The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The NMR solution structure of the pheromone Er-1 from the ciliated protozoan Euplotes raikovi.
pubmed rcsb |
molecule tags |
Pheromone
|
source organism |
Euplotes raikovi
|
molecule keywords |
PHEROMONE ER-1
|
total genus |
14
|
structure length |
40
|
sequence length |
40
|
ec nomenclature | |
pdb deposition date | 1994-02-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06360 | E_raikovi_mat | Euplotes raikovi mating pheromone |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Pheromone ER-1 | Pheromone ER-1 |
#chains in the Genus database with same CATH superfamily 2ERL A; 1ERC A; #chains in the Genus database with same CATH topology 4EDT A; 4EDR A; 2JMS A; 2KK2 A; 3B39 A; 1EQN A; 2LMK A; 4EDV A; 3CU7 A; 4EDG A; 4EDK A; 2AU3 A; 2B39 A; 2KC6 A; 4E2K A; 2ERL A; 2NSV A; 4EE1 A; 2NSW A; 3KXR A; 1DDE A; 1DD9 A; 3KLS A; 1ERC A; #chains in the Genus database with same CATH homology 4EDT A; 4EDR A; 2JMS A; 2KK2 A; 3B39 A; 1EQN A; 2LMK A; 4EDV A; 3CU7 A; 4EDG A; 4EDK A; 2AU3 A; 2B39 A; 2KC6 A; 4E2K A; 2ERL A; 2NSV A; 4EE1 A; 2NSW A; 3KXR A; 1DDE A; 1DD9 A; 3KLS A; 1ERC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...