1OWB A; 1A59 A; 1OWC A; 3ENJ A; 2R26 A; 4G6B A; 4E6Y A; 3O8J A; 6CTS A; 2P2W A; 4YBO A; 4CSC A; 1CSS A; 3MSU A; 6CSC A; 1IOM A; 1CTS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...