The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
245
|
structure length |
244
|
Chain Sequence |
LRNLPINQVGIKDLRFPITLKTAEGTQSTVARLTMTVYLPAEQKGTHMSRFVALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYDVSLTGEMKDGAYGHSMKVMIPVTSLCPSKEISQYGAHNQRSHVTVSLTSDAEVGIEEVIDYVETQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKRIKSFVVESENFESIHNHSAYAYIAYP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase, biosynthetic protein
|
| molecule keywords |
GTP cyclohydrolase FolE2
|
| publication title |
Zinc-independent folate biosynthesis: genetic, biochemical, and structural investigations reveal new metal dependence for GTP cyclohydrolase IB.
pubmed doi rcsb |
| source organism |
Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
|
| total genus |
68
|
| structure length |
244
|
| sequence length |
245
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.5.4.16: GTP cyclohydrolase I. |
| pdb deposition date | 2016-05-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02649 | GCHY-1 | Type I GTP cyclohydrolase folE2 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Urate Oxidase | Urate Oxidase; |
#chains in the Genus database with same CATH superfamily 4CW2 A; 4CW0 A; 3LBG A; 3BJP A; 4D17 A; 1VAY A; 4R8X A; 1WRR A; 4OP9 A; 3L9G A; 3PLM A; 4XFP A; 1VAX A; 3PKG A; 2FXL A; 3P9F A; 1WS2 A; 3OBP A; 1R51 A; 4OP6 A; 3D2O A; 3LD4 A; 3PK5 A; 2ZKB A; 3P9O A; 3CKS A; 1R4U A; 4CW3 A; 4D12 A; 4MB8 A; 5AYJ A; 2R5R A; 4CW6 A; 4D13 A; 5M98 A; 1J2G A; 3PJK A; 1R4S A; 3PKH A; 3PLH A; 1WS3 A; 2YZC A; 1XXJ A; 3PLE A; 3PKS A; 4N9M A; 5FRC A; 4R99 A; 3PKK A; 4PUV A; 2IBA A; 4FSK A; 3GKO A; 3PKU A; 5LL1 A; 2YZE A; 3PLG A; 3BK8 A; 3F2M A; 4OQC A; 2ZKA A; 3PKL A; 4N3M A; 1R56 A; 2YZB A; 2YZD A; 2ICQ A; 3PK8 A; 5K9G A; 3L8W A; 3PK6 A; 2IC0 A; 4N9S A; 4D19 A; 4N9V A; 1XT4 A; 3PKF A; 3PKT A; 5K95 A; 3PK4 A; 2PES A; 4PR8 A; 4POE A; 3CKU A; 3PLJ A; 3PK3 A; 3PLI A; 3WLV A; 2FUB A; 1XY3 A; #chains in the Genus database with same CATH topology 4CW2 A; 4CW0 A; 3LBG A; 3BJP A; 4D17 A; 1VAY A; 4R8X A; 1WRR A; 4OP9 A; 3L9G A; 3PLM A; 4XFP A; 1VAX A; 3PKG A; 2FXL A; 3P9F A; 1WS2 A; 3OBP A; 1R51 A; 4OP6 A; 3D2O A; 3LD4 A; 3PK5 A; 2ZKB A; 3P9O A; 3CKS A; 1R4U A; 4CW3 A; 4D12 A; 4MB8 A; 5AYJ A; 2R5R A; 4CW6 A; 4D13 A; 5M98 A; 1J2G A; 3PJK A; 1R4S A; 3PKH A; 3PLH A; 1WS3 A; 2YZC A; 1XXJ A; 3PLE A; 3PKS A; 4N9M A; 5FRC A; 4R99 A; 3PKK A; 4PUV A; 2IBA A; 4FSK A; 3GKO A; 3PKU A; 5LL1 A; 2YZE A; 3PLG A; 3BK8 A; 3F2M A; 4OQC A; 2ZKA A; 3PKL A; 4N3M A; 1R56 A; 2YZB A; 2YZD A; 2ICQ A; 3PK8 A; 5K9G A; 3L8W A; 3PK6 A; 2IC0 A; 4N9S A; 4D19 A; 4N9V A; 1XT4 A; 3PKF A; 3PKT A; 5K95 A; 3PK4 A; 2PES A; 4PR8 A; 4POE A; 3CKU A; 3PLJ A; 3PK3 A; 3PLI A; 3WLV A; 2FUB A; 1XY3 A; #chains in the Genus database with same CATH homology 4CW2 A; 4CW0 A; 3LBG A; 3BJP A; 4D17 A; 1VAY A; 4R8X A; 1WRR A; 4OP9 A; 3L9G A; 3PLM A; 4XFP A; 1VAX A; 3PKG A; 2FXL A; 3P9F A; 1WS2 A; 3OBP A; 1R51 A; 4OP6 A; 3D2O A; 3LD4 A; 3PK5 A; 2ZKB A; 3P9O A; 3CKS A; 1R4U A; 4CW3 A; 4D12 A; 4MB8 A; 5AYJ A; 2R5R A; 4CW6 A; 4D13 A; 5M98 A; 1J2G A; 3PJK A; 1R4S A; 3PKH A; 3PLH A; 1WS3 A; 2YZC A; 1XXJ A; 3PLE A; 3PKS A; 4N9M A; 5FRC A; 4R99 A; 3PKK A; 4PUV A; 2IBA A; 4FSK A; 3GKO A; 3PKU A; 5LL1 A; 2YZE A; 3PLG A; 3BK8 A; 3F2M A; 4OQC A; 2ZKA A; 3PKL A; 4N3M A; 1R56 A; 2YZB A; 2YZD A; 2ICQ A; 3PK8 A; 5K9G A; 3L8W A; 3PK6 A; 2IC0 A; 4N9S A; 4D19 A; 4N9V A; 1XT4 A; 3PKF A; 3PKT A; 5K95 A; 3PK4 A; 2PES A; 4PR8 A; 4POE A; 3CKU A; 3PLJ A; 3PK3 A; 3PLI A; 3WLV A; 2FUB A; 1XY3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
